Citrus Sinensis ID: 046319

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MELQLQFFQEEGKQLLRLLLLRRGRKRRRRVMKTWVSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPSTKEIAEAYLGQALKNAVVTVPAYFNDS
ccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccEEEEEEEccEEEEEEccccccccccEEEEcccccHHHHHHHHHHcccccccEEEcccccccccccHHHHHHHHHHcccccccEEEEEcccEEcc
cHHHHHHHHHHHHHHHHHHHHHHHHHHcHcccccEEEEEEEEEEEEEEccEEEEcccccccccEEccEEEccccEEEcHHHHHcHHHcHHHEEccHHHHcccccccHHHHHHHHHHHcccccEEEEEEcccccHH
MELQLQFFQEEGKQLLRLLLLRRGRKRRRRVMKTWVSLFLISCVGVWKNDRVQIIAndqgnrttpsyvaftdtERLIGdaaknqvatnpqntvfdAKLLIrrrfsdpstKEIAEAYLGQALKNAVvtvpayfnds
MELQLQFFQEEGKQLLRLLllrrgrkrrrrvmktwVSLFLISCVGVWKNDRVQIiandqgnrttpsyVAFTDTERLIGDAaknqvatnpqntvfdakllirrRFSDPSTKEIAEAylgqalknavVTVPAYFNDS
MELQLQFFQEEGKQllrllllrrgrkrrrrVMKTWVSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPSTKEIAEAYLGQALKNAVVTVPAYFNDS
******FFQEEGKQLLRLLLLRRGRKRRRRVMKTWVSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPSTKEIAEAYLGQALKNAVVTVPAYF***
*****QFFQEEGKQLLRLL****************VSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPSTKEIAEAYLGQALKNAVVTVPAYFND*
MELQLQFFQEEGKQLLRLLLLRRGRKRRRRVMKTWVSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPSTKEIAEAYLGQALKNAVVTVPAYFNDS
MELQLQFFQEEGKQLLRLLLLRRGRKRRRRVMKTWVSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPSTKEIAEAYLGQALKNAVVTVPAYFNDS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELQLQFFQEEGKQLLRLLLLRRGRKRRRRVMKTWVSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPSTKEIAEAYLGQALKNAVVTVPAYFNDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
Q9S9N1 646 Heat shock 70 kDa protein yes no 0.696 0.145 0.582 2e-37
P26413 645 Heat shock 70 kDa protein yes no 0.696 0.145 0.582 2e-36
P09189 651 Heat shock cognate 70 kDa N/A no 0.696 0.144 0.589 2e-36
Q9C7X7 617 Heat shock 70 kDa protein no no 0.696 0.152 0.575 2e-36
P41753 652 Heat shock 70 kDa protein N/A no 0.696 0.144 0.553 3e-36
P11143 645 Heat shock 70 kDa protein N/A no 0.696 0.145 0.586 6e-36
P36415 640 Heat shock cognate 70 kDa yes no 0.696 0.146 0.561 9e-36
P05456 680 Heat shock 70 kDa protein N/A no 0.696 0.138 0.561 1e-35
P22954 653 Probable mediator of RNA no no 0.696 0.143 0.568 2e-35
Q9LHA8 650 Probable mediator of RNA no no 0.696 0.144 0.568 2e-35
>sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 Back     alignment and function desciption
 Score =  154 bits (388), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 87/139 (62%), Gaps = 45/139 (32%)

Query: 42  SCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIR 101
           SCVGVW NDRV+II NDQGNRTTPSYVAFTDTERLIGDAAKNQVA NPQNTVFDAK LI 
Sbjct: 18  SCVGVWMNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIG 77

Query: 102 RRFSDPST---------------------------------------------KEIAEAY 116
           R+FSDPS                                              KE+AEA+
Sbjct: 78  RKFSDPSVQSDILHWPFKVVSGPGEKPMIVVSYKNEEKQFSPEEISSMVLVKMKEVAEAF 137

Query: 117 LGQALKNAVVTVPAYFNDS 135
           LG+ +KNAVVTVPAYFNDS
Sbjct: 138 LGRTVKNAVVTVPAYFNDS 156
In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
Arabidopsis thaliana (taxid: 3702)
>sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 Back     alignment and function description
>sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=1 SV=1 Back     alignment and function description
>sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 Back     alignment and function description
>sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 Back     alignment and function description
>sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 Back     alignment and function description
>sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 Back     alignment and function description
>sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 Back     alignment and function description
>sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
255543357 654 heat shock protein, putative [Ricinus co 0.696 0.143 0.611 6e-38
224115756 655 predicted protein [Populus trichocarpa] 0.696 0.143 0.611 2e-37
186898205 655 heat-shock protein 70 [Hevea brasiliensi 0.696 0.143 0.611 2e-37
255543359 655 heat shock protein, putative [Ricinus co 0.696 0.143 0.611 5e-37
409893161233 hypothetical protein, partial [Scutellar 0.696 0.403 0.597 3e-36
224115828 655 predicted protein [Populus trichocarpa] 0.696 0.143 0.589 5e-36
148910696 652 unknown [Picea sitchensis] gi|224284393| 0.696 0.144 0.589 7e-36
15219109 646 heat shock protein 70B [Arabidopsis thal 0.696 0.145 0.582 2e-35
224072743 651 predicted protein [Populus trichocarpa] 0.688 0.142 0.594 2e-35
562006 648 PsHSP71.2 [Pisum sativum] gi|1771479|emb 0.696 0.145 0.582 2e-35
>gi|255543357|ref|XP_002512741.1| heat shock protein, putative [Ricinus communis] gi|223547752|gb|EEF49244.1| heat shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  162 bits (409), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 89/139 (64%), Gaps = 45/139 (32%)

Query: 42  SCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIR 101
           SCVGVW+NDRV+IIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA NPQNTVFDAK LI 
Sbjct: 18  SCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIG 77

Query: 102 RRFSDPST---------------------------------------------KEIAEAY 116
           RRFSDPS                                              KEIAEAY
Sbjct: 78  RRFSDPSVQSDMKHWPFKVVPGPGDKPMIVVLYKGEEKQFAPEEISSMVLIKMKEIAEAY 137

Query: 117 LGQALKNAVVTVPAYFNDS 135
           LGQ +KNAV+TVPAYFNDS
Sbjct: 138 LGQTVKNAVITVPAYFNDS 156

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224115756|ref|XP_002332049.1| predicted protein [Populus trichocarpa] gi|222831935|gb|EEE70412.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|186898205|gb|ACC93947.1| heat-shock protein 70 [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|255543359|ref|XP_002512742.1| heat shock protein, putative [Ricinus communis] gi|223547753|gb|EEF49245.1| heat shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|409893161|gb|AFV46216.1| hypothetical protein, partial [Scutellaria baicalensis] Back     alignment and taxonomy information
>gi|224115828|ref|XP_002332067.1| predicted protein [Populus trichocarpa] gi|222831953|gb|EEE70430.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|148910696|gb|ABR18415.1| unknown [Picea sitchensis] gi|224284393|gb|ACN39931.1| unknown [Picea sitchensis] gi|224284458|gb|ACN39963.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|15219109|ref|NP_173055.1| heat shock protein 70B [Arabidopsis thaliana] gi|75313114|sp|Q9S9N1.1|HSP7E_ARATH RecName: Full=Heat shock 70 kDa protein 5; AltName: Full=Heat shock protein 70-5; Short=AtHsp70-5; AltName: Full=Heat shock protein 70b gi|6587810|gb|AAF18501.1|AC010924_14 Identical to gb|AJ002551 heat shock protein 70 from Arabidopsis thaliana and contains a PF|00012 HSP 70 domain. EST gb|F13893 comes from this gene [Arabidopsis thaliana] gi|25082767|gb|AAN71999.1| heat shock protein hsp70, putative [Arabidopsis thaliana] gi|30725476|gb|AAP37760.1| At1g16030 [Arabidopsis thaliana] gi|332191281|gb|AEE29402.1| heat shock protein 70B [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224072743|ref|XP_002303859.1| predicted protein [Populus trichocarpa] gi|222841291|gb|EEE78838.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|562006|gb|AAA82975.1| PsHSP71.2 [Pisum sativum] gi|1771479|emb|CAA67867.1| heat shock protein hsp70 [Pisum sativum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
TAIR|locus:2200462 646 Hsp70b "heat shock protein 70B 0.511 0.106 0.869 1.2e-36
TAIR|locus:2010713 617 ERD2 "EARLY-RESPONSIVE TO DEHY 0.511 0.111 0.840 1.5e-35
TAIR|locus:2101222 650 HSP70 "heat shock protein 70" 0.511 0.106 0.840 2.4e-35
TAIR|locus:2181833 651 HSC70-1 "heat shock cognate pr 0.511 0.105 0.840 4.2e-35
DICTYBASE|DDB_G0269144 640 hspB "heat shock cognate prote 0.481 0.101 0.892 6.1e-35
TAIR|locus:2074984 649 AT3G09440 [Arabidopsis thalian 0.511 0.106 0.826 9.1e-35
TAIR|locus:2181818 653 Hsp70-2 [Arabidopsis thaliana 0.511 0.105 0.840 1.1e-34
DICTYBASE|DDB_G0273623 632 hspE-2 "heat shock cognate pro 0.488 0.104 0.848 1.2e-34
DICTYBASE|DDB_G0273249 632 hspE-1 "heat shock cognate pro 0.488 0.104 0.848 1.2e-34
UNIPROTKB|E9PK54184 HSPA8 "Heat shock cognate 71 k 0.481 0.353 0.830 2.7e-34
TAIR|locus:2200462 Hsp70b "heat shock protein 70B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 313 (115.2 bits), Expect = 1.2e-36, Sum P(2) = 1.2e-36
 Identities = 60/69 (86%), Positives = 63/69 (91%)

Query:    42 SCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIR 101
             SCVGVW NDRV+II NDQGNRTTPSYVAFTDTERLIGDAAKNQVA NPQNTVFDAK LI 
Sbjct:    18 SCVGVWMNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIG 77

Query:   102 RRFSDPSTK 110
             R+FSDPS +
Sbjct:    78 RKFSDPSVQ 86
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005829 "cytosol" evidence=TAS
GO:0006457 "protein folding" evidence=RCA;TAS
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0009507 "chloroplast" evidence=IDA
GO:0009615 "response to virus" evidence=IEP
GO:0005618 "cell wall" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0010286 "heat acclimation" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2010713 ERD2 "EARLY-RESPONSIVE TO DEHYDRATION 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101222 HSP70 "heat shock protein 70" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181833 HSC70-1 "heat shock cognate protein 70-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269144 hspB "heat shock cognate protein Hsc70-1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2074984 AT3G09440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181818 Hsp70-2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273623 hspE-2 "heat shock cognate protein Hsc70-2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273249 hspE-1 "heat shock cognate protein Hsc70-2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E9PK54 HSPA8 "Heat shock cognate 71 kDa protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
cd10233 376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 9e-60
PTZ00009 653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 1e-53
cd10241 374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 1e-51
pfam00012 598 pfam00012, HSP70, Hsp70 protein 9e-47
cd11733 377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 2e-32
PRK00290 627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 7e-32
cd10234 376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 1e-31
TIGR02350 595 TIGR02350, prok_dnaK, chaperone protein DnaK 2e-29
cd10170 369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 6e-29
PTZ00400 663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 6e-28
COG0443 579 COG0443, DnaK, Molecular chaperone [Posttranslatio 8e-27
cd11734 373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 8e-27
cd10228 381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 4e-25
PTZ00186 657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 5e-22
cd10235 339 cd10235, HscC_like_NBD, Nucleotide-binding domain 1e-20
PRK13411 653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 2e-20
PRK13410 668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 2e-20
cd10238 375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 2e-18
CHL00094 621 CHL00094, dnaK, heat shock protein 70 6e-18
PLN03184 673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 2e-16
cd10237 417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 1e-13
cd10236 355 cd10236, HscA_like_NBD, Nucleotide-binding domain 3e-13
cd10230 388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 6e-13
cd11739 383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 2e-12
PRK05183 616 PRK05183, hscA, chaperone protein HscA; Provisiona 1e-11
cd10232 386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 1e-10
cd11737 383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 1e-09
TIGR01991 599 TIGR01991, HscA, Fe-S protein assembly chaperone H 2e-09
cd11738 383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 2e-09
cd11732 377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 2e-08
PRK01433 595 PRK01433, hscA, chaperone protein HscA; Provisiona 4e-04
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information 
 Score =  187 bits (478), Expect = 9e-60
 Identities = 76/138 (55%), Positives = 85/138 (61%), Gaps = 44/138 (31%)

Query: 42  SCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIR 101
           SCVGV+++ +V+IIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA NP NTVFDAK LI 
Sbjct: 11  SCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 70

Query: 102 RRFSDPST--------------------------------------------KEIAEAYL 117
           R+FSDP                                              KEIAEAYL
Sbjct: 71  RKFSDPVVQSDMKHWPFKVVNGGGKPPIIVEYKGETKTFYPEEISSMVLTKMKEIAEAYL 130

Query: 118 GQALKNAVVTVPAYFNDS 135
           G+ + NAV+TVPAYFNDS
Sbjct: 131 GKTVTNAVITVPAYFNDS 148

This subfamily includes human HSPA1A (70-kDa heat shock protein 1A, also known as HSP72; HSPA1; HSP70I; HSPA1B; HSP70-1; HSP70-1A), HSPA1B (70-kDa heat shock protein 1B, also known as HSPA1A; HSP70-2; HSP70-1B), and HSPA1L (70-kDa heat shock protein 1-like, also known as HSP70T; hum70t; HSP70-1L; HSP70-HOM). The genes for these three HSPA1 proteins map in close proximity on the major histocompatibility complex (MHC) class III region on chromosome 6, 6p21.3. This subfamily also includes human HSPA8 (heat shock 70kDa protein 8, also known as LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; NIP71; HSPA10; the HSPA8 gene maps to 11q24.1), human HSPA2 (70-kDa heat shock protein 2, also known as HSP70-2; HSP70-3, the HSPA2 gene maps to 14q24.1), human HSPA6 (also known as heat shock 70kDa protein 6 (HSP70B') gi 94717614, the HSPA6 gene maps to 1q23.3), human HSPA7 (heat shock 70kDa protein 7 , also known as HSP70B; the HSPA7 gene maps to 1q23.3) and Saccharmoyces cerevisiae Stress-Seventy subfamily B/Ssb1p. This subfamily belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Associations of polymorphisms within the MHC-III HSP70 gene locus with longevity, systemic lupus erythematosus, Meniere's disease, noise-induced hearing loss, high-altitude pulmonary edema, and coronary heart disease, have been found. HSPA2 is involved in cancer cell survival, is required for maturation of male gametophytes, and is linked to male infertility. The induction of HSPA6 is a biomarker of cellular stress. HSPA8 participates in the folding and trafficking of client proteins to different subcellular compartments, and in the signal transduction and apoptosis process; it has been shown to protect cardiomyocytes against oxidative stress partly through an interaction with alpha-enolase. S. cerevisiae Ssb1p, is part of the ribosome-associated complex (RAC), it acts as a chaperone for nascent polypeptides, and is important for translation fidelity; Ssb1p is also a [PSI+] prion-curing factor. Length = 376
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG0100 663 consensus Molecular chaperones GRP78/BiP/KAR2, HSP 100.0
PTZ00400 663 DnaK-type molecular chaperone; Provisional 99.95
PTZ00009 653 heat shock 70 kDa protein; Provisional 99.95
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 99.95
PRK13411 653 molecular chaperone DnaK; Provisional 99.95
PRK13410 668 molecular chaperone DnaK; Provisional 99.94
PRK05183 616 hscA chaperone protein HscA; Provisional 99.94
PLN03184 673 chloroplast Hsp70; Provisional 99.94
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 99.94
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 99.93
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 99.93
CHL00094 621 dnaK heat shock protein 70 99.93
COG0443 579 DnaK Molecular chaperone [Posttranslational modifi 99.93
KOG0102 640 consensus Molecular chaperones mortalin/PBP74/GRP7 99.93
PF00012 602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 99.92
PRK01433 595 hscA chaperone protein HscA; Provisional 99.92
PRK11678 450 putative chaperone; Provisional 99.91
KOG0101 620 consensus Molecular chaperones HSP70/HSC70, HSP70 99.91
KOG0103 727 consensus Molecular chaperones HSP105/HSP110/SSE1, 99.87
KOG0104 902 consensus Molecular chaperones GRP170/SIL1, HSP70 99.83
PRK13929 335 rod-share determining protein MreBH; Provisional 99.34
TIGR00904 333 mreB cell shape determining protein, MreB/Mrl fami 98.96
PRK13928 336 rod shape-determining protein Mbl; Provisional 98.95
PRK13930 335 rod shape-determining protein MreB; Provisional 98.87
PRK13927 334 rod shape-determining protein MreB; Provisional 98.79
PF06723 326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 98.38
COG1077 342 MreB Actin-like ATPase involved in cell morphogene 98.18
TIGR02529 239 EutJ ethanolamine utilization protein EutJ family 97.57
PRK15080 267 ethanolamine utilization protein EutJ; Provisional 97.0
cd00012 371 ACTIN Actin; An ubiquitous protein involved in the 96.12
smart00842 187 FtsA Cell division protein FtsA. FtsA is essential 94.52
smart00268 373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 94.06
PRK09472 420 ftsA cell division protein FtsA; Reviewed 93.0
TIGR01174 371 ftsA cell division protein FtsA. This bacterial ce 92.43
PF00370 245 FGGY_N: FGGY family of carbohydrate kinases, N-ter 91.82
TIGR02628 465 fuculo_kin_coli L-fuculokinase. Members of this fa 90.43
TIGR00241 248 CoA_E_activ CoA-substrate-specific enzyme activase 89.44
PRK10331 470 L-fuculokinase; Provisional 89.43
PTZ00280 414 Actin-related protein 3; Provisional 89.36
PF14450120 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B 88.4
COG1070 502 XylB Sugar (pentulose and hexulose) kinases [Carbo 87.99
PRK15027 484 xylulokinase; Provisional 86.85
TIGR01234 536 L-ribulokinase L-ribulokinase. This enzyme catalyz 86.63
PRK10939 520 autoinducer-2 (AI-2) kinase; Provisional 86.02
COG0849 418 ftsA Cell division ATPase FtsA [Cell division and 85.96
PTZ00294 504 glycerol kinase-like protein; Provisional 85.87
TIGR01314 505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 85.69
TIGR01311 493 glycerol_kin glycerol kinase. This model describes 85.59
COG1924 396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 85.2
PRK04123 548 ribulokinase; Provisional 85.05
TIGR03192 293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 85.0
smart0073299 YqgFc Likely ribonuclease with RNase H fold. YqgF 84.65
PRK13321 256 pantothenate kinase; Reviewed 84.41
PLN02295 512 glycerol kinase 84.38
cd00529154 RuvC_resolvase Holliday junction resolvases (HJRs) 84.36
PRK13318 258 pantothenate kinase; Reviewed 84.26
TIGR01315 541 5C_CHO_kinase FGGY-family pentulose kinase. This m 84.13
PRK00047 498 glpK glycerol kinase; Provisional 83.67
PLN00130213 succinate dehydrogenase (SDH3); Provisional 82.21
PRK13326 262 pantothenate kinase; Reviewed 81.16
TIGR00671 243 baf pantothenate kinase, type III. This model desc 80.97
>KOG0100 consensus Molecular chaperones GRP78/BiP/KAR2, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-34  Score=235.60  Aligned_cols=104  Identities=68%  Similarity=0.979  Sum_probs=100.7

Q ss_pred             cceEeccCCceEEEEEeCCeEEEEECCCCCeeeeEEEEEcCCeeEecHHHHHHHHcCCCCceeecccccCCCCCChh---
Q 046319           32 MKTWVSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPS---  108 (135)
Q Consensus        32 i~gID~GTtns~vA~~~~g~~~ii~n~~g~~~~PS~V~~~~~~~~vG~~A~~~~~~~p~~~i~~~KrllG~~~~d~~---  108 (135)
                      +.|||||||||||+++++|+++||.|++|+|.+||+|+|++++|++|.+|++++..||+||+++.|||||++|+|+.   
T Consensus        38 vigIdLGTTYsCVgV~kNgrvEIiANdQGNRItPSyVaFt~derLiGdAAKNQ~~~NPenTiFD~KRLIGr~~~d~~vq~  117 (663)
T KOG0100|consen   38 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDDERLIGDAAKNQLTSNPENTIFDAKRLIGRKFNDKSVQK  117 (663)
T ss_pred             EEEEecCCceeeEEEEeCCeEEEEecCCCCccccceeeeccchhhhhhHhhcccccCcccceechHHHhCcccCChhhhh
Confidence            45699999999999999999999999999999999999999999999999999999999999999999999999987   


Q ss_pred             ------------------------------------------HHHHHHHHcCCCCCcEEEeeCCCccCC
Q 046319          109 ------------------------------------------TKEIAEAYLGQALKNAVVTVPAYFNDS  135 (135)
Q Consensus       109 ------------------------------------------lk~~Ae~~~g~~v~~vVItVPa~F~~~  135 (135)
                                                                ||+.||+|+|.+|+++||||||||||+
T Consensus       118 Dik~~Pfkvv~k~~kp~i~v~v~~g~~K~FtPeEiSaMiL~KMKe~AEayLGkkv~~AVvTvPAYFNDA  186 (663)
T KOG0100|consen  118 DIKFLPFKVVNKDGKPYIQVKVGGGETKVFTPEEISAMILTKMKETAEAYLGKKVTHAVVTVPAYFNDA  186 (663)
T ss_pred             hhhcCceEEEcCCCCccEEEEccCCcccccCHHHHHHHHHHHHHHHHHHHhCCcccceEEecchhcchH
Confidence                                                      999999999999999999999999985

>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0102 consensus Molecular chaperones mortalin/PBP74/GRP75, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>KOG0101 consensus Molecular chaperones HSP70/HSC70, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0103 consensus Molecular chaperones HSP105/HSP110/SSE1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0104 consensus Molecular chaperones GRP170/SIL1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>smart00732 YqgFc Likely ribonuclease with RNase H fold Back     alignment and domain information
>PRK13321 pantothenate kinase; Reviewed Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>cd00529 RuvC_resolvase Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination Back     alignment and domain information
>PRK13318 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PLN00130 succinate dehydrogenase (SDH3); Provisional Back     alignment and domain information
>PRK13326 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR00671 baf pantothenate kinase, type III Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
3jxu_A 409 Crystal Structure Of The Human 70kda Heat Shock Pro 8e-35
3d2f_B 382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 9e-35
3a8y_A 392 Crystal Structure Of The Complex Between The Bag5 B 9e-35
2e8a_A 391 Crystal Structure Of The Human Hsp70 Atpase Domain 9e-35
2e88_A 391 Crystal Structure Of The Human Hsp70 Atpase Domain 9e-35
1hjo_A 380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 1e-34
3d2e_B 382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 1e-34
1s3x_A 382 The Crystal Structure Of The Human Hsp70 Atpase Dom 1e-34
3kvg_A 400 Crystal Structure Of The N-Terminal Domain Of Hsp70 2e-34
1yuw_A 554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 3e-34
2v7z_A 543 Crystal Structure Of The 70-Kda Heat Shock Cognate 3e-34
3c7n_B 554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 4e-34
1ba0_A 386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 4e-34
1ngg_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-34
1ngc_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-34
1nge_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-34
1ats_A 386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-34
1nga_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-34
1bup_A 386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 4e-34
1ngd_A 386 Structural Basis Of The 70-kilodalton Heat Shock Co 4e-34
1ngf_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-34
3cqx_A 386 Chaperone Complex Length = 386 4e-34
1ngh_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-34
1ngb_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-34
1atr_A 386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-34
1hpm_A 386 How Potassium Affects The Activity Of The Molecular 4e-34
2bup_A 381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 4e-34
2qw9_B 394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 4e-34
3fzf_A 381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 5e-34
2qwn_A 394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 5e-34
3gdq_A 408 Crystal Structure Of The Human 70kda Heat Shock Pro 5e-34
1hx1_A 400 Crystal Structure Of A Bag Domain In Complex With T 5e-34
1qqm_A 378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 7e-34
1qqo_A 378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 8e-34
1kaz_A 381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 1e-33
1kay_A 381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 2e-33
1kax_A 381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 2e-33
1qqn_A 378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 5e-33
3i33_A 404 Crystal Structure Of The Human 70kda Heat Shock Pro 7e-33
4fsv_A 387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 8e-33
3fe1_A 403 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-32
1ba1_A 386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-32
3iuc_A 408 Crystal Structure Of The Human 70kda Heat Shock Pro 2e-30
3ldl_A 384 Crystal Structure Of Human Grp78 (70kda Heat Shock 2e-30
3qfu_A 394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 3e-28
3qfp_A 390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 4e-28
3gl1_A 387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 4e-26
2kho_A 605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 3e-17
1dkg_D 383 Crystal Structure Of The Nucleotide Exchange Factor 5e-17
2v7y_A 509 Crystal Structure Of The Molecular Chaperone Dnak F 6e-17
4b9q_A 605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 9e-16
2qxl_A 658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 1e-06
3c7n_A 668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 1e-06
3d2f_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 1e-06
4gni_A 409 Structure Of The Ssz1 Atpase Bound To Atp And Magne 3e-06
3d2e_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 3e-06
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure 
Iteration: 1

 Score =  142 bits (357), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 84/138 (60%), Gaps = 44/138 (31%)
Query: 42  SCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIR 101
           SCVGV+++ +V+IIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA NPQNTVFDAK LI 
Sbjct: 38  SCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIG 97
Query: 102 RRFSDP--------------------------------------------STKEIAEAYL 117
           R+F DP                                              KEIAEAYL
Sbjct: 98  RKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYL 157
Query: 118 GQALKNAVVTVPAYFNDS 135
           G  + NAV+TVPAYFNDS
Sbjct: 158 GYPVTNAVITVPAYFNDS 175
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP c 2e-65
3qfu_A 394 78 kDa glucose-regulated protein homolog; HSP70, K 4e-65
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 8e-63
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 3e-57
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 2e-36
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 2e-34
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 1e-32
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
 Score =  202 bits (516), Expect = 2e-65
 Identities = 72/138 (52%), Positives = 83/138 (60%), Gaps = 44/138 (31%)

Query: 42  SCVGVWKNDRVQIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVATNPQNTVFDAKLLIR 101
           SCVGV+++ +V+IIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA NP NT+FDAK LI 
Sbjct: 35  SCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIG 94

Query: 102 RRFSDPST--------------------------------------------KEIAEAYL 117
           R+F D +                                             KEIAEAYL
Sbjct: 95  RKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYL 154

Query: 118 GQALKNAVVTVPAYFNDS 135
           G  + +AV+TVPAYFNDS
Sbjct: 155 GGKVHSAVITVPAYFNDS 172
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 99.94
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 99.93
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 99.93
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 99.92
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP c 99.92
3qfu_A 394 78 kDa glucose-regulated protein homolog; HSP70, K 99.91
4gni_A 409 Putative heat shock protein; HSP70-type ATPase, AT 99.91
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 99.9
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 99.9
1jce_A 344 ROD shape-determining protein MREB; MBL, actin, HS 99.17
2ych_A 377 Competence protein PILM; cell cycle, type IV pilus 97.87
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 97.82
2fsj_A 346 Hypothetical protein TA0583; actin homologs, archa 97.81
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 97.7
3h1q_A 272 Ethanolamine utilization protein EUTJ; ethanolamin 96.83
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 96.82
2zgy_A 320 Plasmid segregation protein PARM; plasmid partitio 96.68
4ehu_A 276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 96.16
4a2a_A 419 Cell division protein FTSA, putative; cell cycle, 94.14
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 91.26
4fo0_A 593 Actin-related protein 8; chromatin remodeling, nuc 90.75
3i8b_A 515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 88.8
3ezw_A 526 Glycerol kinase; glycerol metabolism, allosteric r 88.48
3djc_A 266 Type III pantothenate kinase; structural genomics, 87.25
1hux_A 270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 86.96
4bc3_A 538 Xylulose kinase; transferase, glucuronate xyluloki 85.09
3ifr_A 508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 84.85
3h3n_X 506 Glycerol kinase; ATP-binding, glycerol metabolism, 84.35
3jvp_A 572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 83.98
2p3r_A 510 Glycerol kinase; glycerol metabolism, allosteric r 83.73
2h3g_X 268 Biosynthetic protein; pantothenate kinase, anthrax 83.65
3l0q_A 554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 83.62
3h6e_A 482 Carbohydrate kinase, FGGY; novosphingobium aromati 82.52
3g25_A 501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 82.35
2w40_A 503 Glycerol kinase, putative; closed conformation, ma 82.24
3ll3_A 504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 82.17
4e1j_A 520 Glycerol kinase; structural genomics, PSI-biology, 82.06
3hz6_A 511 Xylulokinase; xylulose, structural genomic, chromo 81.87
1hjr_A158 Holliday junction resolvase (RUVC); site-specific 81.44
2uyt_A 489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 81.41
2zf5_O 497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 81.03
2dpn_A 495 Glycerol kinase; thermus thermophilus HB8, structu 80.85
2itm_A 484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 80.46
3bex_A 249 Type III pantothenate kinase; actin-like fold, ATP 80.18
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
Probab=99.94  E-value=9e-27  Score=198.51  Aligned_cols=103  Identities=47%  Similarity=0.704  Sum_probs=96.5

Q ss_pred             cceEeccCCceEEEEEeCCeEEEEECCCCCeeeeEEEEEc-CCeeEecHHHHHHHHcCCCCceeecccccCCCCCChh--
Q 046319           32 MKTWVSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPS--  108 (135)
Q Consensus        32 i~gID~GTtns~vA~~~~g~~~ii~n~~g~~~~PS~V~~~-~~~~~vG~~A~~~~~~~p~~~i~~~KrllG~~~~d~~--  108 (135)
                      +.||||||||||||++++|.+++++|..|++++||+|+|. ++++++|..|+.++..+|.++++++||+||++++|+.  
T Consensus         4 viGIDlGTT~S~Va~~~~g~~~ii~n~~g~~~~PS~V~~~~~~~~~vG~~A~~~~~~~p~~ti~~~KrllG~~~~d~~v~   83 (605)
T 4b9q_A            4 IIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGCTLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQ   83 (605)
T ss_dssp             EEEEECCSSEEEEEEEETTEEEECCCTTSCSSEECCEEECTTSCEEESHHHHHTTTTCGGGEECCGGGTTTCBTTSHHHH
T ss_pred             EEEEEcCCCcEEEEEEECCEEEEEECCCCCcccceEEEEeCCCcEEecHHHHHHHHhCCCcEehhhHHhhCCCCCCHHHH
Confidence            4569999999999999999999999999999999999998 5689999999999999999999999999999988732  


Q ss_pred             ---------------------------------------HHHHHHHHcCCCCCcEEEeeCCCccC
Q 046319          109 ---------------------------------------TKEIAEAYLGQALKNAVVTVPAYFND  134 (135)
Q Consensus       109 ---------------------------------------lk~~Ae~~~g~~v~~vVItVPa~F~~  134 (135)
                                                             |++.|+.++|.++.++|||||+||++
T Consensus        84 ~~~~~~p~~~~~~~~g~~~~~~~~~~~~p~ei~a~iL~~lk~~ae~~lg~~v~~~VITVPa~f~~  148 (605)
T 4b9q_A           84 RDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFND  148 (605)
T ss_dssp             HHHTTCSSEEEECTTSBEEEEETTEEECHHHHHHHHHHHHHHHHHHHHTSCCCEEEEEECTTCCH
T ss_pred             HHhhcCCeEEEEcCCCceEEEECCEEECHHHHHHHHHHHHHHHHHHHhCCCCCeEEEEECCCCCH
Confidence                                                   88899999999999999999999986
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>2h3g_X Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str} Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6 Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 1e-28
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 2e-27
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Escherichia coli, gene dnaK [TaxId: 562]

 Score =  101 bits (252), Expect = 1e-28
 Identities = 49/136 (36%), Positives = 64/136 (47%), Gaps = 42/136 (30%)

Query: 42  SCVGVWKNDRVQIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVATNPQNTVFDAKLLI 100
           SCV +      +++ N +G+RTTPS +A+T D E L+G  AK Q  TNPQNT+F  K LI
Sbjct: 12  SCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLI 71

Query: 101 RRRFSDPST-----------------------------------------KEIAEAYLGQ 119
            RRF D                                            K+ AE YLG+
Sbjct: 72  GRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGE 131

Query: 120 ALKNAVVTVPAYFNDS 135
            +  AV+TVPAYFND+
Sbjct: 132 PVTEAVITVPAYFNDA 147
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 99.96
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.96
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 99.68
d1huxa_ 259 Hydroxyglutaryl-CoA dehydratase component A {Acida 94.07
d2p3ra1 252 Glycerol kinase {Escherichia coli [TaxId: 562]} 93.15
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromo 91.62
d2f9wa2114 Type III pantothenate kinase, CoaX {Pseudomonas ae 91.1
d1r59o1 252 Glycerol kinase {Enterococcus casseliflavus [TaxId 91.06
d3bexa1118 Type III pantothenate kinase, CoaX {Thermotoga mar 90.98
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 90.2
d2ewsa1 267 Type II pantothenate kinase, CoaW {Staphylococcus 86.22
d2ap1a2117 Putative regulator protein YcfX {Salmonella typhim 85.62
d1woqa1129 Inorganic polyphosphate/ATP-glucomannokinase PPGMK 85.2
d2fsja2164 Hypothetical protein Ta0583 {Archaeon Thermoplasma 85.09
d1xc3a1118 Putative fructokinase YhdR {Bacillus subtilis [Tax 84.6
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli 84.43
d1hjra_158 RuvC resolvase {Escherichia coli [TaxId: 562]} 84.33
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 83.34
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli 82.79
d2gupa1114 Hypothetical protein SP2142 {Streptococcus pneumon 82.56
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Escherichia coli, gene dnaK [TaxId: 562]

Probab=99.96  E-value=2.6e-30  Score=188.80  Aligned_cols=103  Identities=48%  Similarity=0.726  Sum_probs=96.1

Q ss_pred             cceEeccCCceEEEEEeCCeEEEEECCCCCeeeeEEEEEc-CCeeEecHHHHHHHHcCCCCceeecccccCCCCCChh--
Q 046319           32 MKTWVSLFLISCVGVWKNDRVQIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVATNPQNTVFDAKLLIRRRFSDPS--  108 (135)
Q Consensus        32 i~gID~GTtns~vA~~~~g~~~ii~n~~g~~~~PS~V~~~-~~~~~vG~~A~~~~~~~p~~~i~~~KrllG~~~~d~~--  108 (135)
                      |.|||||||||+||++++|++++++|++|++.+||+|+|. ++++++|..|..+..++|+++++++|||||+++.|+.  
T Consensus         2 VvGIDfGTt~s~va~~~~~~~~ii~n~~~~~~~ps~v~~~~~~~~~~G~~A~~~~~~~p~~~i~~~KrllG~~~~~~~~~   81 (183)
T d1dkgd1           2 IIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQ   81 (183)
T ss_dssp             CCEEECCSSEEEEEEEETTEEEECCCTTSCSEEECEEEECTTSCEEESHHHHTTSTTCGGGEEECGGGTTTCBSCSHHHH
T ss_pred             EEEEEcChhcEEEEEEECCEEEEEEcCCCcccccceeeecCCCCEEccHHHHHhhhcCCccEEeeeHHHcCCCCCcHHHH
Confidence            3569999999999999999999999999999999999998 4689999999999999999999999999999887654  


Q ss_pred             ---------------------------------------HHHHHHHHcCCCCCcEEEeeCCCccC
Q 046319          109 ---------------------------------------TKEIAEAYLGQALKNAVVTVPAYFND  134 (135)
Q Consensus       109 ---------------------------------------lk~~Ae~~~g~~v~~vVItVPa~F~~  134 (135)
                                                             |++.|++++|.++.+||||||++|++
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~l~a~~L~~l~~~a~~~~~~~~~~~VitVPa~f~~  146 (183)
T d1dkgd1          82 RDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFND  146 (183)
T ss_dssp             HHTTTCSSEEEECSSSBEEEEETTEEECHHHHHHHHHHHHHHHHHHHHSSCCCEEEECBCTTCCH
T ss_pred             hhhhcCCEEEEEcCCCcEEEEECCEEECHHHHHHHHHHHHHHHHHHHhCCCCCeEEEEECCCCCH
Confidence                                                   78899999999999999999999985
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2f9wa2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d3bexa1 c.55.1.13 (A:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} Back     information, alignment and structure
>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hjra_ c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure