Citrus Sinensis ID: 046418


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MALPLVLMKQLQPFPDTSEIYNPLSLSLLLLILLLTLVHLLKLSRSSNKLNLPPSPPRLPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASRCIFGRK
cccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEcccccEEEEccHHHHHHHHHHcccccccccccccHHHHccccccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHHccc
cccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHcccccHHHHHHHHHHHHccEEEEEccccEEEEEEcHHHHHHHHcccHHHHEEEccccHHHEEEEccccEEEccccHHHHHHHHHHHHHHHcHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccc
MALPLVLMkqlqpfpdtseiynPLSLSLLLLILLLTLVHLLKlsrssnklnlppspprlpiiGNLHQILQNVPHRSLKAlsdrygpimlvyfgnspslVVSSAELASEMMKThdiafsnrprsIATKILlydgkdlgfaEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIAsrcifgrk
MALPLVLMKQLQPFPDTSEIYNPLSLSLLLLILLLTLVHLLKLSRSSNKLNLPPSPPRLPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKThdiafsnrprsIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSnkrvksaqhirveEVSCLINKIRRSCINVHGRSTINLSEMILAVSnniasrcifgrk
MALPLVLMKQLQPFPDTSEIYNPlslsllllillltlvhllklsrssnklnlppspprlpIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASRCIFGRK
*****VLMKQLQPFPDTSEIYNPLSLSLLLLILLLTLVHLLKLS**************LPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELA**MMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASRCIF***
********KQLQPFPDTSEIYNPLSLSLLLLILLLTLVH******************RLPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIR***********INLSEMILAVSNNIASRCIFGRK
MALPLVLMKQLQPFPDTSEIYNPLSLSLLLLILLLTLVHLLKLSRSSNKLNLPPSPPRLPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASRCIFGRK
*ALPLVLMKQLQPFPDTSEIYNPLSLSLLLLILLLTLVHLLKLSRSSNKLNLPPSPPRLPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASRCIFGRK
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALPLVLMKQLQPFPDTSEIYNPLSLSLLLLILLLTLVHLLKLSRSSNKLNLPPSPPRLPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASRCIFGRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query215 2.2.26 [Sep-21-2011]
Q9STL2 490 Cytochrome P450 71A21 OS= yes no 0.827 0.363 0.497 1e-45
Q9STK9 488 Cytochrome P450 71A24 OS= no no 0.790 0.348 0.494 7e-44
Q9SAB6 497 Cytochrome P450 71A18 OS= no no 0.772 0.334 0.494 1e-43
O49342 497 Indoleacetaldoxime dehydr no no 0.767 0.331 0.502 1e-43
C0SJS4 476 Psoralen synthase (Fragme N/A no 0.823 0.371 0.483 1e-43
P37118 505 Cytochrome P450 71A2 OS=S N/A no 0.855 0.364 0.468 4e-43
Q9T0K2 497 Cytochrome P450 71A20 OS= no no 0.795 0.344 0.477 1e-42
Q9STK8 490 Cytochrome P450 71A25 OS= no no 0.846 0.371 0.453 1e-42
Q9STK7 489 Cytochrome P450 71A26 OS= no no 0.767 0.337 0.502 2e-42
Q9T0K0 490 Cytochrome P450 71A19 OS= no no 0.781 0.342 0.470 3e-42
>sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 Back     alignment and function desciption
 Score =  182 bits (462), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/185 (49%), Positives = 132/185 (71%), Gaps = 7/185 (3%)

Query: 31  LILLLTLVHLLKLSRSSNKLNLPPSPPRLPIIGNLHQILQNVPHRSLKALSDRYGPIMLV 90
           LI+ +T++   K  R   K N P SPPRLP+IGNLHQ L + PHRSL +LS RYGP+ML+
Sbjct: 12  LIIFITILFFKKQKRG-KKSNTPRSPPRLPLIGNLHQ-LGHHPHRSLCSLSHRYGPLMLL 69

Query: 91  YFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLRK 150
           + G  P LVVSSA++A +++KTHD  F++RPRS   + L YDG+D+ FA YGEYWRQ++ 
Sbjct: 70  HLGRVPVLVVSSADVARDILKTHDRVFASRPRSKLFEKLFYDGRDVAFAPYGEYWRQIKS 129

Query: 151 ICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASRC 210
           +CVL LLSNK V S +++R EE+S ++ KI++S         +N+SE++ +++N++ SR 
Sbjct: 130 VCVLRLLSNKMVTSFRNVRQEEISLMMEKIQKSS-----SLQVNVSELLGSLTNDVISRI 184

Query: 211 IFGRK 215
             GRK
Sbjct: 185 ALGRK 189





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 Back     alignment and function description
>sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 Back     alignment and function description
>sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 Back     alignment and function description
>sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 Back     alignment and function description
>sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 Back     alignment and function description
>sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 Back     alignment and function description
>sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 Back     alignment and function description
>sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
356516619 519 PREDICTED: cytochrome P450 71A1-like [Gl 0.897 0.371 0.540 1e-53
224139378 486 cytochrome P450 [Populus trichocarpa] gi 0.772 0.341 0.564 5e-52
449469731 507 PREDICTED: cytochrome P450 71A1-like [Cu 0.865 0.366 0.517 8e-52
224139376 486 cytochrome P450 [Populus trichocarpa] gi 0.772 0.341 0.552 1e-51
224135973 494 predicted protein [Populus trichocarpa] 0.753 0.327 0.580 2e-51
356513646 478 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.865 0.389 0.561 3e-50
357461739 521 Cytochrome P450 [Medicago truncatula] gi 0.962 0.397 0.488 1e-49
255647657 517 unknown [Glycine max] 0.962 0.400 0.483 1e-49
449487831 479 PREDICTED: cytochrome P450 71A1-like, pa 0.739 0.331 0.548 8e-49
449532791205 PREDICTED: cytochrome P450 71A2-like [Cu 0.744 0.780 0.551 9e-49
>gi|356516619|ref|XP_003526991.1| PREDICTED: cytochrome P450 71A1-like [Glycine max] Back     alignment and taxonomy information
 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (71%), Gaps = 5/198 (2%)

Query: 21  YNPLSLSLLL-LILLLTLVHLLKLSRSSNKLNLPPSPPRLPIIGNLHQILQNVPHRSLKA 79
           Y P S   L      ++L+ +LKL+R  NK N PPSPP+LPIIGNLHQ L  +PHRS +A
Sbjct: 13  YEPSSTHYLTAFFCFVSLLLMLKLTRR-NKSNFPPSPPKLPIIGNLHQ-LGTLPHRSFQA 70

Query: 80  LSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFA 139
           LS +YGP+M++  G +P+LVVSSA++A E++KTHD+ FSNRP+  A KI LY+ KD+GFA
Sbjct: 71  LSRKYGPLMMLQLGQTPTLVVSSADVAREIIKTHDVVFSNRPQPTAAKIFLYNCKDVGFA 130

Query: 140 EYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINV--HGRSTINLSE 197
            YGE WRQ +K CV+ELLS ++V+S + IR E VS L+  +R +C       R  +NLSE
Sbjct: 131 PYGEEWRQTKKTCVVELLSQRKVRSFRSIREEVVSELVEAVREACGGSERENRPCVNLSE 190

Query: 198 MILAVSNNIASRCIFGRK 215
           M++A SNNI SRC+ GRK
Sbjct: 191 MLIAASNNIVSRCVIGRK 208




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224139378|ref|XP_002323083.1| cytochrome P450 [Populus trichocarpa] gi|222867713|gb|EEF04844.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449469731|ref|XP_004152572.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224139376|ref|XP_002323082.1| cytochrome P450 [Populus trichocarpa] gi|222867712|gb|EEF04843.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224135973|ref|XP_002322207.1| predicted protein [Populus trichocarpa] gi|222869203|gb|EEF06334.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513646|ref|XP_003525522.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71A1-like [Glycine max] Back     alignment and taxonomy information
>gi|357461739|ref|XP_003601151.1| Cytochrome P450 [Medicago truncatula] gi|355490199|gb|AES71402.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255647657|gb|ACU24290.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449487831|ref|XP_004157822.1| PREDICTED: cytochrome P450 71A1-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449532791|ref|XP_004173362.1| PREDICTED: cytochrome P450 71A2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
TAIR|locus:504955642 490 CYP71A21 ""cytochrome P450, fa 0.693 0.304 0.503 4.9e-37
TAIR|locus:504955639 489 CYP71A26 ""cytochrome P450, fa 0.693 0.304 0.503 1.3e-36
TAIR|locus:2142075 497 CYP71A20 ""cytochrome P450, fa 0.706 0.305 0.467 1.2e-35
TAIR|locus:504955640 490 CYP71A22 ""cytochrome P450, fa 0.693 0.304 0.470 6.5e-35
TAIR|locus:504955637 490 CYP71A25 ""cytochrome P450, fa 0.693 0.304 0.470 2.2e-34
TAIR|locus:2142055 490 CYP71A19 ""cytochrome P450, fa 0.711 0.312 0.445 2.2e-34
TAIR|locus:2149373 496 CYP71A15 ""cytochrome P450, fa 0.702 0.304 0.438 4.6e-34
TAIR|locus:2149383 497 CYP71A14 ""cytochrome P450, fa 0.702 0.303 0.425 4.6e-34
TAIR|locus:504955634 483 CYP71A23 ""cytochrome P450, fa 0.693 0.308 0.464 1.2e-33
UNIPROTKB|Q6QNI4 494 CYP71AJ1 "Psoralen synthase" [ 0.679 0.295 0.487 8.5e-33
TAIR|locus:504955642 CYP71A21 ""cytochrome P450, family 71, subfamily A, polypeptide 21"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 398 (145.2 bits), Expect = 4.9e-37, P = 4.9e-37
 Identities = 78/155 (50%), Positives = 114/155 (73%)

Query:    61 IIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNR 120
             +IGNLHQ L + PHRSL +LS RYGP+ML++ G  P LVVSSA++A +++KTHD  F++R
Sbjct:    41 LIGNLHQ-LGHHPHRSLCSLSHRYGPLMLLHLGRVPVLVVSSADVARDILKTHDRVFASR 99

Query:   121 PRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKI 180
             PRS   + L YDG+D+ FA YGEYWRQ++ +CVL LLSNK V S +++R EE+S ++ KI
Sbjct:   100 PRSKLFEKLFYDGRDVAFAPYGEYWRQIKSVCVLRLLSNKMVTSFRNVRQEEISLMMEKI 159

Query:   181 RRSCINVHGRSTINLSEMILAVSNNIASRCIFGRK 215
             ++S         +N+SE++ +++N++ SR   GRK
Sbjct:   160 QKS-----SSLQVNVSELLGSLTNDVISRIALGRK 189




GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:504955639 CYP71A26 ""cytochrome P450, family 71, subfamily A, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142075 CYP71A20 ""cytochrome P450, family 71, subfamily A, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955637 CYP71A25 ""cytochrome P450, family 71, subfamily A, polypeptide 25"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142055 CYP71A19 ""cytochrome P450, family 71, subfamily A, polypeptide 19"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149373 CYP71A15 ""cytochrome P450, family 71, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149383 CYP71A14 ""cytochrome P450, family 71, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955634 CYP71A23 ""cytochrome P450, family 71, subfamily A, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6QNI4 CYP71AJ1 "Psoralen synthase" [Ammi majus (taxid:48026)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
CYP71AN3
cytochrome P450 (486 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-41
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 6e-41
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-38
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 7e-38
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 1e-29
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-29
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 4e-28
pfam00067 461 pfam00067, p450, Cytochrome P450 2e-24
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 6e-18
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 6e-16
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-15
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 4e-14
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-13
PLN02196 463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-06
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
 Score =  145 bits (368), Expect = 4e-41
 Identities = 70/209 (33%), Positives = 108/209 (51%), Gaps = 19/209 (9%)

Query: 7   LMKQLQPFPDTSEIYNPLSLSLLLLILLLTLVHLLKLSRSSNKLNLPPSPPRLPIIGNLH 66
            ++ L   P               LIL+   + L  +SR   +L  PP P  LPIIGN+ 
Sbjct: 4   PLQSLLTSPSF------------FLILISLFLFLGLISRLRRRLPYPPGPKGLPIIGNML 51

Query: 67  QILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIAT 126
            + Q + HR L  L+ +YG +  +  G    + VSS E+A ++++  D  FSNRP +IA 
Sbjct: 52  MMDQ-LTHRGLANLAKQYGGLFHMRMGYLHMVAVSSPEVARQVLQVQDSVFSNRPANIAI 110

Query: 127 KILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCIN 186
             L YD  D+ FA YG +WRQ+RK+CV++L S KR +S   +R +EV  ++  +  +   
Sbjct: 111 SYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWASVR-DEVDSMVRSVSSN--- 166

Query: 187 VHGRSTINLSEMILAVSNNIASRCIFGRK 215
                 +N+ E+I  ++ NI  R  FG  
Sbjct: 167 --IGKPVNIGELIFTLTRNITYRAAFGSS 193


Length = 516

>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 215
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.97
PLN02687 517 flavonoid 3'-monooxygenase 99.97
PLN03112 514 cytochrome P450 family protein; Provisional 99.96
PLN03234 499 cytochrome P450 83B1; Provisional 99.96
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.96
PTZ00404 482 cytochrome P450; Provisional 99.96
PLN02971 543 tryptophan N-hydroxylase 99.96
PLN02394 503 trans-cinnamate 4-monooxygenase 99.95
PLN02966 502 cytochrome P450 83A1 99.95
PLN02183 516 ferulate 5-hydroxylase 99.95
PLN00168 519 Cytochrome P450; Provisional 99.94
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.94
PLN02290 516 cytokinin trans-hydroxylase 99.94
PLN02196 463 abscisic acid 8'-hydroxylase 99.94
PLN02500 490 cytochrome P450 90B1 99.93
PLN02655 466 ent-kaurene oxidase 99.93
PLN02774 463 brassinosteroid-6-oxidase 99.92
PLN03018 534 homomethionine N-hydroxylase 99.92
PLN02302 490 ent-kaurenoic acid oxidase 99.91
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.91
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.9
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.9
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.9
PLN02738 633 carotene beta-ring hydroxylase 99.89
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.89
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.89
PLN02936 489 epsilon-ring hydroxylase 99.89
PLN02648 480 allene oxide synthase 99.86
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.81
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.77
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.67
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.34
cd0878090 Death_TRADD Death Domain of Tumor Necrosis Factor 82.8
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.97  E-value=7.6e-30  Score=204.76  Aligned_cols=161  Identities=43%  Similarity=0.800  Sum_probs=146.4

Q ss_pred             CCCCCCCCCCccccchhhhcCCC-hhHHHHHHHhhhCCeEEEEecCcCeEEeccHHHHHHHHHhcCcccCCCCc-hhhHH
Q 046418           50 LNLPPSPPRLPIIGNLHQILQNV-PHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPR-SIATK  127 (215)
Q Consensus        50 ~~~~p~p~~~p~~g~~~~~~~~~-~~~~~~~~~~~yG~v~~~~~~~~~~v~i~~p~~i~~il~~~~~~~~~~~~-~~~~~  127 (215)
                      .+.||||+++|++||++++ ... .+..+.++.++|||++.+++|..++|+++|++.++|++.+++..|.+|+. .....
T Consensus        25 ~~lPPGP~~lPiIGnl~~l-~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   25 RNLPPGPPPLPIIGNLHQL-GSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCcCCCCCCccccHHHc-CCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            6889999999999999999 554 99999999999999999999999999999999999999999999999997 33546


Q ss_pred             HhhhCCCceeeecCChhHHHHHHHHHhhccChhHHhHhHHHHHHHHHHHHHHHHHhccccCCCCcccHHHHHHHHHHHHH
Q 046418          128 ILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIA  207 (215)
Q Consensus       128 ~~~~~~~~~~~~~~g~~w~~~Rk~~~~~~f~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vdl~~~~~~~~~~vi  207 (215)
                      .+..++.+++++.+|+.||.+||......++...++...+...++++++++++.+ .   ..++++|+.+.+..++.++|
T Consensus       104 ~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~-~---~~~~~vdl~~~l~~~~~nvI  179 (489)
T KOG0156|consen  104 YLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSK-S---KKGEPVDLSELLDLLVGNVI  179 (489)
T ss_pred             HhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh-c---CCCceeeHHHHHHHHHHHHH
Confidence            6666789999998899999999999999999999999988889999999999987 2   23378999999999999999


Q ss_pred             HHHhhcCC
Q 046418          208 SRCIFGRK  215 (215)
Q Consensus       208 ~~~~fG~~  215 (215)
                      ++++||++
T Consensus       180 ~~~~fG~r  187 (489)
T KOG0156|consen  180 CRMLFGRR  187 (489)
T ss_pred             HHHHhCCc
Confidence            99999985



>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd08780 Death_TRADD Death Domain of Tumor Necrosis Factor Receptor 1-Associated Death Domain protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 7e-10
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 7e-10
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 7e-10
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 7e-10
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 7e-10
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 4e-08
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 5e-08
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-07
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 6e-07
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 7e-07
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 7e-07
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-06
2f9q_A 479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 5e-06
3qm4_A 479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 5e-06
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 6e-06
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 6e-06
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 6e-06
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 7e-06
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 7e-06
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 7e-06
3pm0_A 507 Structural Characterization Of The Complex Between 8e-06
3ibd_A 476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 9e-06
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 5e-05
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 6e-04
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure

Iteration: 1

Score = 60.5 bits (145), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 42/156 (26%), Positives = 79/156 (50%), Gaps = 8/156 (5%) Query: 61 IIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNR 120 ++GNL Q+ + RS L ++YG + VY G+ P +V+ + E + AFS R Sbjct: 20 VLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGR 79 Query: 121 PRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRV-EEVSCLINK 179 + IA ++ G + FA GE WR LR+ + + K + R+ EE CL+ + Sbjct: 80 GK-IAVVDPIFQGYGVIFAN-GERWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEE 137 Query: 180 IRRSCINVHGRSTINLSEMILAVSNNIASRCIFGRK 215 +R+S + ++ + + ++++NI +FG++ Sbjct: 138 LRKS-----KGALLDNTLLFHSITSNIICSIVFGKR 168
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-51
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-45
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-42
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-40
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 4e-37
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 8e-34
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-33
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-32
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 9e-30
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-29
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-29
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 7e-29
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 8e-29
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-28
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-28
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 6e-27
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-23
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-22
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-20
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-16
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 1e-15
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-15
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-15
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 1e-14
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-09
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-06
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 8e-05
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  170 bits (434), Expect = 5e-51
 Identities = 29/177 (16%), Positives = 58/177 (32%), Gaps = 5/177 (2%)

Query: 44  SRSSNKLNLPPSPPRLPIIGNLHQILQ---NVPHRSLKALSDRYGPIMLVYFGNSPSLVV 100
           +RS    N  PSP     +   H   +   +  H        +YGPI     GN  S+ V
Sbjct: 2   TRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYV 61

Query: 101 SSAELASEMMKTHDIAFSNRP-RSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSN 159
              E  + + K+                   Y        +    W++ R     E+++ 
Sbjct: 62  IDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAP 121

Query: 160 KRVKSAQHIRVEEVSCLINKIRRSCI-NVHGRSTINLSEMILAVSNNIASRCIFGRK 215
           +  K+   +        ++ + R       G  + ++S+ +   +    +  IFG +
Sbjct: 122 EATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGER 178


>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.95
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.95
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.94
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.94
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.94
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.94
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.93
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.93
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.93
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.93
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.93
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.92
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.92
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.92
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.92
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.92
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.91
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.91
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.9
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.89
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.89
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.88
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.87
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.86
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.85
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.83
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.83
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.83
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.82
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.82
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.81
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.79
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.78
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.78
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.77
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.77
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.75
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.75
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.75
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.74
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.74
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.73
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.72
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.72
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.71
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.71
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.7
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.7
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.7
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.69
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.69
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.69
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.69
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.68
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.67
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.67
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.66
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.65
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.65
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.63
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.62
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.62
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.61
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.6
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.6
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.6
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.59
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.57
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.55
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.54
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.5
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.49
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.48
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.38
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.35
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.14
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.35
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.95  E-value=3.2e-28  Score=197.02  Aligned_cols=156  Identities=20%  Similarity=0.332  Sum_probs=135.2

Q ss_pred             CCCCCCCCCccccchhhhcCCChhHHHHHHHhhhCCeEEEEecCcCeEEeccHHHHHHHHHhc-CcccCCCCchhhHHHh
Q 046418           51 NLPPSPPRLPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTH-DIAFSNRPRSIATKIL  129 (215)
Q Consensus        51 ~~~p~p~~~p~~g~~~~~~~~~~~~~~~~~~~~yG~v~~~~~~~~~~v~i~~p~~i~~il~~~-~~~~~~~~~~~~~~~~  129 (215)
                      +.+|||+++|++||++.+ ..+++.++.+++++|||++++++++.+.|+++||+++++++.++ ...|.+++....... 
T Consensus        14 ~~~PGP~~~PliGn~~~~-~~~~~~~~~~~~~~yG~i~~~~~g~~~~vvv~dp~~i~~il~~~~~~~f~~r~~~~~~~~-   91 (485)
T 3nxu_A           14 LGIPGPTPLPFLGNILSY-HKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGF-   91 (485)
T ss_dssp             HTCCCCCCBTTTBTGGGG-GGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCCCCCCSCCGG-
T ss_pred             CCCCCCCCcCeecCcHHh-hcChHHHHHHHHHHcCCeEEEEeCCCCEEEECCHHHHHHHHhccchhhccCCcccccccc-
Confidence            569999999999999998 77899999999999999999999999999999999999999876 566766654332221 


Q ss_pred             hhCCCceeeecCChhHHHHHHHHHhhccChhHHhHhHHHHHHHHHHHHHHHHHhccccCCCCcccHHHHHHHHHHHHHHH
Q 046418          130 LYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASR  209 (215)
Q Consensus       130 ~~~~~~~~~~~~g~~w~~~Rk~~~~~~f~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vdl~~~~~~~~~~vi~~  209 (215)
                      .  +.++++.+ |+.|+++||++ +++|+.++++.+.+.+.++++++++.+.+..   ++++++|+.+++..+++|+++.
T Consensus        92 ~--~~~l~~~~-g~~w~~~R~~~-~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~---~~g~~~d~~~~~~~~~~dvi~~  164 (485)
T 3nxu_A           92 M--KSAISIAE-DEEWKRLRSLL-SPTFTSGKLKEMVPIIAQYGDVLVRNLRREA---ETGKPVTLKDVFGAYSMDVITS  164 (485)
T ss_dssp             G--GGSTTTCC-HHHHHHHHHHH-GGGGCHHHHHHHHHHHHHHHHHHHHHHHHHH---HHTCCEEHHHHHHHHHHHHHHH
T ss_pred             c--ccCccccC-CcHHHHHHhhc-ChhcCHHHHHHHHHHHHHHHHHHHHHHHHHh---ccCCcCcHHHHHHHHHHHHHHH
Confidence            1  45565555 99999999999 8999999999999999999999999997653   3567899999999999999999


Q ss_pred             HhhcCC
Q 046418          210 CIFGRK  215 (215)
Q Consensus       210 ~~fG~~  215 (215)
                      ++||.+
T Consensus       165 ~~fG~~  170 (485)
T 3nxu_A          165 TSFGVN  170 (485)
T ss_dssp             HHHSCC
T ss_pred             HHcCCc
Confidence            999974



>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 215
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 4e-35
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-33
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 9e-33
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 8e-29
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 8e-26
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-25
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-19
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-15
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 3e-14
d1z8oa1 402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 7e-04
d1gwia_ 403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 0.003
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  127 bits (318), Expect = 4e-35
 Identities = 46/165 (27%), Positives = 78/165 (47%), Gaps = 8/165 (4%)

Query: 52  LPPSPPRLPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMK 111
           LPP P  LP+IGN+ QI      +SL  LS  YGP+  +YFG  P +V+   E   E + 
Sbjct: 4   LPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALI 63

Query: 112 THDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLRKICVLELLSNKRVKSAQHIRV- 170
                FS R      +     G  + F+  G+ W+++R+  ++ L +    K +   RV 
Sbjct: 64  DLGEEFSGRGIFPLAERANR-GFGIVFS-NGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQ 121

Query: 171 EEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASRCIFGRK 215
           EE  CL+ ++R++       S  + + ++     N+    IF ++
Sbjct: 122 EEARCLVEELRKTK-----ASPCDPTFILGCAPCNVICSIIFHKR 161


>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.95
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.94
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.91
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.9
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.89
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.88
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.84
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.81
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.73
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.61
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.6
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.58
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.57
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.48
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.37
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.33
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.28
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.24
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.19
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.04
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.81
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]
Probab=99.95  E-value=2e-27  Score=188.89  Aligned_cols=158  Identities=18%  Similarity=0.221  Sum_probs=136.2

Q ss_pred             CCCCCCCCCccccchhhhcCCChhHHHHHHHhhhCCeEEEEecCcCeEEeccHHHHHHHHHhcCcccCCCCchhhHHHhh
Q 046418           51 NLPPSPPRLPIIGNLHQILQNVPHRSLKALSDRYGPIMLVYFGNSPSLVVSSAELASEMMKTHDIAFSNRPRSIATKILL  130 (215)
Q Consensus        51 ~~~p~p~~~p~~g~~~~~~~~~~~~~~~~~~~~yG~v~~~~~~~~~~v~i~~p~~i~~il~~~~~~~~~~~~~~~~~~~~  130 (215)
                      +.+|||+++|++||++.+...+++.++.+++++|||||++++++.++|+++||+++++++.++...+..+..........
T Consensus         1 r~iPGP~~~p~lG~l~~l~~~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~~~   80 (453)
T d2ij2a1           1 KEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFA   80 (453)
T ss_dssp             CCCCCCCCCGGGTTGGGGCSSCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHHHH
T ss_pred             CCCccCCCcchhhCHHHhCCCCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHHhc
Confidence            45899999999999998866788999999999999999999999999999999999999976666555544433334443


Q ss_pred             hCCCceeee-cCChhHHHHHHHHHhhccChhHHhHhHHHHHHHHHHHHHHHHHhccccCCCCcccHHHHHHHHHHHHHHH
Q 046418          131 YDGKDLGFA-EYGEYWRQLRKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINVHGRSTINLSEMILAVSNNIASR  209 (215)
Q Consensus       131 ~~~~~~~~~-~~g~~w~~~Rk~~~~~~f~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vdl~~~~~~~~~~vi~~  209 (215)
                        |++++.+ .+|++|+++|+++ .+.|++++++.+.+.+.++++++++.|.+.    ++++.+|+.+++..+++|+++.
T Consensus        81 --g~~~~~~~~~g~~wk~~Rk~l-~~~fs~~~l~~~~~~i~~~~~~li~~l~~~----~~~~~idl~~~~~~~~~~~i~~  153 (453)
T d2ij2a1          81 --GDGLFTSWTHEKNWKKAHNIL-LPSFSQQAMKGYHAMMVDIAVQLVQKWERL----NADEHIEVPEDMTRLTLDTIGL  153 (453)
T ss_dssp             --TTSGGGSCTTSHHHHHHHHHH-GGGGSTTTHHHHHHHHHHHHHHHHHHHHTC----CTTCCEEHHHHHHHHHHHHHHH
T ss_pred             --CCcEEecCCChHHHHHHHHHH-HHHhhhhhhhhhhhhHHHHHHHHHHHhhhc----CCCCccchHHHHHHHhhhcchh
Confidence              6666543 4699999999999 899999999999999999999999999875    3677899999999999999999


Q ss_pred             HhhcCC
Q 046418          210 CIFGRK  215 (215)
Q Consensus       210 ~~fG~~  215 (215)
                      ++||.+
T Consensus       154 ~~fG~~  159 (453)
T d2ij2a1         154 CGFNYR  159 (453)
T ss_dssp             HHHSCC
T ss_pred             cccccc
Confidence            999964



>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure