Citrus Sinensis ID: 046389

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
ETCEEKSTLSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRRDYGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNYGLQTPRELFTQSHRSLIEDGQKWMRETADSCMVVATLVATVVFAAAFTIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCKLFDD
cccccccccHHHHHHHHcccHHHHHHHHHccHHHHHHccccccccHHHHHHHcccHHHHHHHHHcccHHHcccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHccccccHHHHccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
ccccccccccHHHHHHHcccHHHHHHHHHccccHHHHccccccccHHHHHHHcccHHHHHHHHHccccHHcccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHccccHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccEEcccccccccHHHHHHHcccHHHHHHHHHccccHcHHcccccHHHHHHccccHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEHccccHHEEEEHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
ETCEEKSTLSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLlgyspqvlkLTDYFGQTALSLAAASGNLDLVQLMTEDNEhlaldresvdqylpihagamsGHKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALRLFkdhpqlatlrdsnEETALHALAGKSMMSSYLANQNQQGMLQNFFssanvgstklSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPyiiskhddmgrTMFHIAVLNHQVKILELINEMGSMKDRIVSrrdyggnnilhmagmqpsnegpnvVFGAVLQLQQEVLWFKKVSEIVRPVDAEarnyglqtprelFTQSHRSLIEDGQKWMRETADSCMVVATLVATVVFAAaftipggnkgdtgvpifIEEASFIAFAISDAVGLVFSATSILTFLSIrssvyseedflwrvpgslASGLASLFMSIAAMMVVFCTTSftifhdrlpwlPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCKLFDD
etceekstlsklyrAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRRDYGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEarnyglqtprelftqsHRSLIEDGQKWMRETADSCMVVATLVATVVFAAAFTIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCKLFDD
ETCEEKSTLSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITEGQLDNKDlielliiliKTDLYEVALRLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRRDYGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNYGLQTPRELFTQSHRSLIEDGQKWMRETADSCMvvatlvatvvfaaaftIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCKLFDD
***********LYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLAT******************************MLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRRDYGGNNILHMAG******GPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNYGLQTPRELFTQSHRSLIEDGQKWMRETADSCMVVATLVATVVFAAAFTIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCKLF**
*TCEEKSTLSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRRDYGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNYGLQTP*********************TADSCMVVATLVATVVFAAAFTIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCKLFDD
*********SKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRRDYGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNYGLQTPRELFTQSHRSLIEDGQKWMRETADSCMVVATLVATVVFAAAFTIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCKLFDD
*****KSTLSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRRDYGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNYGLQTPRELFTQSHRSLIEDGQKWMRETADSCMVVATLVATVVFAAAFTIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCKLF**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ETCEEKSTLSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRRDYGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNYGLQTPRELFTQSHRSLIEDGQKWMRETADSCMVVATLVATVVFAAAFTIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCKLFDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query558 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.781 0.738 0.228 9e-16
Q6AWW5524 Ankyrin repeat-containing no no 0.713 0.759 0.239 5e-10
Q9TZM3 2393 Leucine-rich repeat serin yes no 0.474 0.110 0.246 8e-08
P16157 1881 Ankyrin-1 OS=Homo sapiens yes no 0.437 0.129 0.239 5e-07
Q02357 1862 Ankyrin-1 OS=Mus musculus yes no 0.437 0.131 0.236 7e-07
Q502K3 1071 Serine/threonine-protein no no 0.492 0.256 0.253 2e-06
Q5U312 978 Ankycorbin OS=Rattus norv no no 0.152 0.086 0.366 4e-06
Q146781352 KN motif and ankyrin repe no no 0.191 0.079 0.341 7e-06
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.216 0.061 0.333 1e-05
Q495B1522 Ankyrin repeat and death no no 0.225 0.241 0.317 1e-05
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 85.9 bits (211), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 132/577 (22%), Positives = 227/577 (39%), Gaps = 141/577 (24%)

Query: 32  EDYVKASLSKLGETALHVAASAGRIDFVKNLLG--------------YSPQVLKL----- 72
           + YVK    +  +T LH+AA  G +  V+ +L               +  +V ++     
Sbjct: 63  KKYVKQVTGRHNDTELHLAAQRGDLAAVQQILKDINSQMEGILSGEEFDAEVAEIRASIV 122

Query: 73  --TDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLY 130
              +  G+TAL  AA  G+LD+V+ + + +   ++ +++   Y P+H  A+ GH  +V  
Sbjct: 123 NEVNELGETALFTAADKGHLDVVKELLKYSSRESIAKKNRSGYDPLHIAAIQGHHAIVEV 182

Query: 131 L--YSITEGQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLATLRDSNEETALHALAGK 188
           L  +  T  Q         L+        EV  +L      L  +  SN + ALH  A  
Sbjct: 183 LLDHDATLSQTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLEISRSNNKNALHLAA-- 240

Query: 189 SMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEIS 248
                      +QG                             VE+I  + + S+D +++
Sbjct: 241 -----------RQGH----------------------------VEVI--KALLSKDPQLA 259

Query: 249 TLIERPFQLTFVAAEKG-NIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELI 307
             I++  Q     A KG + E +++L+   P I+ + D    T  H+A    + +I+EL+
Sbjct: 260 RRIDKKGQTALHMAVKGQSSEVVKLLLDADPAIVMQPDKSCNTALHVATRKKRAEIVELL 319

Query: 308 NEMGSMKDRIVSRRDYGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFK-------- 359
             +       ++R      +I          EG        L L +E  + K        
Sbjct: 320 LSLPDTNANTLTRDHKTALDIA---------EG--------LPLSEESSYIKECLARSGA 362

Query: 360 -KVSEIVRPVDAEARNYGLQTPREL---FTQSHRS------LIEDGQKWMRE----TADS 405
            + +E+ +P D E R+   Q   ++     Q+ R+      + ++ +K  RE      +S
Sbjct: 363 LRANELNQPRD-ELRSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKLHREGINNATNS 421

Query: 406 CMVVATLVATVVFAAAFTIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFS-ATSILTF 464
             VVA L ATV FAA FT+PGG+  D G  + +  ASF  F I +A+ L  S A  ++  
Sbjct: 422 VTVVAVLFATVAFAAIFTVPGGDNND-GSAVVVGRASFKIFFIFNALALFTSLAVVVVQI 480

Query: 465 LSIRSSVYSEE-------DFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPW 517
             +R    +E+         +W         LAS+  S+A     F  +S+ +   +  W
Sbjct: 481 TLVRGETKAEKRVVEVINKLMW---------LASMCTSVA-----FLASSYIVVGRKNEW 526

Query: 518 LPVLVTVISSIPVLLFIRQYHRFFASTLGVLQRYKCK 554
              LVTV+  +             A  LG +  Y  K
Sbjct: 527 AAELVTVVGGV-----------IMAGVLGTMTYYVVK 552

Arabidopsis thaliana (taxid: 3702)
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|Q9TZM3|LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans GN=lrk-1 PE=1 SV=6 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description
>sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=2 SV=2 Back     alignment and function description
>sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query558
224120488610 predicted protein [Populus trichocarpa] 0.955 0.873 0.439 1e-123
359483665 762 PREDICTED: ankyrin repeat-containing pro 0.931 0.682 0.433 1e-114
359472754 789 PREDICTED: ankyrin repeat-containing pro 0.917 0.648 0.437 1e-113
224136692 743 predicted protein [Populus trichocarpa] 0.924 0.694 0.431 1e-112
147784800 1697 hypothetical protein VITISV_029434 [Viti 0.921 0.302 0.420 1e-112
147860696 891 hypothetical protein VITISV_011174 [Viti 0.905 0.566 0.415 1e-110
297737987 1855 unnamed protein product [Vitis vinifera] 0.870 0.261 0.423 1e-107
359473665602 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.939 0.870 0.438 1e-106
225425076563 PREDICTED: ankyrin repeat-containing pro 0.870 0.863 0.421 1e-105
297740805 702 unnamed protein product [Vitis vinifera] 0.849 0.675 0.395 2e-98
>gi|224120488|ref|XP_002331060.1| predicted protein [Populus trichocarpa] gi|222872990|gb|EEF10121.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 237/539 (43%), Positives = 349/539 (64%), Gaps = 6/539 (1%)

Query: 5   EKSTLSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLG 64
           E+    +LY+AAL  DW TAE I++     V A ++K GETALH+AA+A    FVK L+G
Sbjct: 45  ERKRHLQLYQAALSGDWDTAEGIYKLCPGEVNARITKRGETALHIAAAAEHTHFVKQLVG 104

Query: 65  Y-SPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSG 123
             S + L      G TA   AA SG   L ++M +    LA+ R      LPI+   + G
Sbjct: 105 MMSIEALAYRSSAGNTAFCFAAISGVEALAKVMMDKKPDLAMTR-GRGNLLPIYMATLLG 163

Query: 124 HKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLATLRDSNEETALH 183
           H+ +V YLY  T+ QL + D I+LL+ LI +D+Y+VA ++ K+H  LA  RD ++ TALH
Sbjct: 164 HRGMVSYLYDETKEQLTDGDRIKLLVALINSDIYDVAWKMLKEHRGLAYARDEHQLTALH 223

Query: 184 ALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQ 243
           A + KS M S + +Q+  G      +     +    L H   +QA+ L++ +W++V+   
Sbjct: 224 AFSQKSCMPSNVVDQSPPGFWNKCLNPCFKLAQMKKLMH---KQALDLIQYLWEQVVLLD 280

Query: 244 DSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKI 303
           DS IS+ I +P+ L F AAE+GN++ L +LIR YP +I K D    ++FHIA+LN    I
Sbjct: 281 DSTISSQIGKPWPLIFTAAERGNLDLLTILIRLYPELIFKVDQNTYSIFHIAILNRHEDI 340

Query: 304 LELINEMGSMKDRIVSRRDYGGNNILHMAG-MQPSNEGPNVVFGAVLQLQQEVLWFKKVS 362
           L++I ++GS+K+ +   +D  GNN+LH+A  +  S    N + GA LQLQ+E+LWF++V 
Sbjct: 341 LKMIYQIGSIKNVMTIYKDREGNNMLHLAAKVLESPSRLNAIPGAALQLQRELLWFEEVK 400

Query: 363 EIVRPVDAEARNYGLQTPRELFTQSHRSLIEDGQKWMRETADSCMVVATLVATVVFAAAF 422
           ++V+P   E +N+  +TP  LF + HR L+++G++WMR+TADSCM+VATL+ATVVFAAAF
Sbjct: 401 KVVQPRHIEEKNFHGKTPGALFIEQHRDLMKEGEQWMRDTADSCMLVATLIATVVFAAAF 460

Query: 423 TIPGGNKGDTGVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVP 482
           T+PGGN  D G P+F++E +F  FAISDA+ LV SA+S+LTFLS R+S Y+E++FLW +P
Sbjct: 461 TVPGGNFQDKGTPVFLKEIAFKFFAISDAISLVTSASSLLTFLSTRTSRYAEQNFLWSLP 520

Query: 483 GSLASGLASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFF 541
             L  GL +LF+SI AMMV F  T F +F ++L    + + V++S+PV+ FI Q+ R F
Sbjct: 521 NRLIIGLTTLFISIGAMMVAFMATFFLVFGNKLLPYSIPIAVVASLPVIFFIWQHFRLF 579

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359483665|ref|XP_003632996.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136692|ref|XP_002322392.1| predicted protein [Populus trichocarpa] gi|222869388|gb|EEF06519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860696|emb|CAN81449.1| hypothetical protein VITISV_011174 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737987|emb|CBI27188.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473665|ref|XP_003631341.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225425076|ref|XP_002271486.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740805|emb|CBI30987.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query558
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.517 0.503 0.361 7.7e-64
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.562 0.904 0.372 2.8e-50
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.494 0.412 0.345 3.8e-50
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.862 0.769 0.299 4.7e-48
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.569 0.527 0.316 4e-45
TAIR|locus:2165194282 AT5G35830 [Arabidopsis thalian 0.277 0.549 0.325 3.9e-16
ZFIN|ZDB-GENE-060526-136586 ankdd1b "ankyrin repeat and de 0.514 0.489 0.269 6.9e-12
TAIR|locus:2020833616 AT1G03670 "AT1G03670" [Arabido 0.860 0.779 0.200 2.1e-11
TAIR|locus:2031948627 AT1G05640 "AT1G05640" [Arabido 0.374 0.333 0.277 7.2e-10
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.417 0.429 0.231 1.2e-09
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 454 (164.9 bits), Expect = 7.7e-64, Sum P(2) = 7.7e-64
 Identities = 107/296 (36%), Positives = 161/296 (54%)

Query:   257 LTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDR 316
             L F AAE GN+E L +LIR +  ++   D+  RT+FH+A L     I  LI E+G +KD 
Sbjct:   258 LLFDAAELGNVEILVILIRSHLDLLWIVDNNNRTLFHVAALYRHENIFSLIYELGGIKDL 317

Query:   317 IVSRRD-YGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNY 375
             I S ++    + +LH+    P      V  GA L +Q+E+LWFK V EIV     E +N 
Sbjct:   318 IASYKEKQSKDTLLHLVARLPPMNRQQVGSGAALHMQKELLWFKAVKEIVPRSYIETKNT 377

Query:   376 GLQTPRELFTQSHRSLIEDGQKWMRETADSCMXXXXXXXXXXXXXXXXIPGGN--KGDT- 432
               +   ++FT+ H +L ++G++WM+ETA +CM                IPGGN   GD  
Sbjct:   378 KGELAHDIFTEQHENLRKEGERWMKETATACMLGATLIATVVFAAAITIPGGNDDSGDKA 437

Query:   433 ---GVPIFIEEASFIAFAISDAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGL 489
                G P F +   F  F +SD+V L  S  SI+ FLSI +S Y+EEDF + +P  L  GL
Sbjct:   438 NTLGFPNFRKRLLFDIFTLSDSVALFSSMMSIVIFLSIFTSRYAEEDFRYDLPTKLMFGL 497

Query:   490 ASLFMSIAAMMVVFCTTSFTIFHDRLPWLPVLVTVISSIPVLLFIRQYHRFFASTL 545
             ++LF+SI +M++ F  +   I  ++     VL++ ++S+  L F   Y   + +TL
Sbjct:   498 SALFISIISMILAFTFSMILIRVEKASLSLVLISCLASLTALTFAYLYFHLWFNTL 553
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165194 AT5G35830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-136 ankdd1b "ankyrin repeat and death domain containing 1B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01520066
hypothetical protein (610 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
pfam13962114 pfam13962, PGG, Domain of unknown function 3e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.002
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.002
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information 
 Score = 99.9 bits (250), Expect = 3e-25
 Identities = 42/121 (34%), Positives = 63/121 (52%), Gaps = 13/121 (10%)

Query: 396 QKWMRETADSCMVVATLVATVVFAAAFTIPGG-----NKGDTGVPIFIEEAS-FIAFAIS 449
            +W+ +T +S +VVATL+ATV FAA FT PGG          G PI   +   F AF +S
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 450 DAVGLVFSATSILTFLSIRSSVYSEEDFLWRVPGSLASGLASLFMSIAAMMVVFCTTSFT 509
           + +  V S  +++  L I         F  R+P  LA  L  L++S+ ++MV F   S+ 
Sbjct: 61  NTIAFVASLVAVILLLYIV------PSFSRRLPRLLA-LLTLLWLSLLSLMVAFAAGSYR 113

Query: 510 I 510
           +
Sbjct: 114 V 114

The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 558
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 99.98
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02792631 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.93
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
PF13962113 PGG: Domain of unknown function 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.9
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.89
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.86
KOG0514452 consensus Ankyrin repeat protein [General function 99.86
PHA02741169 hypothetical protein; Provisional 99.85
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.84
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.83
KOG0514452 consensus Ankyrin repeat protein [General function 99.82
PHA02741169 hypothetical protein; Provisional 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.82
PHA02884300 ankyrin repeat protein; Provisional 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.79
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.77
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.74
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.63
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.63
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.59
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.52
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.46
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.45
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.45
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.45
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.41
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.41
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.36
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.35
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.34
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.3
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.29
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.27
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.84
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.81
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.79
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.71
PF1360630 Ank_3: Ankyrin repeat 98.7
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.69
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.68
PF1360630 Ank_3: Ankyrin repeat 98.63
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.6
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.54
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.53
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.52
KOG0522560 consensus Ankyrin repeat protein [General function 98.51
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.47
KOG0522560 consensus Ankyrin repeat protein [General function 98.46
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.39
KOG0520975 consensus Uncharacterized conserved protein, conta 98.18
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.18
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.06
KOG2384223 consensus Major histocompatibility complex protein 98.01
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.0
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.99
KOG0511516 consensus Ankyrin repeat protein [General function 97.87
KOG2384223 consensus Major histocompatibility complex protein 97.83
KOG0520975 consensus Uncharacterized conserved protein, conta 97.77
KOG0511516 consensus Ankyrin repeat protein [General function 97.7
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.69
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.43
KOG2505591 consensus Ankyrin repeat protein [General function 96.05
KOG2505591 consensus Ankyrin repeat protein [General function 95.53
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.9
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 94.83
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.53
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 92.55
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 91.45
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.36
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.03
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.39
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.2e-47  Score=408.78  Aligned_cols=344  Identities=14%  Similarity=0.067  Sum_probs=288.8

Q ss_pred             ccCCcHHHHHHHHcCCHHHHHHHHhhCchhhhhhcCCCCchHHHHHH---------------------------------
Q 046389            5 EKSTLSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAA---------------------------------   51 (558)
Q Consensus         5 d~~g~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~g~t~Lh~Aa---------------------------------   51 (558)
                      +..+.||||+|+..|+.|+|+.|++++|..+... |..|.||||+|+                                 
T Consensus        38 ~~~~~t~LH~A~~~g~~e~V~~ll~~~~~~~~~~-~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  116 (682)
T PHA02876         38 ESIPFTAIHQALQLRQIDIVEEIIQQNPELIYIT-DHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKYASIILNKHK  116 (682)
T ss_pred             ccccchHHHHHHHHHhhhHHHHHHHhCcccchhh-chhhccccccccCCCCccccccccccchhhcccccHHHHHHHHHH
Confidence            5578999999999999999999999988766655 888999999666                                 


Q ss_pred             -------------------------------------HCCCHHHHHHHhcCCCcccccccCCCCcHhHHHHHcCCHHHHH
Q 046389           52 -------------------------------------SAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQ   94 (558)
Q Consensus        52 -------------------------------------~~g~~~~v~~Ll~~~~~~~~~~d~~g~TpLh~A~~~g~~eiv~   94 (558)
                                                           ..|+.+++++|++. |++++.+|..|.||||+|+..|+.++++
T Consensus       117 ~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~~-Gadvn~~d~~G~TpLh~Aa~~G~~~iv~  195 (682)
T PHA02876        117 LDEACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLEG-GADVNAKDIYCITPIHYAAERGNAKMVN  195 (682)
T ss_pred             HHHHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHhC-CCCCCCCCCCCCCHHHHHHHCCCHHHHH
Confidence                                                 55788999999998 9999999999999999999999999999


Q ss_pred             HHHHcCcccccccCCCCCccHHHHHHHcCChHHHHHHHhcCc------------------------------cccCccch
Q 046389           95 LMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITE------------------------------GQLDNKDL  144 (558)
Q Consensus        95 ~Ll~~~~~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~~~------------------------------~~~~~~~~  144 (558)
                      +|+++|+++ ...+ ..|.||||+|+..|+.+++++|++.+.                              .+..+..|
T Consensus       196 ~LL~~Gad~-n~~~-~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~~~~~~L~~ai~~~~~~~~~~Ll~~g~~vn~~d~~g  273 (682)
T PHA02876        196 LLLSYGADV-NIIA-LDDLSVLECAVDSKNIDTIKAIIDNRSNINKNDLSLLKAIRNEDLETSLLLYDAGFSVNSIDDCK  273 (682)
T ss_pred             HHHHCCCCc-CccC-CCCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCcHHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCC
Confidence            999999997 4555 789999999999999999988887654                              12345578


Q ss_pred             hHHHHHHHHhccHH-HHHHHHhhCCcccccccCCCCcHHHHHhcCCCchhhhhhhcccchhhhhhcccccccccchhhhH
Q 046389          145 IELLIILIKTDLYE-VALRLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHA  223 (558)
Q Consensus       145 ~t~l~~a~~~~~~~-~~~~Ll~~~~~~~~~~d~~g~t~L~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a  223 (558)
                      .||||.|+..++.+ +++.|++. +.+++.+|.+|.||||+|+..|........+...|.+++..    .....++++.|
T Consensus       274 ~TpLh~Aa~~~~~~~iv~lLl~~-gadin~~d~~g~TpLh~Aa~~g~~~~~v~~Ll~~gadin~~----d~~g~TpLh~A  348 (682)
T PHA02876        274 NTPLHHASQAPSLSRLVPKLLER-GADVNAKNIKGETPLYLMAKNGYDTENIRTLIMLGADVNAA----DRLYITPLHQA  348 (682)
T ss_pred             CCHHHHHHhCCCHHHHHHHHHHC-CCCCCCcCCCCCCHHHHHHHhCCCHHHHHHHHHcCCCCCCc----ccCCCcHHHHH
Confidence            99999999988864 56666655 77888889999999999999886556666677777776654    45567888888


Q ss_pred             HHH-HHHHHHHHHHHHhhccchhhhhhhccCCchHHHHHHhcChHHHHHHHHHhCCcccccccCCCCcHHHHHHHcCc-H
Q 046389          224 VLE-QAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQ-V  301 (558)
Q Consensus       224 ~~~-~~~~~v~~l~~~~~~~~~~~~~~~~~~g~tpLh~Aa~~g~~~iv~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~~~-~  301 (558)
                      +.. +..++++.|++.+++++..     +..|.||||+|+..|+.+++++|+++|+++ +..+..|.||||+|+..++ .
T Consensus       349 ~~~~~~~~iv~lLl~~gadin~~-----d~~G~TpLh~Aa~~~~~~iv~~Ll~~gad~-~~~~~~g~T~Lh~A~~~~~~~  422 (682)
T PHA02876        349 STLDRNKDIVITLLELGANVNAR-----DYCDKTPIHYAAVRNNVVIINTLLDYGADI-EALSQKIGTALHFALCGTNPY  422 (682)
T ss_pred             HHhCCcHHHHHHHHHcCCCCccC-----CCCCCCHHHHHHHcCCHHHHHHHHHCCCCc-cccCCCCCchHHHHHHcCCHH
Confidence            774 5678888899888877654     478899999999999999999999999998 8889999999999988665 5


Q ss_pred             HHHHHHHhcCCcccceeeeccCCCCchhhHhhcCC-CCCCCccccchHHHHHHHHHHHHHHHhhcCCcchhhccCCCCCh
Q 046389          302 KILELINEMGSMKDRIVSRRDYGGNNILHMAGMQP-SNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNYGLQTP  380 (558)
Q Consensus       302 ~iv~~Ll~~ga~~~~~in~~d~~g~TpLh~A~~~~-~~~~~~~l~~~~l~~~~~~~~~~~v~~l~~~~~~~~~n~~g~tp  380 (558)
                      .++++|++.|++    +|.+|..|+||||+|+..+ +.+++++|                   +..|++++.+|..|.||
T Consensus       423 ~~vk~Ll~~gad----in~~d~~G~TpLh~Aa~~~~~~~iv~lL-------------------l~~Gad~n~~d~~g~tp  479 (682)
T PHA02876        423 MSVKTLIDRGAN----VNSKNKDLSTPLHYACKKNCKLDVIEML-------------------LDNGADVNAINIQNQYP  479 (682)
T ss_pred             HHHHHHHhCCCC----CCcCCCCCChHHHHHHHhCCcHHHHHHH-------------------HHCCCCCCCCCCCCCCH
Confidence            678999999998    7899999999999999866 44444433                   33899999999999999


Q ss_pred             hhhhHH
Q 046389          381 RELFTQ  386 (558)
Q Consensus       381 l~~a~~  386 (558)
                      +++|.+
T Consensus       480 l~~a~~  485 (682)
T PHA02876        480 LLIALE  485 (682)
T ss_pred             HHHHHH
Confidence            999875

>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-07
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-06
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 6e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 9e-06
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 9e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-05
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-05
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-05
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-05
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-05
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-05
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-05
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-05
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 6e-05
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 7e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-04
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-04
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-04
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 5e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-04
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 7e-04
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure 
Iteration: 1

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
Query: 42  LGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNE 101
           LG T LH+AA  G ++ V+ LL Y   V    D +G T L LAA +G+L++V+++ +   
Sbjct: 46  LGHTPLHLAAKTGHLEIVEVLLKYGADV-NAWDNYGATPLHLAADNGHLEIVEVLLKHGA 104
Query: 102 HLALDRESVDQYLPIHAGAMSGHKEVV 128
              ++ +  + + P+H  A  GH E+V
Sbjct: 105 D--VNAKDYEGFTPLHLAAYDGHLEIV 129
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-04
2pnn_A273 Transient receptor potential cation channel subfa 5e-13
2pnn_A273 Transient receptor potential cation channel subfa 1e-11
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
2pnn_A273 Transient receptor potential cation channel subfa 4e-06
2pnn_A273 Transient receptor potential cation channel subfa 3e-04
2pnn_A273 Transient receptor potential cation channel subfa 8e-04
2rfa_A232 Transient receptor potential cation channel subfa 6e-13
2rfa_A232 Transient receptor potential cation channel subfa 4e-10
2rfa_A232 Transient receptor potential cation channel subfa 4e-09
2rfa_A232 Transient receptor potential cation channel subfa 7e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-10
2etb_A256 Transient receptor potential cation channel subfam 3e-12
2etb_A256 Transient receptor potential cation channel subfam 3e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-06
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-11
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-05
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score = 78.3 bits (194), Expect = 1e-15
 Identities = 60/370 (16%), Positives = 104/370 (28%), Gaps = 110/370 (29%)

Query: 16  ALDDDWQTA--ETIFESHEDYVKASLS---------KLGETALHVAASAGRIDFVKNLLG 64
                  T       E H + V A L          K G T LHVAA  G++   + LL 
Sbjct: 108 LATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLE 167

Query: 65  YSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEHLA-LDRESVDQYLPIHAGAMSG 123
                       G T L +A    NLD+V+L+             + + Y P+H  A   
Sbjct: 168 RDAHP-NAAGKNGLTPLHVAVHHNNLDIVKLLL---PRGGSPHSPAWNGYTPLHIAAKQN 223

Query: 124 HKEVVLYLYSITEG------------------QLDNKDLIELLI-----ILIKTDLYEVA 160
             EV   L  +  G                  Q  + +++ LL+       +        
Sbjct: 224 QVEVARSL--LQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTP 281

Query: 161 LRL--FKDHPQLATL----------RDSNEETALH--ALAGKSMMSSYL----ANQNQQG 202
           L L   + H  +A +                T LH  +  G   +  +L    A+ N + 
Sbjct: 282 LHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKT 341

Query: 203 MLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAA 262
                     +G + L                                          AA
Sbjct: 342 ---------KLGYSPLHQ----------------------------------------AA 352

Query: 263 EKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRRD 322
           ++G+ + + +L++            G T   IA     + + +++  +   +   V   D
Sbjct: 353 QQGHTDIVTLLLKNGASPNEV-SSDGTTPLAIAKRLGYISVTDVLKVVTD-ETSFVLVSD 410

Query: 323 YGGNNILHMA 332
               +     
Sbjct: 411 KHRMSFPETV 420
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query558
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2pnn_A273 Transient receptor potential cation channel subfa 99.98
2etb_A256 Transient receptor potential cation channel subfam 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.88
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.82
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.78
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.78
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.69
3gvo_A351 Pumilio 2, pumilio homolog 2; RNA-binding, PUF dom 89.77
3k49_A369 MRNA-binding protein PUF3; PUF3, pumilio, RNA bind 86.25
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2.4e-53  Score=438.04  Aligned_cols=363  Identities=19%  Similarity=0.148  Sum_probs=286.8

Q ss_pred             ccccCCcHHHHHHHHcCCHHHHHHHHhhCchhhhhhcCCCCchHHHHHHHCCCHHHHHHHhcCCCcccccccCCCCcHhH
Q 046389            3 CEEKSTLSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALS   82 (558)
Q Consensus         3 ~~d~~g~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~TpLh   82 (558)
                      ..|.+|+||||+|+..|+.++|++|++. +.+++.. +..|.||||+|+..|+.+++++|++. +++++.+|.+|.||||
T Consensus         9 ~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~-g~~~~~~-~~~~~t~L~~A~~~g~~~~v~~Ll~~-g~~~~~~~~~g~t~L~   85 (437)
T 1n11_A            9 GGGESGLTPLHVASFMGHLPIVKNLLQR-GASPNVS-NVKVETPLHMAARAGHTEVAKYLLQN-KAKVNAKAKDDQTPLH   85 (437)
T ss_dssp             ------CCHHHHHHHHTCHHHHHHHHHT-TCCSCCS-SSCCCCHHHHHHHHTCHHHHHHHHHH-TCCSSCCCTTSCCHHH
T ss_pred             ccCCCCCCHHHHHHHCCCHHHHHHHHHc-CCCCCCC-CCCCCCHHHHHHHcCCHHHHHHHHhC-CCCCCCCCCCCCCHHH
Confidence            4678899999999999999999988876 6777776 88999999999999999999999998 8999999999999999


Q ss_pred             HHHHcCCHHHHHHHHHcCcccccccCCCCCccHHHHHHHcCChHHHHHHHhcCc-cccCccchhHHHHHHHHhccHHHHH
Q 046389           83 LAAASGNLDLVQLMTEDNEHLALDRESVDQYLPIHAGAMSGHKEVVLYLYSITE-GQLDNKDLIELLIILIKTDLYEVAL  161 (558)
Q Consensus        83 ~A~~~g~~eiv~~Ll~~~~~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~~~-~~~~~~~~~t~l~~a~~~~~~~~~~  161 (558)
                      +|+..|+.+++++|+++|+++ ...+ ..|.||||+|+..|+.+++++|+++++ ....+..|.||||.|+..|+.++++
T Consensus        86 ~A~~~g~~~~v~~Ll~~ga~~-~~~~-~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~  163 (437)
T 1n11_A           86 CAARIGHTNMVKLLLENNANP-NLAT-TAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAE  163 (437)
T ss_dssp             HHHHHTCHHHHHHHHHHTCCT-TCCC-TTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHH
T ss_pred             HHHHCCCHHHHHHHHhCCCCC-CCCC-CCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHH
Confidence            999999999999999999987 4566 799999999999999999999999988 5567788999999999999999999


Q ss_pred             HHHhhCCcccccccCCCCcHHHHHhcCCCchhhhhhhcccchhhhhhcccccccccchhhhHHHHHHHHHHHHHHHHhhc
Q 046389          162 RLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIR  241 (558)
Q Consensus       162 ~Ll~~~~~~~~~~d~~g~t~L~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~l~~~~~~  241 (558)
                      .|+++ +.+++..+..|.||||+|+..++.+.+ ..+...+...+..    .....++++.|+..++.+++++|++.+.+
T Consensus       164 ~Ll~~-g~~~~~~~~~g~t~L~~A~~~~~~~~v-~~Ll~~g~~~~~~----~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~  237 (437)
T 1n11_A          164 LLLER-DAHPNAAGKNGLTPLHVAVHHNNLDIV-KLLLPRGGSPHSP----AWNGYTPLHIAAKQNQVEVARSLLQYGGS  237 (437)
T ss_dssp             HHHHT-TCCTTCCCSSCCCHHHHHHHTTCHHHH-HHHGGGTCCSCCC----CTTCCCHHHHHHHTTCHHHHHHHHHTTCC
T ss_pred             HHHhC-CCCCCCCCCCCCCHHHHHHHcCCHHHH-HHHHhCCCCCCCc----CCCCCCHHHHHHHcCCHHHHHHHHHcCCC
Confidence            99997 677788899999999999999987544 3444444443322    33456778888888888888888887766


Q ss_pred             cchhhhhhhccCCchHHHHHHhcChHHHHHHHHHhCCcccccccCCCCcHHHHHHHcCcHHHHHHHHhcCCcccceeeec
Q 046389          242 SQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMGSMKDRIVSRR  321 (558)
Q Consensus       242 ~~~~~~~~~~~~g~tpLh~Aa~~g~~~iv~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~~~~~iv~~Ll~~ga~~~~~in~~  321 (558)
                      .+..+     ..|.||||+|+..|+.+++++|+++++++ +..|..|+||||+|+..|+.+++++|+++|++    +|.+
T Consensus       238 ~~~~~-----~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~-~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~----~~~~  307 (437)
T 1n11_A          238 ANAES-----VQGVTPLHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM----VDAT  307 (437)
T ss_dssp             TTCCC-----TTCCCHHHHHHHTTCHHHHHHHHTTTCCT-TCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC----TTCC
T ss_pred             CCCCC-----CCCCCHHHHHHHCCCHHHHHHHHhcCCCC-CCCCCCCCCHHHHHHHcCCHHHHHHHHhCCcc----CCCC
Confidence            55433     56677777777777777777777777776 77777777777777777777777777777777    5677


Q ss_pred             cCCCCchhhHhhcCCCCCCCcccc-------------chHHHHHHHHHHHHHHHhhc-CCcchhhccCCCCChhhhhHH
Q 046389          322 DYGGNNILHMAGMQPSNEGPNVVF-------------GAVLQLQQEVLWFKKVSEIV-RPVDAEARNYGLQTPRELFTQ  386 (558)
Q Consensus       322 d~~g~TpLh~A~~~~~~~~~~~l~-------------~~~l~~~~~~~~~~~v~~l~-~~~~~~~~n~~g~tpl~~a~~  386 (558)
                      |..|+||||+|+..|+.+++++|.             ..+++.+......+.|+.++ .|++++.+|.+|+||+++|.+
T Consensus       308 ~~~g~t~L~~A~~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~  386 (437)
T 1n11_A          308 TRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKR  386 (437)
T ss_dssp             CSSCCCHHHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHH
T ss_pred             CCCCCCHHHHHHHcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHH
Confidence            777777777777777776666551             12344444444445555555 778888888888888888764
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} SCOP: a.118.1.8 PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X Back     alignment and structure
>3k49_A MRNA-binding protein PUF3; PUF3, pumilio, RNA binding, mitochondrial mRNA,, membrane, mitochondrion; HET: CIT; 2.50A {Saccharomyces cerevisiae} SCOP: a.118.1.0 PDB: 3k4e_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 558
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.001
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: RNase L, 2-5a-dependent ribonuclease
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.2 bits (168), Expect = 1e-13
 Identities = 46/284 (16%), Positives = 88/284 (30%), Gaps = 27/284 (9%)

Query: 43  GETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASGNLDLVQLMTEDNEH 102
               L  A     +D V+ LL     V    +  G T L  A      D+V+L+      
Sbjct: 5   DNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMSREDIVELLLRHGAD 64

Query: 103 LALDRESVDQYLPIHAGAMSGHKEVVLYLYSITEGQLDNKDLIELLIILIKTDLYEVALR 162
             L +++      + A A S     +         + D       +   +   +  +   
Sbjct: 65  PVLRKKNGATPFLLAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFL 124

Query: 163 LFK--------DHPQLATLRDSNEETALHALAG-------KSMMSSYLANQNQQGMLQNF 207
             +           +          TAL   A        K ++    A+ N    +   
Sbjct: 125 YKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRN 184

Query: 208 FSSANVGSTKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNI 267
                + S+  S   A+    +               ++++   ER      +A EK ++
Sbjct: 185 ALIHALLSSDDSDVEAITHLLL------------DHGADVNVRGERGKTPLILAVEKKHL 232

Query: 268 EFLRVLIREYPYIISKHDDMGRTMFHIAVLNHQVKILELINEMG 311
             ++ L+ +    I+  D  G+T   +AV     KI EL+ + G
Sbjct: 233 GLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRG 276
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query558
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.98
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.78
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.8e-46  Score=378.15  Aligned_cols=340  Identities=19%  Similarity=0.192  Sum_probs=292.8

Q ss_pred             cHHHHHHHHcCCHHHHHHHHhhCchhhhhhcCCCCchHHHHHHHCCCHHHHHHHhcCCCcccccccCCCCcHhHHHHHcC
Q 046389            9 LSKLYRAALDDDWQTAETIFESHEDYVKASLSKLGETALHVAASAGRIDFVKNLLGYSPQVLKLTDYFGQTALSLAAASG   88 (558)
Q Consensus         9 ~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~TpLh~A~~~g   88 (558)
                      .||||.||..|+.++|++|++. |.+++.. |..|+||||+|+..|+.++|++|+++ |++++.+|.+|.||||+|+..|
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~-g~~in~~-d~~g~TpL~~A~~~g~~~iv~~Ll~~-gadi~~~~~~g~t~L~~A~~~g   77 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQR-GASPNVS-NVKVETPLHMAARAGHTEVAKYLLQN-KAKVNAKAKDDQTPLHCAARIG   77 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHT-TCCSCCS-SSCCCCHHHHHHHHTCHHHHHHHHHH-TCCSSCCCTTSCCHHHHHHHHT
T ss_pred             CChHHHHHHCcCHHHHHHHHHC-CCCCCCC-CCCCCCHHHHHHHcCCHHHHHHHHHC-cCCCCCCCCCCCCHHHHHHHcC
Confidence            4899999999999999998876 7788887 89999999999999999999999998 8999999999999999999999


Q ss_pred             CHHHHHHHHHcCccccc--------------------------------ccCCCCCccHHHHHHHcCChHHHHHHHhcCc
Q 046389           89 NLDLVQLMTEDNEHLAL--------------------------------DRESVDQYLPIHAGAMSGHKEVVLYLYSITE  136 (558)
Q Consensus        89 ~~eiv~~Ll~~~~~~~~--------------------------------~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~~~  136 (558)
                      +.+++++|++.+++...                                ..+ ..+.++++.|+..++.+++++|+++++
T Consensus        78 ~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~l~~a~~~~~~~~v~~ll~~~~  156 (408)
T d1n11a_          78 HTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMT-KKGFTPLHVAAKYGKVRVAELLLERDA  156 (408)
T ss_dssp             CHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCC-TTSCCHHHHHHHTTCHHHHHHHHHTTC
T ss_pred             CHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccc-cccchHHHHHHHcCCHHHHHHHHHcCC
Confidence            99999999987654311                                123 678899999999999999999999998


Q ss_pred             -cccCccchhHHHHHHHHhccHHHHHHHHhhCCcccccccCCCCcHHHHHhcCCCchhhhhhhcccchhhhhhccccccc
Q 046389          137 -GQLDNKDLIELLIILIKTDLYEVALRLFKDHPQLATLRDSNEETALHALAGKSMMSSYLANQNQQGMLQNFFSSANVGS  215 (558)
Q Consensus       137 -~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~d~~g~t~L~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  215 (558)
                       .+..+.++.+||+.|+..++.++++.|+++ +.+++..+..|.||+|.+......+........ .....    .....
T Consensus       157 ~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~-g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~-~~~~~----~~~~~  230 (408)
T d1n11a_         157 HPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQY-GGSAN----AESVQ  230 (408)
T ss_dssp             CTTCCCSSCCCHHHHHHHTTCHHHHHHHGGG-TCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHT-TCCTT----CCCTT
T ss_pred             CCCcCCCcCchHHHHHHHcCCHHHHHHHHhc-CCcccccCCCCCCcchhhhccchhhhhhhhhhc-ccccc----ccCCC
Confidence             667788999999999999999999999998 667788899999999999988876443222211 11111    11233


Q ss_pred             ccchhhhHHHHHHHHHHHHHHHHhhccchhhhhhhccCCchHHHHHHhcChHHHHHHHHHhCCcccccccCCCCcHHHHH
Q 046389          216 TKLSLSHAVLEQAITLVEIIWKEVIRSQDSEISTLIERPFQLTFVAAEKGNIEFLRVLIREYPYIISKHDDMGRTMFHIA  295 (558)
Q Consensus       216 ~~~~l~~a~~~~~~~~v~~l~~~~~~~~~~~~~~~~~~g~tpLh~Aa~~g~~~iv~~Ll~~~~~~~~~~d~~g~t~Lh~A  295 (558)
                      ..+++..|+..+..++++.+.+.+...+..     +..|.||++.|++.++.+++++|+++|+++ +..+..+.||||.|
T Consensus       231 ~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~-----~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~-~~~~~~~~t~L~~~  304 (408)
T d1n11a_         231 GVTPLHLAAQEGHAEMVALLLSKQANGNLG-----NKSGLTPLHLVAQEGHVPVADVLIKHGVMV-DATTRMGYTPLHVA  304 (408)
T ss_dssp             CCCHHHHHHHTTCHHHHHHHHTTTCCTTCC-----CTTCCCHHHHHHHHTCHHHHHHHHHHTCCT-TCCCSSCCCHHHHH
T ss_pred             CCCHHHHHHHhCcHhHhhhhhccccccccc-----cCCCCChhhhhhhcCcHHHHHHHHHCCCcc-ccccccccccchhh
Confidence            457788899999999999988776655543     467899999999999999999999999998 89999999999999


Q ss_pred             HHcCcHHHHHHHHhcCCcccceeeeccCCCCchhhHhhcCCCCCCCccccchHHHHHHHHHHHHHHHhhcCCcchhhccC
Q 046389          296 VLNHQVKILELINEMGSMKDRIVSRRDYGGNNILHMAGMQPSNEGPNVVFGAVLQLQQEVLWFKKVSEIVRPVDAEARNY  375 (558)
Q Consensus       296 ~~~~~~~iv~~Ll~~ga~~~~~in~~d~~g~TpLh~A~~~~~~~~~~~l~~~~l~~~~~~~~~~~v~~l~~~~~~~~~n~  375 (558)
                      +..++.++++++++.|++    +|.+|.+|+||||+|++.|+.+++++|                   +.+|++++.+|+
T Consensus       305 ~~~~~~~~~~~ll~~g~~----in~~d~~G~T~Lh~A~~~g~~~iv~~L-------------------l~~GAd~n~~d~  361 (408)
T d1n11a_         305 SHYGNIKLVKFLLQHQAD----VNAKTKLGYSPLHQAAQQGHTDIVTLL-------------------LKNGASPNEVSS  361 (408)
T ss_dssp             HHSSCSHHHHHHHHTTCC----TTCCCTTSCCHHHHHHHTTCHHHHHHH-------------------HHTTCCSCCCCS
T ss_pred             cccCcceeeeeecccccc----ccccCCCCCCHHHHHHHcCCHHHHHHH-------------------HHCCCCCCCCCC
Confidence            999999999999999999    789999999999999999997665554                   348999999999


Q ss_pred             CCCChhhhhHHh
Q 046389          376 GLQTPRELFTQS  387 (558)
Q Consensus       376 ~g~tpl~~a~~~  387 (558)
                      +|+||+|+|.+.
T Consensus       362 ~G~t~L~~A~~~  373 (408)
T d1n11a_         362 DGTTPLAIAKRL  373 (408)
T ss_dssp             SSCCHHHHHHHT
T ss_pred             CCCCHHHHHHHc
Confidence            999999999754
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure