Citrus Sinensis ID: 046577

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------88
MGSEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALRGKSLHEWKNSLRELRTPSMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNSIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVARSIACRDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALECPQLEFLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESMLPAGFLARKLERQVSQEESTTTYCSSEITLDTSTLLFNEKVALPNLEALEISEINVDKIWHYNQIPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISENRADQVIPYFVFPQLTTLRLQDLPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFAADLLQKNENDQLGIPVQQPPLPLEKILPNLTELSLSGKDAKMILQADFPQHLFGSLKRLVIAEDDSAGFPIWNVLERFHNLEILTLFNFSFHEEVFSMEGCLEKHVGKLATIKELELYRHYHLKQLCKQDSKLGPIFQYLEILKVYHCQSLLILLPSSSVSFGNLTKLVASGCKELMHLVTSSTAKTLVRLVSLGVYGCRAMTEVVINDKDGVEKEEIVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQELGVICCPKMKIFTTGESITPPGVYVWYGETADQRCWANNDLNATIQQLHAEK
ccccccEEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccHHHHHHccccccccHHHHHHHHHccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEcHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEEEEEEccccccccccccccccEEEEccccccccccccccHHHccccccEEEEccccccccccHHHHccccccEEEccccccccccHHHHHHHHHcccccccccccccccHHHcccccccEEcccccccccccccccccccccccEEEccccccccEEEcccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEccccccEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHHHHHHccccccccccccccccccccccccccEEEcccccccccccccccccccccccEEEEEccccccccHHHHHHccccccEEEEccccccccccccccHHHHcccccccccEEEEccccccccccccccccccccccccEEEEEcccccEEEccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEEccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccEEEEEcccccccccccccccHHHHHHHHcc
cccccccEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccHHEEEcccccccHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEHHHHHHHHHHHHccccEEEEEccccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccccHHHHHcccccEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccccHHcccccccEEEEEcccccccccccccccccccHHHHcccHHHHccccccccHHHHHHHHHHHHHHHHHcHHccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEcccccccEcccHccccccccccccccccEEEEcccHHHHHcccccccccccccEEEEEcccccHHccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccccHccEEEEcccccccccccHHccccccccEEEEccccccccccccccccHHHHcccHcHHcccccccccHccccccccccccccccccEEEEcccccHHccccccccccccccEEEEccccccccccccccccccHcccEEEEcccccHHHccccccccccccccccccccEEEEccccccccccccccccccccccEEEEcccccccccccccccccccEEEEEcccccccccccccccHHHHHHHccc
MGSEDNFLINNLNEEEAGRLFKmmagddvenrELKSTAIDVARACGGLPIALTTVAKALRGKSLHEWKNSLRelrtpsmvnfegvsaeTYSSIELSFKYLKGGQLKELFQLCSlmgnsiptlKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSClllegdsnkliSMHDVVRDVARSIacrdqhvfvvenedvwelpdkeslkkCYAISIRYCCihelpnalecpqleflcmspedsslevsipenffvGMRKLKVvdftgmqlfslpSSIDLLVKLKTLcldesilrDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLtklrlldltdcfhlkviapNVISSLIRLEELYMCNCSIEWEVERAnskrsnasLDELMHLRWLTTLEIdvknesmlpaGFLARKLERqvsqeestttycsseitldtstllfnekvalpnlealeiseinvdkiwhynqipaavfphfqSLTRLIVWRCHKLKYIFSASMIGslkqlqhldirDCKDLQEIIsenradqvipyfvfpqlttlrlqdlpklrclypgmhtpEWLALEMLFVYRCDKLKIFAADLLQknendqlgipvqqpplplekilpnltelslsgkDAKMILQADFPQHLFGSLKRLViaeddsagfpiWNVLERFHNLEILTLFNFSFHEEVFSMEGCLEKHVGKLATIKELELYRHYHLKQLckqdsklgpiFQYLEILKVYHCQSllillpsssvsfgNLTKLVASGCKELMHLVTSSTAKTLVRLVSLGVYGCRAMTEVvindkdgvekEEIVFRKLKtlelcdldsltsfcsanytfefpslqelgviccpkmkifttgesitppgvyvwygetadqrcwaNNDLNATIQQLHAEK
MGSEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALRGKSLHEWknslrelrtpsmvnfEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNSIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVARSIAcrdqhvfvvenedvwelpdkesLKKCYAISIRYCCIHELPNALECPQLEFLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESMLPAGFLARKLErqvsqeestttycsseitlDTSTLLFNEKVALPNLEALEISEINVDKIWHYNQIPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISenradqvipyFVFPQLTTLRLQDLPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFAADLLQKNENDQLGIPVQQPPLPLEKILPNLTELSLSGKDAKMILQADFPQHLFGSLKRLVIAEDDSAGFPIWNVLERFHNLEILTLFNFSFHEEVFSMEGCLEKHVGKLATIKELELYRHYHLKQLCKQDSKLGPIFQYLEILKVYHCQSLLILLPSSSVSFGNLTKLVASGCKELMHLVTSSTAKTLVRLVSLGVYGCRAMTevvindkdgvekEEIVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQELGVICCPKMKIFTTGESITPPGVYVWYGETADQRCWANNDLNATIQQLHAEK
MGSEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALRGKSLHEWKNSLRELRTPSMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNSIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVARSIACRDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALECPQLEFLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESMLPAGFLARKLERQVSQEESTTTYCSSEITLDTSTLLFNEKVALPNLEALEISEINVDKIWHYNQIPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISENRADQVIPYFVFPQLTTLRLQDLPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFAADLLQKNENDQLGIPVQQPPLPLEKILPNLTELSLSGKDAKMILQADFPQHLFGSLKRLVIAEDDSAGFPIWNVLERFHNLEILTLFNFSFHEEVFSMEGCLEKHVGKLATIKELELYRHYHLKQLCKQDSKLGPIFQYLEILKVYHCQsllillpsssvsFGNLTKLVASGCKELMHLVTSSTAKTLVRLVSLGVYGCRAMTEVVINDKDGVEKEEIVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQELGVICCPKMKIFTTGESITPPGVYVWYGETADQRCWANNDLNATIQQLHAEK
*******************LFK**********ELKSTAIDVARACGGLPIALTTVAKALRGKSLHEWKNSLRELRTPSMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNSIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVARSIACRDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALECPQLEFLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERA*******SLDELMHLRWLTTLEIDVKNESMLPAGFLARKL**********TTYCSSEITLDTSTLLFNEKVALPNLEALEISEINVDKIWHYNQIPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISENRADQVIPYFVFPQLTTLRLQDLPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFAADLLQKNENDQLGIPVQ***LPLEKILPNLTELSLSGKDAKMILQADFPQHLFGSLKRLVIAEDDSAGFPIWNVLERFHNLEILTLFNFSFHEEVFSMEGCLEKHVGKLATIKELELYRHYHLKQLCKQDSKLGPIFQYLEILKVYHCQSLLILLPSSSVSFGNLTKLVASGCKELMHLVTSSTAKTLVRLVSLGVYGCRAMTEVVINDKDGVEKEEIVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQELGVICCPKMKIFTTGESITPPGVYVWYGETADQRCWANNDLNATI*******
**SEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALRGKSLHEWKNSLRELRTPS**N**GVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNSIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVARSIACRDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALECPQLEFLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESMLPAGFLARKLERQVSQEESTTTYCSSEITLDTSTLLFNEKVALPNLEALEISEINVDKIWHYNQIPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISENRA******FVFPQLTTLRLQDLPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFAADLLQK**NDQLGIPVQQPPLPLEKILPNLTELSLSGKDAKMILQADFPQHLFGSLKRLVIAEDDSAGFPIWNVLERFHNLEILTLFNFSFHEEVFSMEGCLEKHVGKLATIKELELYRHYHLKQLCKQDSKLGPIFQYLEILKVYHCQSLLILLPSSSVSFGNLTKLVASGCKELMHLVTSSTAKTLVRLVSLGVYGCRAMTEVVI**********IVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQELGVICCPKMKIFTT**********VWYGETADQRCWANNDLNATIQQLHA**
MGSEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALRGKSLHEWKNSLRELRTPSMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNSIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVARSIACRDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALECPQLEFLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESMLPAGFLARKLE*************SSEITLDTSTLLFNEKVALPNLEALEISEINVDKIWHYNQIPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISENRADQVIPYFVFPQLTTLRLQDLPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFAADLLQKNENDQLGIPVQQPPLPLEKILPNLTELSLSGKDAKMILQADFPQHLFGSLKRLVIAEDDSAGFPIWNVLERFHNLEILTLFNFSFHEEVFSMEGCLEKHVGKLATIKELELYRHYHLKQLCKQDSKLGPIFQYLEILKVYHCQSLLILLPSSSVSFGNLTKLVASGCKELMHLVTSSTAKTLVRLVSLGVYGCRAMTEVVINDKDGVEKEEIVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQELGVICCPKMKIFTTGESITPPGVYVWYGETADQRCWANNDLNATIQQLHAEK
*****NFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALRGKSLHEWKNSLRELRTPSMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNSIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVARSIACRDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALECPQLEFLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESMLPAGFLARKLERQVSQEESTTTYCSSEITLDTSTLLFNEKVALPNLEALEISEINVDKIWHYNQIPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISENRADQVIPYFVFPQLTTLRLQDLPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFAADLLQKNENDQLGIPVQQPPLPLEKILPNLTELSLSGKDAKMILQADFPQHLFGSLKRLVIAEDDSAGFPIWNVLERFHNLEILTLFNFSFHEEVFSMEGCLEKHVGKLATIKELELYRHYHLKQLCKQDSKLGPIFQYLEILKVYHCQSLLILLPSSSVSFGNLTKLVASGCKELMHLVTSSTAKTLVRLVSLGVYGCRAMTEVVINDKDGVEKEEIVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQELGVICCPKMKIFTTGESITPPGVYVWYGETADQRCWANNDLNATIQQLHAEK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALRGKSLHEWKNSLRELRTPSMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNSIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVARSIACRDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALECPQLEFLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESMLPAGFLARKLERQVSQEESTTTYCSSEITLDTSTLLFNEKVALPNLEALEISEINVDKIWHYNQIPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISENRADQVIPYFVFPQLTTLRLQDLPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFAADLLQKNENDQLGIPVQQPPLPLEKILPNLTELSLSGKDAKMILQADFPQHLFGSLKRLVIAEDDSAGFPIWNVLERFHNLEILTLFNFSFHEEVFSMEGCLEKHVGKLATIKELELYRHYHLKQLCKQDSKLGPIFQYLEILKVYHCQSLLILLPSSSVSFGNLTKLVASGCKELMHLVTSSTAKTLVRLVSLGVYGCRAMTEVVINDKDGVEKEEIVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQELGVICCPKMKIFTTGESITPPGVYVWYGETADQRCWANNDLNATIQQLHAEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query878 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.439 0.420 0.297 1e-35
Q42484909 Disease resistance protei no no 0.603 0.583 0.264 4e-35
Q9T048985 Disease resistance protei no no 0.449 0.401 0.275 7e-33
Q9SH22884 Probable disease resistan no no 0.592 0.588 0.262 2e-27
O82484892 Putative disease resistan no no 0.578 0.569 0.279 3e-27
O64973889 Disease resistance protei no no 0.597 0.590 0.255 7e-27
Q9SI85893 Probable disease resistan no no 0.579 0.569 0.266 7e-26
Q8RXS5888 Probable disease resistan no no 0.567 0.560 0.269 5e-21
Q9LVT4843 Probable disease resistan no no 0.580 0.604 0.252 7e-21
Q9FG91848 Probable disease resistan no no 0.396 0.410 0.281 6e-20
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  152 bits (383), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 121/407 (29%), Positives = 200/407 (49%), Gaps = 21/407 (5%)

Query: 1   MGSEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALR 60
           M + +N  +  L E+EA  LF    G+   +  +K  A DV+  C GLP+A+ T+ + LR
Sbjct: 261 MMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLR 320

Query: 61  GKSLHE-WKNSLRELR--TPSMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGN 117
           GK   E WK++L  L+   PS+   E +    + +++LS+ +L+   +K  F  C+L   
Sbjct: 321 GKPQVEVWKHTLNLLKRSAPSIDTEEKI----FGTLKLSYDFLQD-NMKSCFLFCALFPE 375

Query: 118 --SIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVV 175
             SI   +L+ Y +  G+  G +  ED  N+   LV  L+DSCLL +GDS   + MHDVV
Sbjct: 376 DYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVV 435

Query: 176 RDVA---RSIACRDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALECPQLE 232
           RD A    S      H  V+    + E P  + +     +S+    +  LPN +    +E
Sbjct: 436 RDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNV-IEGVE 494

Query: 233 FLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDE-SIL 291
            L +  + +S    +P  F      L+++D +G+++ +LP S   L  L++L L     L
Sbjct: 495 TLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKL 554

Query: 292 RDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLI 351
           R  ++  +  L  L+ L    S   +LP+ L  L+ LR + +++ + L+ I    I  L 
Sbjct: 555 R--NLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLS 612

Query: 352 RLEELYMCNCSIEWEVERANSKRSNASLDE---LMHLRWLTTLEIDV 395
            LE L M   +  W + +   +   A+LDE   L HL++L    +DV
Sbjct: 613 SLEVLDMAGSAYSWGI-KGEEREGQATLDEVTCLPHLQFLAIKLLDV 658
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query878
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.956 0.626 0.359 1e-122
255574526 1232 Disease resistance protein RFL1, putativ 0.961 0.685 0.333 1e-110
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.862 0.575 0.338 1e-97
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.609 0.467 0.402 2e-96
255581680 1126 Disease resistance protein RPS2, putativ 0.908 0.708 0.339 1e-95
255563252 1603 Disease resistance protein RPS5, putativ 0.802 0.439 0.339 4e-95
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.856 0.561 0.341 3e-93
147777048 1460 hypothetical protein VITISV_009359 [Viti 0.925 0.556 0.327 9e-93
359487988 1297 PREDICTED: disease resistance protein RP 0.872 0.590 0.331 2e-91
356566878 2804 PREDICTED: uncharacterized protein LOC10 0.899 0.281 0.307 8e-91
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  446 bits (1148), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 362/1008 (35%), Positives = 508/1008 (50%), Gaps = 168/1008 (16%)

Query: 1    MGSEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALR 60
            M ++ +F + +L  +EA  LFK M GD +EN +L   A DVA+ C GLPIA+ TVAKAL+
Sbjct: 297  MSTQKDFGVEHLQGDEAWILFKNMVGDSIENPDLLLIATDVAKECTGLPIAIVTVAKALK 356

Query: 61   GKSLHEWKNSLRELRTPSMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNSIP 120
             K++  WK++L++L+T +  N  G+  + YS+++LS+K+L+G ++K LF LC L  N I 
Sbjct: 357  NKNVSIWKDALKQLKTQTSTNITGMGTKVYSTLKLSYKHLEGDEVKSLFLLCGLFSNYID 416

Query: 121  TLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVAR 180
               LLKY +GL +FQG N +E+A+N++  LV  L+ S LLLE   N +  MHDVV++VA 
Sbjct: 417  IRDLLKYGMGLRLFQGTNTLEEAKNRIETLVDNLKASNLLLETRYNAVFRMHDVVQNVAI 476

Query: 181  SIACRDQHVFVVENE-DVWELPDKESLKKCYAISIRYCCIHELPNALECPQLEFLCMSPE 239
             IA ++ HVF  +    + E P+ + L+K   I +  C I ELP  L             
Sbjct: 477  EIASKEHHVFTFQTGVRMEEWPNMDELQKFTMIYLDCCDIRELPEGLN-----------H 525

Query: 240  DSSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAII 299
            +SSL+  IP  FF GM++LKV+DFT M L SLPSS+  L  L+TLCLD   L   DI II
Sbjct: 526  NSSLK--IPNTFFEGMKQLKVLDFTNMHLPSLPSSLHCLANLRTLCLDACKLG--DITII 581

Query: 300  GKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMC 359
             +L+ LEILS + SD  QLP+ L QLT LRLLDL     LKVI P+VISSL +LE+L M 
Sbjct: 582  AELKKLEILSLMDSDIEQLPRELSQLTHLRLLDLKGSSKLKVIPPDVISSLSQLEDLCME 641

Query: 360  NCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESMLPAGFLARKLERQ---VSQ 416
            N   +WEVE     +SNA L EL HL +LTTL+I + +  + P   +   L +    V  
Sbjct: 642  NSYTQWEVE----GKSNAYLAELKHLSYLTTLDIQIPDAKLFPKDVVFDNLMKYRIFVGD 697

Query: 417  EESTTTYCSSEITL-----DTSTLLF---------NEKVALPNLEA-------------L 449
              S    C +  TL     DTS  L           E + L +L               L
Sbjct: 698  VWSWEENCETNKTLKLNEFDTSLHLVEGISKLLRXTEDLHLHDLRGTTNILSKLDRQCFL 757

Query: 450  EISEINVDKIWHYNQIPAAV--------FPHFQS--LTRLIVWR--CHKLKYIFSASMIG 497
            ++  +NV+       I  ++        FP  ++  L +LI  +  CH     F +   G
Sbjct: 758  KLKHLNVESSPEIRSIMNSMDLTPSHHAFPVMETLFLRQLINLQEVCHGQ---FPS---G 811

Query: 498  SLKQLQHLDIRDCKDLQ--------------------------EIISENR-----ADQVI 526
            S   L+ +++ DC  L+                          EI+ + R      D  +
Sbjct: 812  SFGFLRKVEVEDCDSLKFLFSLSMARGLSRLKEITMTRCKSMGEIVPQGRKEIKDGDDAV 871

Query: 527  PYFVFPQLTTLRLQDLPKL--RC--------------------------LYPGMHTPEWL 558
               +FP+L  L LQDLPKL   C                          ++ G  +  + 
Sbjct: 872  NVPLFPELRYLTLQDLPKLINFCFEENLMLSKPVSTIAGRSTSLFNQAEVWNGQLSLSFG 931

Query: 559  ALEMLFVYRC-DKLKIFAADLLQKNEN----------------DQLGIPVQQPPLPLEKI 601
             L  L +  C   LK+F + L Q  +N                D  G+ V    + L   
Sbjct: 932  NLRSLMMQNCMSLLKVFPSSLFQSLQNLEVLKVENCNQLEEIFDLEGLNVDGGHVGL--- 988

Query: 602  LPNLTELSLSG--------KDAKMIL---QADFPQHLFGSLKRLVIAE--DDSAGFPIWN 648
            LP L E+ L+G         D   I+   Q  FP   F  L+ L I E  D     P  +
Sbjct: 989  LPKLEEMCLTGCIPLEELILDGSRIIEIWQEQFPVESFCRLRVLSICEYRDILVVIPS-S 1047

Query: 649  VLERFHNLEILTLFNFSFHEEVFSMEGCL--EKHVGKLATIKELELYRHYHLKQLCKQDS 706
            +L+R H LE LT+ +    +EV  +EG +  E H   LA ++ELEL     LK L K++S
Sbjct: 1048 MLQRLHTLEKLTVRSCGSVKEVVQLEGLVDEENHFRALARLRELELNDLPELKYLWKENS 1107

Query: 707  KLGPIFQYLEILKVYHCQSLLILLPSSSVSFGNLTKLVASGCKELMHLVTSSTAKTLVRL 766
             +GP FQ LEILK++ C +L+ L+P SSVSF NL  L  S C  L++L+    AK+LV+ 
Sbjct: 1108 NVGPHFQNLEILKIWDCDNLMNLVP-SSVSFHNLASLDISYCCSLINLLPPLIAKSLVQH 1166

Query: 767  VSLGVYGCRAMTEVVINDKDGVEKEEIVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQE 826
                +     M EVV N+ +    +EI F KL+ +ELC L +LTSFCS  Y+  FP L+ 
Sbjct: 1167 KIFKIGRSDMMKEVVANEGENA-GDEITFCKLEEIELCVLPNLTSFCSGVYSLSFPVLER 1225

Query: 827  LGVICCPKMKIFTTGESITPPGVYVWYGETADQRCWANNDLNATIQQL 874
            + V  CPKMKIF+ G  +TP    V  G   +   W  +DLN TI  L
Sbjct: 1226 VVVEECPKMKIFSQGLLVTPRLDRVEVGNNKEH--W-KDDLNTTIHLL 1270

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581680|ref|XP_002531643.1| Disease resistance protein RPS2, putative [Ricinus communis] gi|223528728|gb|EEF30739.1| Disease resistance protein RPS2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147777048|emb|CAN65562.1| hypothetical protein VITISV_009359 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487988|ref|XP_002262896.2| PREDICTED: disease resistance protein RPS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356566878|ref|XP_003551653.1| PREDICTED: uncharacterized protein LOC100819614 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query878
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.440 0.392 0.278 2e-38
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.439 0.420 0.297 2.5e-35
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.369 0.356 0.296 2.9e-34
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.405 0.400 0.280 1.8e-24
TAIR|locus:2170892848 AT5G43730 [Arabidopsis thalian 0.396 0.410 0.276 3.7e-24
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.382 0.398 0.287 2.1e-23
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.400 0.394 0.285 4.3e-23
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.403 0.394 0.268 2e-22
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.370 0.365 0.291 2.2e-22
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.375 0.372 0.268 4.6e-22
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 400 (145.9 bits), Expect = 2.0e-38, Sum P(2) = 2.0e-38
 Identities = 112/402 (27%), Positives = 204/402 (50%)

Query:     9 INNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALRGK-SLHEW 67
             ++ L EE+A  LF   AGD V +  ++  A  V++ CGGLP+A+ TV  A+RGK ++  W
Sbjct:   299 VDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLW 358

Query:    68 KNSLRELRTPSMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGN--SIPTLKLL 125
              + L +L + S+   + +  + +  ++LS+ +L+  + K  F LC+L     SI   +++
Sbjct:   359 NHVLSKL-SKSVPWIKSIEEKIFQPLKLSYDFLED-KAKFCFLLCALFPEDYSIEVTEVV 416

Query:   126 KYSIGLGIFQGVNKMEDARNKLYALVHELRDSCLLLEGDSNKLISMHDVVRDVA---RSI 182
             +Y +  G  + +   ED+ N+    V  L+D CLL +GD    + MHDVVRD A    S 
Sbjct:   417 RYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSS 476

Query:   183 ACRDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALE--CPQLEFLCMSPED 240
             +  D H  V+    + ++   +       +S+    +  LP+ +E  C +   L +  + 
Sbjct:   477 SQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLL--QG 534

Query:   241 SSLEVSIPENFFVGMRKLKVVDFTGMQLFSLPS-SIDLLVKLKTLCLDESILRDIDIAII 299
             + L   +P  F      L++++ +G ++ S PS S+  L  L +L L +   + + +  +
Sbjct:   535 NFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCF-KLVKLPSL 593

Query:   300 GKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMC 359
               L  LE+L    +  ++ P+ L +L + R LDL+   HL+ I   V+S L  LE L M 
Sbjct:   594 ETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMT 653

Query:   360 NCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESML 401
             +    W V+   +++  A+++E+  L+ L  L I + +   L
Sbjct:   654 SSHYRWSVQ-GETQKGQATVEEIGCLQRLQVLSIRLHSSPFL 694
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query878
PLN032101153 PLN03210, PLN03210, Resistant to P 4e-11
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-06
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 66.8 bits (163), Expect = 4e-11
 Identities = 134/545 (24%), Positives = 221/545 (40%), Gaps = 104/545 (19%)

Query: 38  AIDVARACGGLPIALTTVAKALRGKSLHEWKNSLRELRTPSMVNFEGVSAETYSSIELSF 97
           A +VA   G LP+ L  +   LRG+   +W + L  LR        G+  +   ++ +S+
Sbjct: 378 ASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRN-------GLDGKIEKTLRVSY 430

Query: 98  KYLKGGQLKELFQ--LCSLMGNSIPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELR 155
             L   + K +F+   C   G  +  +KLL  +  L +  G+  + D      +L+H   
Sbjct: 431 DGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDK-----SLIHVRE 485

Query: 156 DSCLLLEGDSNKLISMHDVVRDVARSIACRDQ------HVFVVENEDVWE-LPDKESLKK 208
           D           ++ MH +++++ + I  R Q        F+V+ +D+ + L D    KK
Sbjct: 486 D-----------IVEMHSLLQEMGKEIV-RAQSNEPGEREFLVDAKDICDVLEDNTGTKK 533

Query: 209 CYAISIRYCCIHELPNALECPQLEFLCMSPEDSSLEVSIPENFFVGMRKLKVVDFTGMQL 268
              I++                         D   E+ I EN F GMR L  + F   + 
Sbjct: 534 VLGITLDI-----------------------DEIDELHIHENAFKGMRNLLFLKFYTKKW 570

Query: 269 -------FSLPSSIDLL-VKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPK 320
                  + LP   D L  KL+ L  D+  LR +      + ENL  L    S   +L  
Sbjct: 571 DQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNF--RPENLVKLQMQGSKLEKLWD 628

Query: 321 ALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERANSKRSNASLD 380
            +  LT LR +DL    +LK I P+ +S    LE L + +CS    VE  +S +    L+
Sbjct: 629 GVHSLTGLRNIDLRGSKNLKEI-PD-LSMATNLETLKLSDCSS--LVELPSSIQYLNKLE 684

Query: 381 ELMHLRWLTTLEIDVKNESMLPAGFLARKLER-------QVSQEESTTTYCSSEITLDTS 433
           +L  +     LEI       LP G   + L R       ++      +T  S     +T+
Sbjct: 685 DL-DMSRCENLEI-------LPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETA 736

Query: 434 TLLFNEKVALPNLEALEISEINVDKIWHYNQIPA---AVFPHFQSLTRLIVWRCHKLKYI 490
              F   + L NL+ L + E+  +K+W   Q       +     SLTRL +     L  +
Sbjct: 737 IEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSP--SLTRLFLSDIPSLVEL 794

Query: 491 FSASMIGSLKQLQHLDIRDCKDLQEIISENRADQVIPYFV-FPQLTTLRLQDLPKLRCLY 549
              S I +L +L+HL+I +C +L          + +P  +    L +L L    +LR  +
Sbjct: 795 --PSSIQNLHKLEHLEIENCINL----------ETLPTGINLESLESLDLSGCSRLRT-F 841

Query: 550 PGMHT 554
           P + T
Sbjct: 842 PDIST 846

syringae 6; Provisional. Length = 1153
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 878
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.76
KOG4237498 consensus Extracellular matrix protein slit, conta 99.68
KOG4237498 consensus Extracellular matrix protein slit, conta 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.55
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.5
KOG4341483 consensus F-box protein containing LRR [General fu 99.45
KOG4341483 consensus F-box protein containing LRR [General fu 99.3
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.26
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.26
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.79
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.77
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.75
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.72
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.5
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.47
PLN03150623 hypothetical protein; Provisional 98.45
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.44
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.41
PLN03150623 hypothetical protein; Provisional 98.4
PRK15386 426 type III secretion protein GogB; Provisional 98.39
PRK15386 426 type III secretion protein GogB; Provisional 98.29
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.29
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.17
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.04
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.98
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.91
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.82
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.78
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.78
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.75
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.66
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.58
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.51
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.89
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.03
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.95
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.73
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.51
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.5
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.39
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.24
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.22
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.06
PRK04841903 transcriptional regulator MalT; Provisional 94.23
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.2
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.56
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.33
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.73
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.65
smart0037026 LRR Leucine-rich repeats, outliers. 86.65
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.85
smart0037026 LRR Leucine-rich repeats, outliers. 83.44
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.44
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-57  Score=525.62  Aligned_cols=522  Identities=28%  Similarity=0.392  Sum_probs=363.1

Q ss_pred             CCCCccEEccCCChHHHHHHHHHhcCCC--CCChhhHHHHHHHHHHhCCChhHHHHHHHHhcCCCch-hHHHHHHHhcCC
Q 046577            1 MGSEDNFLINNLNEEEAGRLFKMMAGDD--VENRELKSTAIDVARACGGLPIALTTVAKALRGKSLH-EWKNSLRELRTP   77 (878)
Q Consensus         1 m~~~~~~~l~~L~~~~~~~Lf~~~a~~~--~~~~~~~~~~~~i~~~c~GlPLai~~lg~~L~~k~~~-~W~~~l~~l~~~   77 (878)
                      ||++..+++++|+++|||+||+++||+.  ...+.++++|++||++|+|+|||++|||+.|+.|.+. ||+++.+.+.+.
T Consensus       306 m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~  385 (889)
T KOG4658|consen  306 MGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSS  385 (889)
T ss_pred             ccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcccccc
Confidence            7889999999999999999999999643  3445599999999999999999999999999999876 599999998877


Q ss_pred             CCCCcCCchhhHHHHHHHHHhcCCCchhHHHHHHhccCCCC--CChhHHHHHHhhcccccCcchHHHHHHHHHHHHHHHH
Q 046577           78 SMVNFEGVSAETYSSIELSFKYLKGGQLKELFQLCSLMGNS--IPTLKLLKYSIGLGIFQGVNKMEDARNKLYALVHELR  155 (878)
Q Consensus        78 ~~~~~~~~~~~i~~~L~lSy~~L~~~~lk~cFly~~~fp~~--i~~~~li~~w~~~g~~~~~~~~e~~~~~~~~~l~~L~  155 (878)
                      ...+.++..+.|+++|++|||+||++ +|.||+|||+||||  |++++||.+|+||||+++.+..+.+.+.+++|+.+||
T Consensus       386 ~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV  464 (889)
T KOG4658|consen  386 LAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELV  464 (889)
T ss_pred             ccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHH
Confidence            55566666788999999999999965 99999999999996  6789999999999999873333333444455699999


Q ss_pred             hcccccccC---CCCcEEccHHHHHHHHHHhh-----cccceEEeeCCCCCCCCCccccccceEEEEeccccccCCCCCC
Q 046577          156 DSCLLLEGD---SNKLISMHDVVRDVARSIAC-----RDQHVFVVENEDVWELPDKESLKKCYAISIRYCCIHELPNALE  227 (878)
Q Consensus       156 ~r~l~~~~~---~~~~~~mHdl~~~l~~~~~~-----~e~~~~~~~~~~~~~~~~~~~~~~~~~L~l~~~~~~~l~~~~~  227 (878)
                      +++|++..+   ...+|+|||+|||||.++++     +|+.++.. +......++......+|++++.++.+..++....
T Consensus       465 ~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~-~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~  543 (889)
T KOG4658|consen  465 RASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSD-GVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSE  543 (889)
T ss_pred             HHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEEC-CcCccccccccchhheeEEEEeccchhhccCCCC
Confidence            999998654   34789999999999999999     66644422 2234446666667889999999999999999988


Q ss_pred             CCCccEEEcCCCCC-ccccCcChhhhhCCCCCcEEEeeCC-CCCCCccccccccCccEEEecCccccccchhhhcCCCCC
Q 046577          228 CPQLEFLCMSPEDS-SLEVSIPENFFVGMRKLKVVDFTGM-QLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENL  305 (878)
Q Consensus       228 ~~~Lr~L~l~~~~~-~~~~~l~~~~~~~l~~Lr~L~L~~~-~i~~lp~~~~~l~~L~~L~l~~~~~~~~~p~~i~~L~~L  305 (878)
                      +++|++|.+.+|.. ...  ++..+|..+++||+|||++| .+..+|+.++.|.|||||+++++.+.. +|..+++|+.|
T Consensus       544 ~~~L~tLll~~n~~~l~~--is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~-LP~~l~~Lk~L  620 (889)
T KOG4658|consen  544 NPKLRTLLLQRNSDWLLE--ISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISH-LPSGLGNLKKL  620 (889)
T ss_pred             CCccceEEEeecchhhhh--cCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccc-cchHHHHHHhh
Confidence            89999999999863 222  88888999999999999976 456888888888888888888888876 88888888888


Q ss_pred             CEEEcCCCC-CcccchhhcCCCCccEEecCCCCCCCccCcchhcCCccccEEEcccCcchhHHhhhcccCCCCChhhhcC
Q 046577          306 EILSFVRSD-TVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMCNCSIEWEVERANSKRSNASLDELMH  384 (878)
Q Consensus       306 ~~L~l~~~~-l~~lp~~i~~L~~L~~L~l~~~~~l~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~  384 (878)
                      .+||+..+. +..+|.....|.+||+|.+.... . ......++.+.+|++|..-.+....          ......+..
T Consensus       621 ~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~-~-~~~~~~l~el~~Le~L~~ls~~~~s----------~~~~e~l~~  688 (889)
T KOG4658|consen  621 IYLNLEVTGRLESIPGILLELQSLRVLRLPRSA-L-SNDKLLLKELENLEHLENLSITISS----------VLLLEDLLG  688 (889)
T ss_pred             heeccccccccccccchhhhcccccEEEeeccc-c-ccchhhHHhhhcccchhhheeecch----------hHhHhhhhh
Confidence            888887774 33444445557788877776543 1 1111113333333333222111110          001122222


Q ss_pred             CCCCcEEEEEecCCCcCCchhhhcccccccccccCcccccccccccccccccccccccCCCcceeeeccccceeecccCC
Q 046577          385 LRWLTTLEIDVKNESMLPAGFLARKLERQVSQEESTTTYCSSEITLDTSTLLFNEKVALPNLEALEISEINVDKIWHYNQ  464 (878)
Q Consensus       385 l~~L~~L~l~~~~~~~~~~~~~~~~L~~l~l~~~~l~~~~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~l~~~~~~~~  464 (878)
                      +..|+++...-.                  +..          .....   ....+..+.+|+.|.+.+|.+.++.....
T Consensus       689 ~~~L~~~~~~l~------------------~~~----------~~~~~---~~~~~~~l~~L~~L~i~~~~~~e~~~~~~  737 (889)
T KOG4658|consen  689 MTRLRSLLQSLS------------------IEG----------CSKRT---LISSLGSLGNLEELSILDCGISEIVIEWE  737 (889)
T ss_pred             hHHHHHHhHhhh------------------hcc----------cccce---eecccccccCcceEEEEcCCCchhhcccc
Confidence            222221111000                  000          00000   11112268889999999886543211111


Q ss_pred             CCCcccccccCccEEeeccccccccccchhhhcccCCcCEEEEeCCchhHHHhhcccCCCCC--CcccCccccee-cccc
Q 046577          465 IPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISENRADQVI--PYFVFPQLTTL-RLQD  541 (878)
Q Consensus       465 ~~~~~~~~l~~L~~L~L~~c~~l~~~~~~~~l~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~--~~~~~p~L~~L-~l~~  541 (878)
                      ........|+++.++.+.+|...+...+   ..-.|+|+.|.+..|..++++..........  ....|+++..+ .+.+
T Consensus       738 ~~~~~~~~f~~l~~~~~~~~~~~r~l~~---~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~  814 (889)
T KOG4658|consen  738 ESLIVLLCFPNLSKVSILNCHMLRDLTW---LLFAPHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEGLRMLCS  814 (889)
T ss_pred             cccchhhhHHHHHHHHhhccccccccch---hhccCcccEEEEecccccccCCCHHHHhhhcccEEecccccccceeeec
Confidence            1111010267888888888888877644   4456899999999998776654432221110  01246666666 4666


Q ss_pred             ccccccccCCCCcCCCCCccEEEEccCCCccchh
Q 046577          542 LPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFA  575 (878)
Q Consensus       542 c~~L~~~~~~~~~~~~~~L~~L~l~~C~~L~~lp  575 (878)
                      .+.+..+....  -.++.|+.+.+..||++..+|
T Consensus       815 l~~l~~i~~~~--l~~~~l~~~~ve~~p~l~~~P  846 (889)
T KOG4658|consen  815 LGGLPQLYWLP--LSFLKLEELIVEECPKLGKLP  846 (889)
T ss_pred             CCCCceeEecc--cCccchhheehhcCcccccCc
Confidence            56666554433  236779999999999987764

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query878
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-21
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 8e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score = 97.4 bits (242), Expect = 4e-21
 Identities = 23/195 (11%), Positives = 59/195 (30%), Gaps = 14/195 (7%)

Query: 1   MGSEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALR 60
             + +   + +L  +E     +          + +           G P  L    K+  
Sbjct: 282 SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCE 341

Query: 61  GKSLHEWKNSLRELRTPSMVNFEGVSAETYSSI----ELSFKYLKGGQLKELFQLCSLM- 115
            K+  +      +L +  +V  E ++  +Y S+    +   + L   + +       +M 
Sbjct: 342 PKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLS-DEDRSALAFAVVMP 400

Query: 116 -GNSIPTLKLLKYSIGLGIFQGVNKMED-ARNKLYALVHELRDSCLLLEGDSNKLIS--M 171
            G  IP                  +++D   ++L      L     LL G    +++  +
Sbjct: 401 PGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRL----KRLSKRGALLSGKRMPVLTFKI 456

Query: 172 HDVVRDVARSIACRD 186
             ++    + +    
Sbjct: 457 DHIIHMFLKHVVDAQ 471
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query878
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.85
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.64
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.63
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.63
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.62
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.61
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.6
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.59
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.58
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.57
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.56
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.55
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.53
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.53
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.53
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.53
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.4
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.39
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.34
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.33
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.3
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.09
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.05
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.0
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.94
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.84
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.8
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.69
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.38
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.29
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.06
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.91
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.82
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.59
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.31
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.28
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.24
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 93.85
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.51
2fna_A357 Conserved hypothetical protein; structural genomic 92.75
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 88.4
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-39  Score=390.17  Aligned_cols=567  Identities=14%  Similarity=0.048  Sum_probs=333.5

Q ss_pred             ccceEEEEeccccccCCCCC-CCCCccEEEcCCCCCccccCcCh-hhhhCCCCCcEEEeeCCCCC-CCcccc-ccccCcc
Q 046577          207 KKCYAISIRYCCIHELPNAL-ECPQLEFLCMSPEDSSLEVSIPE-NFFVGMRKLKVVDFTGMQLF-SLPSSI-DLLVKLK  282 (878)
Q Consensus       207 ~~~~~L~l~~~~~~~l~~~~-~~~~Lr~L~l~~~~~~~~~~l~~-~~~~~l~~Lr~L~L~~~~i~-~lp~~~-~~l~~L~  282 (878)
                      +.++.++++.+.+..++..+ .+++|++|++++|.....  +|. ..++++++|++|++++|.+. .+|..+ .++++|+
T Consensus        77 ~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~--~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~  154 (768)
T 3rgz_A           77 TGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGP--VTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLE  154 (768)
T ss_dssp             TTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEE--GGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCS
T ss_pred             CcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCc--CCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCC
Confidence            34455555555554454554 677777777777765433  554 12577777788887777766 344443 6777777


Q ss_pred             EEEecCccccccchhh---hcCCCCCCEEEcCCCCCcccchhhcCCCCccEEecCCCCCCCccCcchhcCCccccEEEcc
Q 046577          283 TLCLDESILRDIDIAI---IGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDLTDCFHLKVIAPNVISSLIRLEELYMC  359 (878)
Q Consensus       283 ~L~l~~~~~~~~~p~~---i~~L~~L~~L~l~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~~~~~~~~~l~~L~~L~l~  359 (878)
                      +|++++|.+.+..|..   ++++++|++|++++|.+..... ++++++|++|++++|. +....+. ++++++|++|+++
T Consensus       155 ~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~-~~~l~~L~~L~Ls~n~-l~~~~~~-l~~l~~L~~L~Ls  231 (768)
T 3rgz_A          155 VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD-VSRCVNLEFLDVSSNN-FSTGIPF-LGDCSALQHLDIS  231 (768)
T ss_dssp             EEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB-CTTCTTCCEEECCSSC-CCSCCCB-CTTCCSCCEEECC
T ss_pred             EEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC-cccCCcCCEEECcCCc-CCCCCcc-cccCCCCCEEECc
Confidence            7777777777755555   6777777777777776664332 3677777778777777 4443334 7777778888877


Q ss_pred             cCcchhHHhhhcccCCCCChhhhcCCCCCcEEEEEecCCCcCCchhhhcccccccccccCcccccccccccccccccccc
Q 046577          360 NCSIEWEVERANSKRSNASLDELMHLRWLTTLEIDVKNESMLPAGFLARKLERQVSQEESTTTYCSSEITLDTSTLLFNE  439 (878)
Q Consensus       360 ~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~l~l~~~~l~~~~~~~~~~~~~~~~l~~  439 (878)
                      +|.+.           +..+..++.+++|++|++++|..........+++|+.++++.+.+.......        +.. 
T Consensus       232 ~n~l~-----------~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~--------~~~-  291 (768)
T 3rgz_A          232 GNKLS-----------GDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDF--------LSG-  291 (768)
T ss_dssp             SSCCC-----------SCHHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCC--------SCT-
T ss_pred             CCcCC-----------CcccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHH--------HHh-
Confidence            77665           3345667777777777777776543222225566666666655544221110        001 


Q ss_pred             cccCCCcceeeeccccceeecccCCCCCcccccccCccEEeeccccccccccchhhhcccCCcCEEEEeCCchhHHHhhc
Q 046577          440 KVALPNLEALEISEINVDKIWHYNQIPAAVFPHFQSLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRDCKDLQEIISE  519 (878)
Q Consensus       440 ~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~l~~L~~L~L~~c~~l~~~~~~~~l~~l~~L~~L~l~~~~~l~~~~~~  519 (878)
                        .+++|++|++++|.++...     |.+ +..+++|++|++++| .+....|...++.+++|++|++++|.....++..
T Consensus       292 --~~~~L~~L~Ls~n~l~~~~-----p~~-~~~l~~L~~L~L~~n-~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~  362 (768)
T 3rgz_A          292 --ACDTLTGLDLSGNHFYGAV-----PPF-FGSCSLLESLALSSN-NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES  362 (768)
T ss_dssp             --TCTTCSEEECCSSEEEECC-----CGG-GGGCTTCCEEECCSS-EEEEECCHHHHTTCTTCCEEECCSSEEEECCCTT
T ss_pred             --hcCcCCEEECcCCcCCCcc-----chH-HhcCCCccEEECCCC-cccCcCCHHHHhcCCCCCEEeCcCCccCccccHH
Confidence              2366667777666555321     111 124566666666663 3332234344566666666666666521122221


Q ss_pred             ccCCCCCCcccCc-ccceeccccccccccccCCCCcCCCCCccEEEEccCCCccchhh--hhhccccCCCCCCCCCC-CC
Q 046577          520 NRADQVIPYFVFP-QLTTLRLQDLPKLRCLYPGMHTPEWLALEMLFVYRCDKLKIFAA--DLLQKNENDQLGIPVQQ-PP  595 (878)
Q Consensus       520 ~~~~~~~~~~~~p-~L~~L~l~~c~~L~~~~~~~~~~~~~~L~~L~l~~C~~L~~lp~--~~~~~~~~~~~~~~~~~-~~  595 (878)
                      ..        .++ +|++|+++++.--..++.......+++|++|++++|.--..+|.  ..++.++.+........ .+
T Consensus       363 l~--------~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~  434 (768)
T 3rgz_A          363 LT--------NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI  434 (768)
T ss_dssp             HH--------HHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCC
T ss_pred             HH--------hhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcc
Confidence            11        122 55555555532111111111111134455555554422112221  01111111111110000 00


Q ss_pred             CCccccCCCcceEEeccCCccccccccCccccccCCcEEEEecCCCC-ccchhHHHHHcCCCceEEEeccCccceeeccc
Q 046577          596 LPLEKILPNLTELSLSGKDAKMILQADFPQHLFGSLKRLVIAEDDSA-GFPIWNVLERFHNLEILTLFNFSFHEEVFSME  674 (878)
Q Consensus       596 ~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~-~~~~~~~l~~l~~L~~L~l~~c~~l~~l~~~~  674 (878)
                      ......+++|+.|++++|......+..+.  .+++|++|++++|.+. .+|.+  +.++++|+.|++++|.-...+    
T Consensus       435 p~~l~~l~~L~~L~L~~n~l~~~~p~~~~--~l~~L~~L~L~~N~l~~~~p~~--l~~l~~L~~L~L~~N~l~~~~----  506 (768)
T 3rgz_A          435 PSSLGSLSKLRDLKLWLNMLEGEIPQELM--YVKTLETLILDFNDLTGEIPSG--LSNCTNLNWISLSNNRLTGEI----  506 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCCSCCCGGGG--GCTTCCEEECCSSCCCSCCCGG--GGGCTTCCEEECCSSCCCSCC----
T ss_pred             cHHHhcCCCCCEEECCCCcccCcCCHHHc--CCCCceEEEecCCcccCcCCHH--HhcCCCCCEEEccCCccCCcC----
Confidence            12235678888888888886655544432  3688889988665555 66665  888889999999877543333    


Q ss_pred             cccccccccccccceeecccccccccccccCCCCCCcccceeeEEeecccccccc-------------------------
Q 046577          675 GCLEKHVGKLATIKELELYRHYHLKQLCKQDSKLGPIFQYLEILKVYHCQSLLIL-------------------------  729 (878)
Q Consensus       675 ~~~~~~~~~~~~L~~L~l~~c~~L~~l~~~~~~~~~~~~~L~~L~l~~c~~l~~l-------------------------  729 (878)
                         |..++.+++|+.|++++|.-...++..    ...+++|+.|++++|+....+                         
T Consensus       507 ---p~~~~~l~~L~~L~L~~N~l~~~~p~~----l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~  579 (768)
T 3rgz_A          507 ---PKWIGRLENLAILKLSNNSFSGNIPAE----LGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIK  579 (768)
T ss_dssp             ---CGGGGGCTTCCEEECCSSCCEEECCGG----GGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEE
T ss_pred             ---ChHHhcCCCCCEEECCCCcccCcCCHH----HcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccc
Confidence               455668889999999888654455432    256788999999886433222                         


Q ss_pred             --------------------------------------------cCCCcccccCccEEEecCCCCcccccchhHHhhccc
Q 046577          730 --------------------------------------------LPSSSVSFGNLTKLVASGCKELMHLVTSSTAKTLVR  765 (878)
Q Consensus       730 --------------------------------------------~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~l~~  765 (878)
                                                                  .|..+..+++|+.|+++++.-...+  |..+.++++
T Consensus       580 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~i--p~~l~~l~~  657 (768)
T 3rgz_A          580 NDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYI--PKEIGSMPY  657 (768)
T ss_dssp             CCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCC--CGGGGGCTT
T ss_pred             cccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccC--CHHHhcccc
Confidence                                                        1112344677888998877433344  456788899


Q ss_pred             ccEEEEcccccccceecccccccccceeeeccccceecccCCCcceeeccCceeecCCcceeecccCCCccccCCCC
Q 046577          766 LVSLGVYGCRAMTEVVINDKDGVEKEEIVFRKLKTLELCDLDSLTSFCSANYTFEFPSLQELGVICCPKMKIFTTGE  842 (878)
Q Consensus       766 L~~L~i~~c~~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~c~~L~~l~~~~~~~~l~~L~~L~i~~C~~l~~lp~~~  842 (878)
                      |+.|++++|.-...+|.....        +++|+.|+++++.--..+|...  ..+++|++|++++|+--..+|.++
T Consensus       658 L~~L~Ls~N~l~g~ip~~l~~--------L~~L~~LdLs~N~l~g~ip~~l--~~l~~L~~L~ls~N~l~g~iP~~~  724 (768)
T 3rgz_A          658 LFILNLGHNDISGSIPDEVGD--------LRGLNILDLSSNKLDGRIPQAM--SALTMLTEIDLSNNNLSGPIPEMG  724 (768)
T ss_dssp             CCEEECCSSCCCSCCCGGGGG--------CTTCCEEECCSSCCEECCCGGG--GGCCCCSEEECCSSEEEEECCSSS
T ss_pred             CCEEeCcCCccCCCCChHHhC--------CCCCCEEECCCCcccCcCChHH--hCCCCCCEEECcCCcccccCCCch
Confidence            999999998544466665554        8899999999876555666543  268899999999986555566543
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 878
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 4e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 56.4 bits (135), Expect = 4e-09
 Identities = 11/90 (12%), Positives = 28/90 (31%)

Query: 1   MGSEDNFLINNLNEEEAGRLFKMMAGDDVENRELKSTAIDVARACGGLPIALTTVAKALR 60
             + +   + +L  +E     +          + +           G P  L    K+  
Sbjct: 174 SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCE 233

Query: 61  GKSLHEWKNSLRELRTPSMVNFEGVSAETY 90
            K+  +      +L +  +V  E ++  +Y
Sbjct: 234 PKTFEKMAQLNNKLESRGLVGVECITPYSY 263
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query878
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.63
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.54
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.53
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.45
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.26
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.15
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.87
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.83
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.78
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.81
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.56
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.97
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.26
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.64
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.84  E-value=1.3e-19  Score=196.44  Aligned_cols=102  Identities=18%  Similarity=0.284  Sum_probs=65.9

Q ss_pred             CCCCCcEEEeeCCCCCCCccccccccCccEEEecCccccccchhhhcCCCCCCEEEcCCCCCcccchhhcCCCCccEEec
Q 046577          254 GMRKLKVVDFTGMQLFSLPSSIDLLVKLKTLCLDESILRDIDIAIIGKLENLEILSFVRSDTVQLPKALGQLTKLRLLDL  333 (878)
Q Consensus       254 ~l~~Lr~L~L~~~~i~~lp~~~~~l~~L~~L~l~~~~~~~~~p~~i~~L~~L~~L~l~~~~l~~lp~~i~~L~~L~~L~l  333 (878)
                      .+.+|++|++++++|+.+. .++.+++|++|++++|.+++ +|. ++++++|++|++++|.+..++. ++++++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~~-l~~-l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLTD-ITP-LKNLTKLVDILMNNNQIADITP-LANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCCC-CGG-GTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCCCcc-ccccCCCCCEEeCcCCcCCC-Ccc-ccCCcccccccccccccccccc-cccccccccccc
Confidence            3556777777777777663 46677777777777777776 443 7777777777777777766653 677777777777


Q ss_pred             CCCCCCCccCcchhcCCccccEEEcccCc
Q 046577          334 TDCFHLKVIAPNVISSLIRLEELYMCNCS  362 (878)
Q Consensus       334 ~~~~~l~~~~~~~~~~l~~L~~L~l~~~~  362 (878)
                      .++. +..++.  ......+..+....+.
T Consensus       118 ~~~~-~~~~~~--~~~~~~~~~~~~~~~~  143 (384)
T d2omza2         118 FNNQ-ITDIDP--LKNLTNLNRLELSSNT  143 (384)
T ss_dssp             CSSC-CCCCGG--GTTCTTCSEEEEEEEE
T ss_pred             cccc-cccccc--cccccccccccccccc
Confidence            7665 555444  3444555555544443
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure