Citrus Sinensis ID: 046373


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MNPISIYPNFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFENDQTAADIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLIYGSRELTLSNVNFQEEVRNLSKDNGRGQYPDGVICKRAQ
cccccccHHHHHHHHcccHHHHHHHHccccHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHcccHHHccccccccHHHHHHHHcccHHHHHHHHHccccccHHHHHcccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHccHHHHHHHHcccHHHHHHHHHcccccHHHHHHHcccc
ccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccEEcccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccHccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHcccccccccccccccccHHHHHHHccc
mnpisiypnffnaaaagdaetfkrnttSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSlllqvnakgdtplhlaakfghSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILtkqdpdypysenkygktslymAAEGRYSEMVIELLENCtsvshegpngkTALHAAAMHFYfendqtaadiaDKDRKMTALHLAAGQGHARTVETILfldpkcyelvdhrgwNFLHYAMVSFKLHELKILLKnplarsliyegdnngntplhVLAAIRPKEFFKIKVRydaggnygavnkqnvSVTDVLIYGsreltlsnvNFQEEVRNLskdngrgqypdgvickraq
MNPISIYPNFFNAAAAGDAETFKRNTTSDEIESLLTaqtkntilhiniisqkrkngSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILtkqdpdypysenkygktSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFENDQTAADIADKDRKMTALHLaagqghartVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGgnygavnkqnvSVTDVLIYGSRELTLSNVNFQEEvrnlskdngrgqypdgvickraq
MNPISIYPNFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFENDQTAADIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLIYGSRELTLSNVNFQEEVRNLSKDNGRGQYPDGVICKRAQ
*****IYPNFFNAAAAG*************IESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFENDQTAADIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLIYGSRELTLSNVNFQ*************************
*NPISIYPNFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFENDQTAADIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLIYGSRELTLSNVNFQEEVRNLSKDNGRGQYPDGVICKR**
MNPISIYPNFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFENDQTAADIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLIYGSRELTLSNVNFQEEVRNLSKDNGRGQYPDGVICKRAQ
***ISIYPNFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFENDQTAADIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLIYGSRELTLSNVNFQEEVRN******RGQYPDGVICKRA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPISIYPNFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFENDQTAADIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLIYGSRELTLSNVNFQEEVRNLSKDNGRGQYPDGVICKRAQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query364 2.2.26 [Sep-21-2011]
Q6AWW5 524 Ankyrin repeat-containing no no 0.681 0.473 0.255 4e-14
Q502K3 1071 Serine/threonine-protein no no 0.700 0.238 0.252 3e-12
P57078832 Receptor-interacting seri yes no 0.516 0.225 0.261 7e-11
Q9XZC0 1413 Alpha-latrocrustotoxin-Lt N/A no 0.829 0.213 0.259 9e-11
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.678 0.131 0.299 1e-10
Q9ERK0786 Receptor-interacting seri no no 0.450 0.208 0.324 1e-10
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.576 0.107 0.270 1e-10
Q63618 837 Espin OS=Rattus norvegicu no no 0.480 0.209 0.273 2e-10
Q69ZU8 712 Ankyrin repeat domain-con no no 0.582 0.297 0.268 2e-10
O44997 1425 Death-associated protein yes no 0.414 0.105 0.329 3e-10
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 131/297 (44%), Gaps = 49/297 (16%)

Query: 35  LTAQTKNTILHINIISQKRKNGSTKFIGEMLKK-----CPSLLLQVNAKGDTPLHLAAKF 89
           +TA+  +T LH  +     + G T  + EM+ +        LL + N  G+T L++AA++
Sbjct: 12  MTARRDDTPLHTAV-----REGKTDLLLEMIGEHDGVELKELLAEQNQSGETALYVAAEY 66

Query: 90  GHSNIVSFLIERAKLAAWQMMRMTNNEKN--TALHEAVCHGNVQVVKILTKQDPDYPYSE 147
           G++++V  L++ +       +      KN   A H A  +GN+QV+ +L + +P+  ++ 
Sbjct: 67  GYTDMVKILMKHS-----DSVLAGTKAKNGFDAFHIAAKNGNLQVLDVLIEANPELSFTF 121

Query: 148 NKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEG-PNGKTALHAAAMHFYFENDQTAADI 206
           +    T+L+ AA   + E+V  LL+    ++     NGKTALH+A               
Sbjct: 122 DSSKTTALHTAASQGHGEIVCFLLDKGVDLAAIARSNGKTALHSA--------------- 166

Query: 207 ADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILL 266
                        A  GH   V+ ++         VD +G   LH A+       + +L+
Sbjct: 167 -------------ARNGHTVIVKKLIEKKAGMVTRVDKKGQTALHMAVKGQNTEIVDVLM 213

Query: 267 KNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDV 323
           +     SLI   DN GNTPLH+       E  +  ++Y       AVNK   +  D+
Sbjct: 214 EAD--GSLINSADNKGNTPLHIAVRKNRAEIVQTVLKYCEVSRV-AVNKSGETALDI 267





Arabidopsis thaliana (taxid: 3702)
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description
>sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 Back     alignment and function description
>sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 Back     alignment and function description
>sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 Back     alignment and function description
>sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query364
255585399 575 ankyrin repeat-containing protein, putat 0.923 0.584 0.374 2e-60
224127104405 predicted protein [Populus trichocarpa] 0.859 0.772 0.384 1e-58
224127098399 predicted protein [Populus trichocarpa] 0.859 0.784 0.384 2e-58
224145572395 predicted protein [Populus trichocarpa] 0.854 0.787 0.393 3e-58
224127079394 predicted protein [Populus trichocarpa] 0.857 0.791 0.384 2e-57
224127106 575 predicted protein [Populus trichocarpa] 0.920 0.582 0.360 1e-55
255551947 582 ankyrin repeat-containing protein, putat 0.774 0.484 0.387 5e-55
224107373391 predicted protein [Populus trichocarpa] 0.777 0.723 0.347 2e-44
224126955295 predicted protein [Populus trichocarpa] 0.703 0.867 0.404 3e-44
356510752 629 PREDICTED: ankyrin-2-like [Glycine max] 0.708 0.410 0.372 5e-44
>gi|255585399|ref|XP_002533395.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223526769|gb|EEF28995.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  239 bits (609), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 152/406 (37%), Positives = 216/406 (53%), Gaps = 70/406 (17%)

Query: 9   NFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKC 68
           + + AA  G  + FK      +   LL    K+TILH+N+ S   +  ST F+ E L  C
Sbjct: 30  DLYKAAEDGKIDPFKNFAGPLD---LLVTPIKDTILHLNLASPSER--STSFVKEALDMC 84

Query: 69  PSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKL----------AAWQMMRMTNNEKN 118
           P +LLQ+NA GDT LH+AA++GH +IV  LIE  +           A  QM+RMTN  K 
Sbjct: 85  PQILLQINADGDTLLHIAARYGHLDIVKLLIEHTRAQHQDLESAGEAVRQMLRMTNKSKE 144

Query: 119 TALHEAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVS 178
           TALHEA  + +  +V++L +QDPD+ +S N +G+T LY+A+E  + E+V+ +L+ CTS++
Sbjct: 145 TALHEAARNDHPDLVELLIEQDPDFVHSSNDFGETPLYLASERGHLEVVVIMLKACTSLA 204

Query: 179 HEGPNGKTALHAAAMHFY-----------------------------------------F 197
           + GPNGKTALHAAAMH +                                          
Sbjct: 205 YGGPNGKTALHAAAMHRHGGIVHAILDKKTSLVNKADEMGWTPLHYAAYIGASRVVKQLL 264

Query: 198 ENDQTAADIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSF 257
             D+  A  ADK R+ TALHLAA Q + +++  I+F  P C +LVD+RGWN  HYA++S 
Sbjct: 265 GYDKYVAYAADKARRRTALHLAACQANIKSMREIIFKCPDCCKLVDNRGWNVAHYAVISK 324

Query: 258 KLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIR--PKEFFKIKVRYDAGGNYGAVNK 315
               LKILL NP    L+ E D  GNTPLH+LAA++  P+        + A G+  AV +
Sbjct: 325 SDDALKILLANPSCIYLVNEKDAQGNTPLHLLAALQSHPRSLM-----HHAKGHRFAVYR 379

Query: 316 QNVSVTDVLIYGSRELTLSNVNFQEEVRNLSKDNGRGQYPDGVICK 361
           QN           +EL   +   ++E++   +D G G     VI K
Sbjct: 380 QNFLCI-------KELLSRSPCRKKEIQEWMRDLGGGPLGQIVIKK 418




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224127104|ref|XP_002329397.1| predicted protein [Populus trichocarpa] gi|222870447|gb|EEF07578.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127098|ref|XP_002329394.1| predicted protein [Populus trichocarpa] gi|222870444|gb|EEF07575.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145572|ref|XP_002325691.1| predicted protein [Populus trichocarpa] gi|222862566|gb|EEF00073.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127079|ref|XP_002329386.1| predicted protein [Populus trichocarpa] gi|224127100|ref|XP_002329395.1| predicted protein [Populus trichocarpa] gi|222870436|gb|EEF07567.1| predicted protein [Populus trichocarpa] gi|222870445|gb|EEF07576.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127106|ref|XP_002329398.1| predicted protein [Populus trichocarpa] gi|222870448|gb|EEF07579.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255551947|ref|XP_002517018.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223543653|gb|EEF45181.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224107373|ref|XP_002333525.1| predicted protein [Populus trichocarpa] gi|222837132|gb|EEE75511.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224126955|ref|XP_002329347.1| predicted protein [Populus trichocarpa] gi|222870397|gb|EEF07528.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356510752|ref|XP_003524098.1| PREDICTED: ankyrin-2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query364
TAIR|locus:2045233 662 AT2G31820 [Arabidopsis thalian 0.782 0.430 0.300 3.4e-15
TAIR|locus:2020833 616 AT1G03670 "AT1G03670" [Arabido 0.818 0.483 0.265 3.8e-15
TAIR|locus:2181768 524 ANK1 "ankyrin-like1" [Arabidop 0.695 0.482 0.292 1.8e-14
TAIR|locus:2031948 627 AT1G05640 "AT1G05640" [Arabido 0.774 0.449 0.299 4.6e-13
UNIPROTKB|F1S0C5 541 ANKRD6 "Uncharacterized protei 0.598 0.402 0.289 1e-12
ZFIN|ZDB-GENE-070615-8489 ankdd1a "ankyrin repeat and de 0.656 0.488 0.274 1.4e-12
ZFIN|ZDB-GENE-030728-7 1614 trpn1 "transient receptor pote 0.717 0.161 0.289 2.3e-12
ZFIN|ZDB-GENE-050522-247 1071 ankrd52a "ankyrin repeat domai 0.733 0.249 0.274 3.8e-12
UNIPROTKB|G3MWL8 731 ANKRD6 "Uncharacterized protei 0.598 0.298 0.285 6.3e-12
ZFIN|ZDB-GENE-071015-4733 ankk1 "ankyrin repeat and kina 0.618 0.306 0.282 6.3e-12
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 3.4e-15, P = 3.4e-15
 Identities = 92/306 (30%), Positives = 141/306 (46%)

Query:    60 FIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNT 119
             FIGE  KK  S       +GD+ LH+AA+ G+ + V  LI        +++   N E  T
Sbjct:   136 FIGERRKKNES----PGKRGDSSLHIAARTGNLSKVKELIRGCGDELKELLSKQNLEGET 191

Query:   120 ALHEAVCHGNVQVVKILTKQ-DPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVS 178
              L+ A  +G+  VV+ + K  D +      + G    ++AA+  + E++  LLE   +++
Sbjct:   192 PLYTAAENGHSIVVEEMLKHMDLETASIAARNGFDPFHVAAKQGHLEVLKILLETFPNLA 251

Query:   179 HEGP-NGKTALHAAA-------MHFYFENDQTAADIADKDRKMTALHLAAGQGHARTVET 230
                  +  TALH AA       ++   E D   A IA  + K TALH AA  GH   V++
Sbjct:   252 MTTDLSCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGK-TALHSAARMGHVEVVKS 310

Query:   231 ILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLA 290
             ++  DP      D +G   LH A V  +   + + L  P    L  E DN GNTPLH+  
Sbjct:   311 LIGKDPSIGFRTDKKGQTALHMA-VKGQNDGIVVELVKPDVAVLSVE-DNKGNTPLHIAT 368

Query:   291 AIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLI-YGSRELTLSNVNFQEEVRNLSKDN 349
                  +  +  V ++ G N   +NK   +  DV    G+ EL   +V  +E     +KD 
Sbjct:   369 NKGRIKIVRCLVSFE-GINLNPINKAGDTPLDVSEKIGNAELV--SV-LKEAGAATAKDL 424

Query:   350 GRGQYP 355
             G+ Q P
Sbjct:   425 GKPQNP 430


GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181768 ANK1 "ankyrin-like1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0C5 ANKRD6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070615-8 ankdd1a "ankyrin repeat and death domain containing 1A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030728-7 trpn1 "transient receptor potential cation channel, subfamily N, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-247 ankrd52a "ankyrin repeat domain 52a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3MWL8 ANKRD6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071015-4 ankk1 "ankyrin repeat and kinase domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01200031
hypothetical protein (405 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query364
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-23
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-04
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 0.001
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.003
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 92.4 bits (230), Expect = 6e-23
 Identities = 40/125 (32%), Positives = 66/125 (52%), Gaps = 6/125 (4%)

Query: 74  QVNAKGDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVV 133
             +  G TPLHLAA  GH  +V  L+E             +N+  T LH A  +G++++V
Sbjct: 2   ARDEDGRTPLHLAASNGHLEVVKLLLENGADVN-----AKDNDGRTPLHLAAKNGHLEIV 56

Query: 134 KILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAM 193
           K+L ++  D   + +K G T L++AA     ++V  LL++   V+    +G+T LH AA 
Sbjct: 57  KLLLEKGAD-VNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAK 115

Query: 194 HFYFE 198
           + + E
Sbjct: 116 NGHLE 120


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 364
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02792631 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.95
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.94
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.94
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.93
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.91
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.89
KOG0514452 consensus Ankyrin repeat protein [General function 99.89
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.88
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.88
KOG0514452 consensus Ankyrin repeat protein [General function 99.88
PHA02743166 Viral ankyrin protein; Provisional 99.87
PHA02743166 Viral ankyrin protein; Provisional 99.85
PHA02741169 hypothetical protein; Provisional 99.84
PHA02741169 hypothetical protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.83
PHA02884300 ankyrin repeat protein; Provisional 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.82
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.82
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.79
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.72
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.72
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.72
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.68
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.58
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.54
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.49
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.46
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.43
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.4
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.39
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.35
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.35
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.34
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.34
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.31
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.29
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.29
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.95
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.76
PF1360630 Ank_3: Ankyrin repeat 98.72
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.71
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.68
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.63
PF1360630 Ank_3: Ankyrin repeat 98.61
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.61
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.56
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.51
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.5
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.47
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.46
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.4
KOG0522 560 consensus Ankyrin repeat protein [General function 98.32
KOG0522 560 consensus Ankyrin repeat protein [General function 98.29
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.29
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.23
KOG0511 516 consensus Ankyrin repeat protein [General function 98.16
KOG2384223 consensus Major histocompatibility complex protein 98.08
KOG0511 516 consensus Ankyrin repeat protein [General function 97.95
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.94
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.9
KOG2384223 consensus Major histocompatibility complex protein 97.82
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.61
KOG0520975 consensus Uncharacterized conserved protein, conta 97.47
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.81
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.53
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.51
KOG2505591 consensus Ankyrin repeat protein [General function 96.19
KOG2505591 consensus Ankyrin repeat protein [General function 96.17
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.07
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.55
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.62
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.49
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.95
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 89.76
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.2e-44  Score=342.62  Aligned_cols=306  Identities=20%  Similarity=0.162  Sum_probs=222.5

Q ss_pred             CChhHHHHHhcCChHHhhhccCChhHHHhhhhccCCchHHHHHHHH----------------------------------
Q 046373            6 IYPNFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQ----------------------------------   51 (364)
Q Consensus         6 ~~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~g~t~L~~A~~~~----------------------------------   51 (364)
                      .+++||+|+..|+.|+|+.|++..+-.....+..|.||||+|  +.                                  
T Consensus        41 ~~t~LH~A~~~g~~e~V~~ll~~~~~~~~~~~~~~~tpLh~a--~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  118 (682)
T PHA02876         41 PFTAIHQALQLRQIDIVEEIIQQNPELIYITDHKCHSTLHTI--CIIPNVMDIVISLTLDCDIILDIKYASIILNKHKLD  118 (682)
T ss_pred             cchHHHHHHHHHhhhHHHHHHHhCcccchhhchhhccccccc--cCCCCccccccccccchhhcccccHHHHHHHHHHHH
Confidence            468999999999999999999987443457777899999977  52                                  


Q ss_pred             ------------------------------------HhcCCChHHHHHHHhcCCccccccCCCCCcHHHHHHHcCCHHHH
Q 046373           52 ------------------------------------KRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAAKFGHSNIV   95 (364)
Q Consensus        52 ------------------------------------~~~~~~~~~l~~~l~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v   95 (364)
                                                          .++.+++++|++    .+++++..|..|.||||+|+..|+.++|
T Consensus       119 ~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~----~Gadvn~~d~~G~TpLh~Aa~~G~~~iv  194 (682)
T PHA02876        119 EACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLE----GGADVNAKDIYCITPIHYAAERGNAKMV  194 (682)
T ss_pred             HHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHh----CCCCCCCCCCCCCCHHHHHHHCCCHHHH
Confidence                                                233334444444    4888999999999999999999999999


Q ss_pred             HHHHHHhhHHHhHhhhcCCCCCCcHHHHHHHcCCHHHHHHHHhcCC-----------------------------CCCCC
Q 046373           96 SFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQDP-----------------------------DYPYS  146 (364)
Q Consensus        96 ~~Ll~~~~~~~~~~~~~~~~~g~t~l~~a~~~~~~e~v~~Ll~~~~-----------------------------~~~~~  146 (364)
                      ++|+++|++     ++..+..|.||||+|+..++.+++++|++.+.                             +++ .
T Consensus       195 ~~LL~~Gad-----~n~~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~~~~~~L~~ai~~~~~~~~~~Ll~~g~~vn-~  268 (682)
T PHA02876        195 NLLLSYGAD-----VNIIALDDLSVLECAVDSKNIDTIKAIIDNRSNINKNDLSLLKAIRNEDLETSLLLYDAGFSVN-S  268 (682)
T ss_pred             HHHHHCCCC-----cCccCCCCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCcHHHHHHHHcCCHHHHHHHHHCCCCCC-C
Confidence            999999976     56677778888888888888777776665443                             222 3


Q ss_pred             CCcCCchHHHHHHhcCCH-HHHHHHHHcCCCCCCCCCCCCChHHHHHHhhh-hhcchhhh-----hhhccCCCchHHHHH
Q 046373          147 ENKYGKTSLYMAAEGRYS-EMVIELLENCTSVSHEGPNGKTALHAAAMHFY-FENDQTAA-----DIADKDRKMTALHLA  219 (364)
Q Consensus       147 ~~~~~~t~l~~A~~~~~~-~~v~~Ll~~~~~~~~~~~~~~~~l~~a~~~~~-~~~~~~~~-----~~~~~~~~~t~L~~a  219 (364)
                      .+..|.||||+|+..++. +++++|++.|++++..+..|.||||+|+.... .+....+.     ....+..|.||||.|
T Consensus       269 ~d~~g~TpLh~Aa~~~~~~~iv~lLl~~gadin~~d~~g~TpLh~Aa~~g~~~~~v~~Ll~~gadin~~d~~g~TpLh~A  348 (682)
T PHA02876        269 IDDCKNTPLHHASQAPSLSRLVPKLLERGADVNAKNIKGETPLYLMAKNGYDTENIRTLIMLGADVNAADRLYITPLHQA  348 (682)
T ss_pred             CCCCCCCHHHHHHhCCCHHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHhCCCHHHHHHHHHcCCCCCCcccCCCcHHHHH
Confidence            455688888888888875 57888888888888888888888888887531 11111111     111224577777777


Q ss_pred             Hhc-CCHHHHHHHHhcCCcccccccCCCCcHHHHHHHcCCHHHHHHHHhCcccccccccCCCCCCcHHHHHHhcCCccee
Q 046373          220 AGQ-GHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFF  298 (364)
Q Consensus       220 ~~~-~~~~~~~~Ll~~~~~~~~~~d~~g~t~l~~a~~~~~~~~~~~ll~~~~~~~~i~~~d~~g~t~L~~A~~~~~~~~~  298 (364)
                      +.. +..++++.|+++|++ ++.+|..|+||||+|+..++.++++.|++.   |++++..+..|.||||+|+..++. ..
T Consensus       349 ~~~~~~~~iv~lLl~~gad-in~~d~~G~TpLh~Aa~~~~~~iv~~Ll~~---gad~~~~~~~g~T~Lh~A~~~~~~-~~  423 (682)
T PHA02876        349 STLDRNKDIVITLLELGAN-VNARDYCDKTPIHYAAVRNNVVIINTLLDY---GADIEALSQKIGTALHFALCGTNP-YM  423 (682)
T ss_pred             HHhCCcHHHHHHHHHcCCC-CccCCCCCCCHHHHHHHcCCHHHHHHHHHC---CCCccccCCCCCchHHHHHHcCCH-HH
Confidence            764 466777777777777 466777777777777777777777777776   777777777777777777766551 23


Q ss_pred             ehhhhcccCCcccccccCCCchhHHhhhcc
Q 046373          299 KIKVRYDAGGNYGAVNKQNVSVTDVLIYGS  328 (364)
Q Consensus       299 ~~~ll~~~~~~~~~~n~~g~t~l~~a~~~~  328 (364)
                      .+.+|++.|++++.+|..|+||||+|+..+
T Consensus       424 ~vk~Ll~~gadin~~d~~G~TpLh~Aa~~~  453 (682)
T PHA02876        424 SVKTLIDRGANVNSKNKDLSTPLHYACKKN  453 (682)
T ss_pred             HHHHHHhCCCCCCcCCCCCChHHHHHHHhC
Confidence            345666777777777777777777776543



>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query364
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-12
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-10
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-05
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-11
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 8e-05
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 9e-10
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 1e-09
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 1e-09
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-08
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-04
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 6e-05
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-08
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-08
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-08
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 3e-08
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-08
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-04
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 4e-08
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-04
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 4e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 5e-08
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-08
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-04
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-06
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 1e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 6e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-07
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-04
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-07
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 5e-07
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 6e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 8e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-04
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-06
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-04
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-06
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-06
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 7e-06
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-05
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-05
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 3e-05
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-05
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 3e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-05
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-05
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 5e-05
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 5e-05
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 5e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 5e-05
3uxg_A172 Crystal Structure Of Rfxank Length = 172 5e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 6e-05
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 8e-05
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-04
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-04
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 5e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-04
1uoh_A226 Human Gankyrin Length = 226 1e-04
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-04
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 3e-04
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 5e-04
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 5e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-04
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 8e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure

Iteration: 1

Score = 69.3 bits (168), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 44/120 (36%), Positives = 68/120 (56%), Gaps = 6/120 (5%) Query: 79 GDTPLHLAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTK 138 G TPLHLAA+ GH +V L+E A + + T LH A +G+++VVK+L + Sbjct: 2 GRTPLHLAARNGHLEVVKLLLE-----AGADVNAKDKNGRTPLHLAARNGHLEVVKLLLE 56 Query: 139 QDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFE 198 D +++K G+T L++AA + E+V LLE V+ + NG+T LH AA + + E Sbjct: 57 AGADV-NAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLE 115
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query364
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-33
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-31
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-30
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-32
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-28
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-31
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-25
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-24
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-30
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-26
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-19
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-24
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-29
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-24
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-29
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-29
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-22
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-29
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-27
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-29
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-28
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-21
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-29
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-24
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-28
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-27
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-27
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-26
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-27
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-20
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-16
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-27
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-26
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-25
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-26
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-23
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-26
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-22
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-26
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-26
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-24
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-25
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-17
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-25
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-25
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-16
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-25
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-18
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-24
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-24
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-24
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-22
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-09
2rfa_A232 Transient receptor potential cation channel subfa 1e-23
2rfa_A232 Transient receptor potential cation channel subfa 1e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-20
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-20
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-17
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-18
2etb_A256 Transient receptor potential cation channel subfam 3e-20
2etb_A256 Transient receptor potential cation channel subfam 8e-14
2etb_A256 Transient receptor potential cation channel subfam 9e-14
2etb_A256 Transient receptor potential cation channel subfam 6e-08
2etb_A256 Transient receptor potential cation channel subfam 5e-07
2pnn_A273 Transient receptor potential cation channel subfa 4e-20
2pnn_A273 Transient receptor potential cation channel subfa 6e-18
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-20
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-13
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-19
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-16
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  127 bits (322), Expect = 2e-33
 Identities = 71/237 (29%), Positives = 101/237 (42%), Gaps = 36/237 (15%)

Query: 71  LLLQ----VNAK---GDTPLHLAAKFGHSNIVSFLIER-AKLAAWQMMRMTNNEKNTALH 122
           LLL+     N     G TPLH+AA+ GH   V  L+E+ A  A          +  T LH
Sbjct: 98  LLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQAC------MTKKGFTPLH 151

Query: 123 EAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGP 182
            A  +G V+V ++L ++D   P +  K G T L++A      ++V  LL    S      
Sbjct: 152 VAAKYGKVRVAELLLERDAH-PNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW 210

Query: 183 NGKTALHAAAMHFYFENDQTA-------ADIADKDRK-MTALHLAAGQGHARTVETILFL 234
           NG T LH AA     E    A            +  + +T LHLAA +GHA  V   L L
Sbjct: 211 NGYTPLHIAAKQNQVE---VARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVA--LLL 265

Query: 235 DPKCY-ELVDHRGWNFLHYAMVSFKLHE--LKILLKNPLARSLIYEGDNNGNTPLHV 288
             +    L +  G   LH    + + H     +L+K+     ++      G TPLHV
Sbjct: 266 SKQANGNLGNKSGLTPLHLV--AQEGHVPVADVLIKH---GVMVDATTRMGYTPLHV 317


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query364
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.88
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.82
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=3e-51  Score=374.33  Aligned_cols=302  Identities=25%  Similarity=0.266  Sum_probs=170.7

Q ss_pred             CCChhHHHHHhcCChHHhhhccCChhHHHhhhhccCCchHHHHHHHHHhcCCChHHHHHHHhcCCccccccCCCCCcHHH
Q 046373            5 SIYPNFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLH   84 (364)
Q Consensus         5 ~~~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~g~t~L~   84 (364)
                      ...++||.|+..|++++|++|++.+ .+....+..|.||||+|  +..|+.+++++|++.    +.+++..+..|.||||
T Consensus        13 ~g~t~L~~Aa~~g~~~~v~~Ll~~g-~~~~~~~~~~~t~L~~A--~~~g~~~~v~~Ll~~----g~~~~~~~~~g~t~L~   85 (437)
T 1n11_A           13 SGLTPLHVASFMGHLPIVKNLLQRG-ASPNVSNVKVETPLHMA--ARAGHTEVAKYLLQN----KAKVNAKAKDDQTPLH   85 (437)
T ss_dssp             --CCHHHHHHHHTCHHHHHHHHHTT-CCSCCSSSCCCCHHHHH--HHHTCHHHHHHHHHH----TCCSSCCCTTSCCHHH
T ss_pred             CCCCHHHHHHHCCCHHHHHHHHHcC-CCCCCCCCCCCCHHHHH--HHcCCHHHHHHHHhC----CCCCCCCCCCCCCHHH
Confidence            3457888888888888888888876 55556666788888888  888888888888876    6777777788888888


Q ss_pred             HHHHcCCHHHHHHHHHHhhHHHhHhhhcCCCCCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCCcCCchHHHHHHhcCCH
Q 046373           85 LAAKFGHSNIVSFLIERAKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQDPDYPYSENKYGKTSLYMAAEGRYS  164 (364)
Q Consensus        85 ~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~g~t~l~~a~~~~~~e~v~~Ll~~~~~~~~~~~~~~~t~l~~A~~~~~~  164 (364)
                      +|+..|+.++|++|++++++     ++..+..|.||||+|+..|+.+++++|++.+.+.. ..+..|.||||+|+..|+.
T Consensus        86 ~A~~~g~~~~v~~Ll~~ga~-----~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~-~~~~~g~t~L~~A~~~g~~  159 (437)
T 1n11_A           86 CAARIGHTNMVKLLLENNAN-----PNLATTAGHTPLHIAAREGHVETVLALLEKEASQA-CMTKKGFTPLHVAAKYGKV  159 (437)
T ss_dssp             HHHHHTCHHHHHHHHHHTCC-----TTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSC-CCCTTSCCHHHHHHHTTCH
T ss_pred             HHHHCCCHHHHHHHHhCCCC-----CCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCc-CCCCCCCCHHHHHHHcCCH
Confidence            88888888888888887765     34455555555555555555555555555554433 3334445555555555555


Q ss_pred             HHHHHHHHcCCCCCCCCCCCCChHHHHHHh---------------------------------hhhhcchhhhhh-----
Q 046373          165 EMVIELLENCTSVSHEGPNGKTALHAAAMH---------------------------------FYFENDQTAADI-----  206 (364)
Q Consensus       165 ~~v~~Ll~~~~~~~~~~~~~~~~l~~a~~~---------------------------------~~~~~~~~~~~~-----  206 (364)
                      +++++|++.|++++..+..|.||||+|+..                                 ..++....+...     
T Consensus       160 ~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~  239 (437)
T 1n11_A          160 RVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSAN  239 (437)
T ss_dssp             HHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTT
T ss_pred             HHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCC
Confidence            555555555554444444444444444443                                 111111111110     


Q ss_pred             hccCCCchHHHHHHhcCCHHHHHHHHhcCCcccccccCCCCcHHHHHHHcCCHHHHHHHHhCcccccccccCCCCCCcHH
Q 046373          207 ADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHELKILLKNPLARSLIYEGDNNGNTPL  286 (364)
Q Consensus       207 ~~~~~~~t~L~~a~~~~~~~~~~~Ll~~~~~~~~~~d~~g~t~l~~a~~~~~~~~~~~ll~~~~~~~~i~~~d~~g~t~L  286 (364)
                      .....|.||||.|+..|+.+++++|++++++ .+..+..|+||||+|+..|+.+++++|+++   +++++.+|..|.|||
T Consensus       240 ~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~-~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~---g~~~~~~~~~g~t~L  315 (437)
T 1n11_A          240 AESVQGVTPLHLAAQEGHAEMVALLLSKQAN-GNLGNKSGLTPLHLVAQEGHVPVADVLIKH---GVMVDATTRMGYTPL  315 (437)
T ss_dssp             CCCTTCCCHHHHHHHTTCHHHHHHHHTTTCC-TTCCCTTCCCHHHHHHHHTCHHHHHHHHHH---TCCTTCCCSSCCCHH
T ss_pred             CCCCCCCCHHHHHHHCCCHHHHHHHHhcCCC-CCCCCCCCCCHHHHHHHcCCHHHHHHHHhC---CccCCCCCCCCCCHH
Confidence            1112344555555555555555555555444 234444444444444444444444444444   444555555555555


Q ss_pred             HHHHhcCCcceeehhhhcccCCcccccccCCCchhHHhh
Q 046373          287 HVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLI  325 (364)
Q Consensus       287 ~~A~~~~~~~~~~~~ll~~~~~~~~~~n~~g~t~l~~a~  325 (364)
                      |+|+..|+  ...+.+|+++|++++.+|..|+||||+|+
T Consensus       316 ~~A~~~g~--~~~v~~Ll~~gad~n~~~~~g~t~L~~A~  352 (437)
T 1n11_A          316 HVASHYGN--IKLVKFLLQHQADVNAKTKLGYSPLHQAA  352 (437)
T ss_dssp             HHHHHSSC--SHHHHHHHHTTCCTTCCCTTSCCHHHHHH
T ss_pred             HHHHHcCc--HHHHHHHHhcCCCCCCCCCCCCCHHHHHH
Confidence            55555555  33444444455555555555555555553



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 364
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-23
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-20
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-18
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-18
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-07
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-17
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.001
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 3e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.001
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 97.0 bits (240), Expect = 6e-23
 Identities = 65/224 (29%), Positives = 93/224 (41%), Gaps = 17/224 (7%)

Query: 81  TPLHLAAKFGHSNIVSFLIER-AKLAAWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQ 139
           TPLH+A+  GH  IV  L++R A          +N +  T LH A   G+ +V K L + 
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNV------SNVKVETPLHMAARAGHTEVAKYLLQN 55

Query: 140 DPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAM-----H 194
                 ++ K  +T L+ AA   ++ MV  LLEN  + +     G T LH AA       
Sbjct: 56  KAK-VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVET 114

Query: 195 FYFENDQTAADIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAM 254
                ++ A+      +  T LH+AA  G  R  E +L  D          G   LH A+
Sbjct: 115 VLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHP-NAAGKNGLTPLHVAV 173

Query: 255 VSFKLHELKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFF 298
               L  +K+LL         +    NG TPLH+ A     E  
Sbjct: 174 HHNNLDIVKLLLPR---GGSPHSPAWNGYTPLHIAAKQNQVEVA 214


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query364
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.98
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=7.1e-47  Score=340.11  Aligned_cols=308  Identities=21%  Similarity=0.218  Sum_probs=263.7

Q ss_pred             hhHHHHHhcCChHHhhhccCChhHHHhhhhccCCchHHHHHHHHHhcCCChHHHHHHHhcCCccccccCCCCCcHHHHHH
Q 046373            8 PNFFNAAAAGDAETFKRNTTSDEIESLLTAQTKNTILHINIISQKRKNGSTKFIGEMLKKCPSLLLQVNAKGDTPLHLAA   87 (364)
Q Consensus         8 ~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~g~t~L~~A~   87 (364)
                      +|||.||..|++++|++|+++| .+....+..|.||||+|  +..|+.+++++|+++    +++++..+..|.||||+|+
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~g-~~in~~d~~g~TpL~~A--~~~g~~~iv~~Ll~~----gadi~~~~~~g~t~L~~A~   74 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQRG-ASPNVSNVKVETPLHMA--ARAGHTEVAKYLLQN----KAKVNAKAKDDQTPLHCAA   74 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHTT-CCSCCSSSCCCCHHHHH--HHHTCHHHHHHHHHH----TCCSSCCCTTSCCHHHHHH
T ss_pred             ChHHHHHHCcCHHHHHHHHHCC-CCCCCCCCCCCCHHHHH--HHcCCHHHHHHHHHC----cCCCCCCCCCCCCHHHHHH
Confidence            7999999999999999999998 77777888999999999  999999999999997    8899999999999999999


Q ss_pred             HcCCHHHHHHHHHHhhHH----------------------------HhHhhhcCCCCCCcHHHHHHHcCCHHHHHHHHhc
Q 046373           88 KFGHSNIVSFLIERAKLA----------------------------AWQMMRMTNNEKNTALHEAVCHGNVQVVKILTKQ  139 (364)
Q Consensus        88 ~~~~~~~v~~Ll~~~~~~----------------------------~~~~~~~~~~~g~t~l~~a~~~~~~e~v~~Ll~~  139 (364)
                      ..|+.+++++|+......                            ........+..+.++++.|+..++.+++++|+++
T Consensus        75 ~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~  154 (408)
T d1n11a_          75 RIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLER  154 (408)
T ss_dssp             HHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHT
T ss_pred             HcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHc
Confidence            999999999999876541                            0011244567889999999999999999999999


Q ss_pred             CCCCCCCCCcCCchHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCCChHHHHHHhhhhh---------------------
Q 046373          140 DPDYPYSENKYGKTSLYMAAEGRYSEMVIELLENCTSVSHEGPNGKTALHAAAMHFYFE---------------------  198 (364)
Q Consensus       140 ~~~~~~~~~~~~~t~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~l~~a~~~~~~~---------------------  198 (364)
                      +.++. ..+..|.+||++|+..++.+++++|+++|++++..+..|.||++.+......+                     
T Consensus       155 ~~~~~-~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t  233 (408)
T d1n11a_         155 DAHPN-AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVT  233 (408)
T ss_dssp             TCCTT-CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCC
T ss_pred             CCCCC-cCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCC
Confidence            98865 67778999999999999999999999999999999999999998887651100                     


Q ss_pred             ------------cchhhh-----hhhccCCCchHHHHHHhcCCHHHHHHHHhcCCcccccccCCCCcHHHHHHHcCCHHH
Q 046373          199 ------------NDQTAA-----DIADKDRKMTALHLAAGQGHARTVETILFLDPKCYELVDHRGWNFLHYAMVSFKLHE  261 (364)
Q Consensus       199 ------------~~~~~~-----~~~~~~~~~t~L~~a~~~~~~~~~~~Ll~~~~~~~~~~d~~g~t~l~~a~~~~~~~~  261 (364)
                                  ......     .......|.||++.|+..++.+++++|+++|.+ ++..+..+.||||.++..++.++
T Consensus       234 ~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~-~~~~~~~~~t~L~~~~~~~~~~~  312 (408)
T d1n11a_         234 PLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPLHVASHYGNIKL  312 (408)
T ss_dssp             HHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC-TTCCCSSCCCHHHHHHHSSCSHH
T ss_pred             HHHHHHHhCcHhHhhhhhccccccccccCCCCChhhhhhhcCcHHHHHHHHHCCCc-cccccccccccchhhcccCccee
Confidence                        000000     001224677899999999999999999999988 47778889999999999999999


Q ss_pred             HHHHHhCcccccccccCCCCCCcHHHHHHhcCCcceeehhhhcccCCcccccccCCCchhHHhhhccc
Q 046373          262 LKILLKNPLARSLIYEGDNNGNTPLHVLAAIRPKEFFKIKVRYDAGGNYGAVNKQNVSVTDVLIYGSR  329 (364)
Q Consensus       262 ~~~ll~~~~~~~~i~~~d~~g~t~L~~A~~~~~~~~~~~~ll~~~~~~~~~~n~~g~t~l~~a~~~~~  329 (364)
                      ++.+++.   ++++|.+|..|.||||+|++.|+  ...+.+|+++|++++.+|..|+||||+|+..+.
T Consensus       313 ~~~ll~~---g~~in~~d~~G~T~Lh~A~~~g~--~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~  375 (408)
T d1n11a_         313 VKFLLQH---QADVNAKTKLGYSPLHQAAQQGH--TDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGY  375 (408)
T ss_dssp             HHHHHHT---TCCTTCCCTTSCCHHHHHHHTTC--HHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTC
T ss_pred             eeeeccc---cccccccCCCCCCHHHHHHHcCC--HHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCC
Confidence            9999997   89999999999999999999999  667788889999999999999999999976654



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure