Citrus Sinensis ID: 046612

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW
cccccccccccccccccHHHHHHHHHHccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccHHHHHHHHHHHHHHccc
HccccccccccccHHHHHHHHHHHHHHccccEEEEEccHHHHcccccHHHcccHHHHHHHHHHHHHHHHcccEEEEEEEccccEHHHHHHHcHHHcccHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHcccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHccEEEEEEEccEEEEccccHHHHHHHHHHHHHHcHH
kifdrstgdiasGFYHHYKEDIKLMKKVgldsfrfsiswtrilpkgkisggvnplgVKFYKDLINELLandikpfvtllhfdppqaleeeyggflspkiVKDFVDygdfcfktyGDRVKLWasmnepngmvmngynggsfapgrcsnyvgnctagdsatepYIAAHNMLLSHGALVNLykhkyqpyqmgkigitilthwfepkfkTAASRQAASRARDFFFGW
kifdrstgdiasgfyHHYKEDIKLMKKVGLDSFRFSISwtrilpkgkisggvnpLGVKFYKDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW
KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKTaasrqaasrarDFFFGW
********DIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKT*****************
KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW
KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFK*********RARDFFFGW
*****STGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query223 2.2.26 [Sep-21-2011]
A2SY66 509 Vicianin hydrolase (Fragm N/A no 0.991 0.434 0.654 3e-85
O64882 517 Beta-glucosidase 17 OS=Ar yes no 1.0 0.431 0.623 1e-83
Q7XKV4 510 Beta-glucosidase 12 OS=Or yes no 1.0 0.437 0.584 8e-76
Q75W17 538 Furcatin hydrolase OS=Vib N/A no 0.982 0.407 0.591 2e-74
A3C053 494 Beta-glucosidase 29 OS=Or yes no 1.0 0.451 0.558 2e-73
Q7XKV2 506 Beta-glucosidase 13 OS=Or no no 1.0 0.440 0.558 2e-73
Q84YK7 499 Beta-glucosidase 27 OS=Or no no 1.0 0.446 0.544 3e-71
P26205 425 Cyanogenic beta-glucosida N/A no 1.0 0.524 0.589 7e-71
A3RF67 547 Isoflavonoid 7-O-beta-api N/A no 1.0 0.407 0.562 3e-70
Q0J0N4 500 Beta-glucosidase 30 OS=Or no no 1.0 0.446 0.535 3e-70
>sp|A2SY66|VICHY_VICSN Vicianin hydrolase (Fragment) OS=Vicia sativa subsp. nigra PE=1 SV=1 Back     alignment and function desciption
 Score =  314 bits (805), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 177/223 (79%), Gaps = 2/223 (0%)

Query: 1   KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFY 60
           KI+D S+G+I + FYH YK DIK++K++GLDS+RFSISW+RI PKGK  G VNPLGVKFY
Sbjct: 81  KIWDHSSGNIGADFYHRYKSDIKIVKEIGLDSYRFSISWSRIFPKGK--GEVNPLGVKFY 138

Query: 61  KDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKL 120
            ++INE+LAN + PFVTL H+D PQ+LE+EY GFLS K+VKDF +Y DF FKTYGDRVK 
Sbjct: 139 NNVINEILANGLIPFVTLFHWDLPQSLEDEYKGFLSSKVVKDFENYADFVFKTYGDRVKH 198

Query: 121 WASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYK 180
           W ++NEP    + GYNGG+FAPGRCS Y GNC  GDS+TEPYI AHN++LSH A   LYK
Sbjct: 199 WVTLNEPFSYALYGYNGGTFAPGRCSKYAGNCEYGDSSTEPYIVAHNLILSHAAAAKLYK 258

Query: 181 HKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW 223
            KYQ +Q G IG T++TH+FEP   +AA R AASRA DFFFGW
Sbjct: 259 TKYQAHQKGNIGATLVTHYFEPHSNSAADRVAASRALDFFFGW 301
Hydrolyzes the disaccharide glycosides vicianin, pNP beta-primeveroside, 2-phenylethyl beta-primeveroside and furcatin.
Vicia sativa subsp. nigra (taxid: 3909)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 1EC: 9
>sp|O64882|BGL17_ARATH Beta-glucosidase 17 OS=Arabidopsis thaliana GN=BGLU17 PE=2 SV=1 Back     alignment and function description
>sp|Q7XKV4|BGL12_ORYSJ Beta-glucosidase 12 OS=Oryza sativa subsp. japonica GN=BGLU12 PE=2 SV=2 Back     alignment and function description
>sp|Q75W17|FURH_VIBFR Furcatin hydrolase OS=Viburnum furcatum PE=1 SV=1 Back     alignment and function description
>sp|A3C053|BGL29_ORYSJ Beta-glucosidase 29 OS=Oryza sativa subsp. japonica GN=BGLU29 PE=2 SV=2 Back     alignment and function description
>sp|Q7XKV2|BGL13_ORYSJ Beta-glucosidase 13 OS=Oryza sativa subsp. japonica GN=BGLU13 PE=2 SV=2 Back     alignment and function description
>sp|Q84YK7|BGL27_ORYSJ Beta-glucosidase 27 OS=Oryza sativa subsp. japonica GN=BGLU27 PE=2 SV=1 Back     alignment and function description
>sp|P26205|BGLT_TRIRP Cyanogenic beta-glucosidase (Fragment) OS=Trifolium repens GN=LI PE=1 SV=1 Back     alignment and function description
>sp|A3RF67|BAGBG_DALNI Isoflavonoid 7-O-beta-apiosyl-glucoside beta-glycosidase OS=Dalbergia nigrescens PE=1 SV=1 Back     alignment and function description
>sp|Q0J0N4|BGL30_ORYSJ Beta-glucosidase 30 OS=Oryza sativa subsp. japonica GN=BGLU30 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
224121010 506 predicted protein [Populus trichocarpa] 1.0 0.440 0.704 2e-92
255542157 454 beta-glucosidase, putative [Ricinus comm 1.0 0.491 0.678 2e-89
255542161 391 beta-glucosidase, putative [Ricinus comm 1.0 0.570 0.687 4e-89
449436255 517 PREDICTED: vicianin hydrolase-like [Cucu 1.0 0.431 0.721 9e-87
449489088 517 PREDICTED: LOW QUALITY PROTEIN: vicianin 1.0 0.431 0.721 2e-86
356557126 510 PREDICTED: vicianin hydrolase-like [Glyc 0.991 0.433 0.668 2e-85
356557124 510 PREDICTED: LOW QUALITY PROTEIN: vicianin 0.991 0.433 0.668 2e-85
224121022 510 predicted protein [Populus trichocarpa] 1.0 0.437 0.669 4e-85
224121026 510 predicted protein [Populus trichocarpa] 1.0 0.437 0.669 6e-85
308191598 509 RecName: Full=Vicianin hydrolase; Short= 0.991 0.434 0.654 2e-83
>gi|224121010|ref|XP_002330881.1| predicted protein [Populus trichocarpa] gi|222872703|gb|EEF09834.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 184/223 (82%)

Query: 1   KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFY 60
           KI+DRS GD+AS FYH +K+DIKLMK+VGLD+FR S SW+RILPKGK+S GVNPLGVKFY
Sbjct: 76  KIWDRSNGDVASDFYHKFKDDIKLMKRVGLDTFRLSFSWSRILPKGKVSRGVNPLGVKFY 135

Query: 61  KDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKL 120
            ++INELL N IKP VTLLH+DPPQ+L +EYGGFLS KIV DF +Y DFCFKT+GDRVK 
Sbjct: 136 NNVINELLHNGIKPLVTLLHYDPPQSLYDEYGGFLSSKIVDDFAEYADFCFKTFGDRVKY 195

Query: 121 WASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYK 180
           W +MNEPNG+ +NGY  GSFAPGRCS  +GNC  G+SA EPY+AAHNM+LSHGA V +YK
Sbjct: 196 WITMNEPNGLAINGYTFGSFAPGRCSKTLGNCPGGNSAVEPYVAAHNMILSHGAAVKVYK 255

Query: 181 HKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW 223
            KYQ  Q G+IG+TI++HWF PKF T A R A SRA DF FGW
Sbjct: 256 DKYQAIQKGQIGMTIVSHWFVPKFNTTADRIAVSRALDFMFGW 298

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255542157|ref|XP_002512142.1| beta-glucosidase, putative [Ricinus communis] gi|223548686|gb|EEF50176.1| beta-glucosidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255542161|ref|XP_002512144.1| beta-glucosidase, putative [Ricinus communis] gi|223548688|gb|EEF50178.1| beta-glucosidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449436255|ref|XP_004135908.1| PREDICTED: vicianin hydrolase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449489088|ref|XP_004158211.1| PREDICTED: LOW QUALITY PROTEIN: vicianin hydrolase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356557126|ref|XP_003546869.1| PREDICTED: vicianin hydrolase-like [Glycine max] Back     alignment and taxonomy information
>gi|356557124|ref|XP_003546868.1| PREDICTED: LOW QUALITY PROTEIN: vicianin hydrolase-like [Glycine max] Back     alignment and taxonomy information
>gi|224121022|ref|XP_002330884.1| predicted protein [Populus trichocarpa] gi|222872706|gb|EEF09837.1| predicted protein [Populus trichocarpa] gi|429326396|gb|AFZ78538.1| beta-glucosidase [Populus tomentosa] Back     alignment and taxonomy information
>gi|224121026|ref|XP_002330885.1| predicted protein [Populus trichocarpa] gi|222872707|gb|EEF09838.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|308191598|sp|A2SY66.1|VICHY_VICAN RecName: Full=Vicianin hydrolase; Short=VH; Flags: Precursor gi|86553273|gb|ABD03937.1| vicianin hydrolase, partial [Vicia sativa subsp. nigra] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
UNIPROTKB|A2SY66 509 A2SY66 "Vicianin hydrolase" [V 0.991 0.434 0.618 4.3e-77
TAIR|locus:2050512 517 BGLU17 "beta glucosidase 17" [ 1.0 0.431 0.596 7.3e-75
UNIPROTKB|Q7XKV4 510 BGLU12 "Beta-glucosidase 12" [ 1.0 0.437 0.566 2.6e-70
TAIR|locus:2157632 507 BGLU12 "beta glucosidase 12" [ 1.0 0.439 0.495 1.9e-60
TAIR|locus:2050605 506 BGLU15 "beta glucosidase 15" [ 0.905 0.399 0.532 2.4e-60
UNIPROTKB|Q8GU20 532 SGR1 "Strictosidine-O-beta-D-g 0.982 0.411 0.524 5e-60
TAIR|locus:2152160 507 BGLU13 "beta glucosidase 13" [ 1.0 0.439 0.486 8.1e-60
TAIR|locus:2101427 577 DIN2 "DARK INDUCIBLE 2" [Arabi 0.869 0.336 0.564 1e-59
TAIR|locus:2101417 514 BGLU16 "beta glucosidase 16" [ 0.905 0.392 0.532 1.3e-59
TAIR|locus:2050306 489 BGLU14 "beta glucosidase 14" [ 1.0 0.456 0.482 2.7e-59
UNIPROTKB|A2SY66 A2SY66 "Vicianin hydrolase" [Vicia sativa subsp. nigra (taxid:3909)] Back     alignment and assigned GO terms
 Score = 776 (278.2 bits), Expect = 4.3e-77, P = 4.3e-77
 Identities = 138/223 (61%), Positives = 169/223 (75%)

Query:     1 KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFY 60
             KI+D S+G+I + FYH YK DIK++K++GLDS+RFSISW+RI PKGK  G VNPLGVKFY
Sbjct:    81 KIWDHSSGNIGADFYHRYKSDIKIVKEIGLDSYRFSISWSRIFPKGK--GEVNPLGVKFY 138

Query:    61 KDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKL 120
              ++INE+LAN + PFVTL H+D PQ+LE+EY GFLS K+VKDF +Y DF FKTYGDRVK 
Sbjct:   139 NNVINEILANGLIPFVTLFHWDLPQSLEDEYKGFLSSKVVKDFENYADFVFKTYGDRVKH 198

Query:   121 WASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYK 180
             W ++NEP    + GYNGG+FAPGRCS Y GNC  GDS+TEPYI AHN++LSH A   LYK
Sbjct:   199 WVTLNEPFSYALYGYNGGTFAPGRCSKYAGNCEYGDSSTEPYIVAHNLILSHAAAAKLYK 258

Query:   181 HKYQPYQMGKIGITILTHWFEPKFKTXXXXXXXXXXXDFFFGW 223
              KYQ +Q G IG T++TH+FEP   +           DFFFGW
Sbjct:   259 TKYQAHQKGNIGATLVTHYFEPHSNSAADRVAASRALDFFFGW 301
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IDA
GO:0016052 "carbohydrate catabolic process" evidence=IDA
TAIR|locus:2050512 BGLU17 "beta glucosidase 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XKV4 BGLU12 "Beta-glucosidase 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2157632 BGLU12 "beta glucosidase 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050605 BGLU15 "beta glucosidase 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GU20 SGR1 "Strictosidine-O-beta-D-glucosidase" [Rauvolfia serpentina (taxid:4060)] Back     alignment and assigned GO terms
TAIR|locus:2152160 BGLU13 "beta glucosidase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101427 DIN2 "DARK INDUCIBLE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101417 BGLU16 "beta glucosidase 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050306 BGLU14 "beta glucosidase 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_1480006
hypothetical protein (506 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
pfam00232 454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 3e-82
PLN02849 503 PLN02849, PLN02849, beta-glucosidase 1e-77
PLN02814 504 PLN02814, PLN02814, beta-glucosidase 2e-75
PLN02998 497 PLN02998, PLN02998, beta-glucosidase 8e-71
COG2723 460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 8e-71
TIGR03356 426 TIGR03356, BGL, beta-galactosidase 5e-67
PRK13511 469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 1e-50
TIGR01233 467 TIGR01233, lacG, 6-phospho-beta-galactosidase 5e-37
PRK09852 474 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosi 3e-33
PRK09589 476 PRK09589, celA, 6-phospho-beta-glucosidase; Review 2e-32
PRK15014 477 PRK15014, PRK15014, 6-phospho-beta-glucosidase Bgl 8e-29
PRK09593 478 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewe 9e-25
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information 
 Score =  251 bits (644), Expect = 3e-82
 Identities = 100/224 (44%), Positives = 129/224 (57%), Gaps = 18/224 (8%)

Query: 1   KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFY 60
           K+F    GD+A   YH YKED+ LMK++G+ ++RFSISW RI PKG   G +N  G+ +Y
Sbjct: 43  KVFGGHNGDVACDSYHRYKEDVALMKELGVTAYRFSISWPRIFPKG--EGEINEAGLDYY 100

Query: 61  KDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKL 120
             LI+ELLA  I+P+VTL H+D PQAL++ YGG+L+   + DF DY D CFK +GDRVK 
Sbjct: 101 DRLIDELLAAGIEPYVTLYHWDLPQALQD-YGGWLNRSTIDDFKDYADTCFKRFGDRVKY 159

Query: 121 WASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEPYIAAHNMLLSHGALVNLYK 180
           W + NEP      GY  G  APG                 PY AAH++LL+H   V LY+
Sbjct: 160 WLTFNEPWVAAWLGYGTGVHAPGGN-----------DGVAPYQAAHHLLLAHARAVKLYR 208

Query: 181 HKYQPYQMGKIGITILTHWFEPKF-KTAASRQAASRARDFFFGW 223
             YQ    G+IGI +   W  P         +AA RA  F  GW
Sbjct: 209 EHYQK---GQIGIVLNLSWAYPLSPSPPDDVEAAERADQFHNGW 249

Length = 454
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase Back     alignment and domain information
>gnl|CDD|182112 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|184975 PRK15014, PRK15014, 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>gnl|CDD|236580 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
KOG0626 524 consensus Beta-glucosidase, lactase phlorizinhydro 100.0
PLN02998 497 beta-glucosidase 100.0
PLN02849 503 beta-glucosidase 100.0
PLN02814 504 beta-glucosidase 100.0
COG2723 460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 100.0
PRK13511 469 6-phospho-beta-galactosidase; Provisional 100.0
TIGR01233 467 lacG 6-phospho-beta-galactosidase. This enzyme is 100.0
PRK09593 478 arb 6-phospho-beta-glucosidase; Reviewed 100.0
PRK09589 476 celA 6-phospho-beta-glucosidase; Reviewed 100.0
PRK15014 477 6-phospho-beta-glucosidase BglA; Provisional 100.0
PF00232 455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 100.0
PRK09852 474 cryptic 6-phospho-beta-glucosidase; Provisional 100.0
TIGR03356 427 BGL beta-galactosidase. 100.0
PF02449 374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 99.55
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 99.55
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 99.07
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 98.85
COG2730 407 BglC Endoglucanase [Carbohydrate transport and met 98.69
PF01229 486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 98.58
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 98.14
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 98.03
PLN03059 840 beta-galactosidase; Provisional 97.85
PF07745 332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 97.8
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 97.65
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 97.61
PF14587 384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 97.53
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 97.45
PF01373 402 Glyco_hydro_14: Glycosyl hydrolase family 14; Inte 97.38
PLN02803 548 beta-amylase 97.31
PRK10150604 beta-D-glucuronidase; Provisional 97.3
PLN02161 531 beta-amylase 97.28
PLN00197 573 beta-amylase; Provisional 97.24
PLN02801 517 beta-amylase 97.14
PLN02705 681 beta-amylase 96.97
PLN02905 702 beta-amylase 96.93
KOG0496 649 consensus Beta-galactosidase [Carbohydrate transpo 96.89
PF14488166 DUF4434: Domain of unknown function (DUF4434) 96.89
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 96.44
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 96.06
COG3250 808 LacZ Beta-galactosidase/beta-glucuronidase [Carboh 95.79
COG3934 587 Endo-beta-mannanase [Carbohydrate transport and me 94.73
COG3664 428 XynB Beta-xylosidase [Carbohydrate transport and m 94.46
COG3867 403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 93.86
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 93.03
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 92.84
smart00642166 Aamy Alpha-amylase domain. 91.65
PLN02361 401 alpha-amylase 88.23
PF07488328 Glyco_hydro_67M: Glycosyl hydrolase family 67 midd 88.11
PRK05402 726 glycogen branching enzyme; Provisional 87.54
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 86.78
PLN00196 428 alpha-amylase; Provisional 86.57
PRK12313 633 glycogen branching enzyme; Provisional 86.53
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 86.37
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 86.34
KOG2233 666 consensus Alpha-N-acetylglucosaminidase [Intracell 85.49
cd06592303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 84.53
COG3589 360 Uncharacterized conserved protein [Function unknow 84.47
PRK05799374 coproporphyrinogen III oxidase; Provisional 84.38
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 84.16
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 82.18
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 82.03
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 81.89
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 81.68
TIGR01210313 conserved hypothetical protein TIGR01210. This fam 81.5
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 81.4
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 81.34
PRK05474 437 xylose isomerase; Provisional 81.25
TIGR02630 434 xylose_isom_A xylose isomerase. Members of this fa 80.86
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 80.69
PLN02784 894 alpha-amylase 80.6
PLN02746347 hydroxymethylglutaryl-CoA lyase 80.44
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 80.34
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 80.17
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2e-72  Score=512.50  Aligned_cols=222  Identities=61%  Similarity=1.177  Sum_probs=214.2

Q ss_pred             cCCCCCCcccCCcccChHHHHHHHHHcCCCEEEecccccccccCCCCCCCCChhHHHHHHHHHHHHHhCCCeeEEecCCC
Q 046612            2 IFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHF   81 (223)
Q Consensus         2 ~~~~~~~~~a~d~y~~~~eDi~l~~~lG~~~~R~si~W~ri~P~~~~~g~~n~~~l~~y~~~i~~l~~~gi~p~vtL~h~   81 (223)
                      +.+..++++|||+||+|+|||+||++||+++||||||||||+|.|...+.+|++||++|+++|++|+++||+|+|||+||
T Consensus        77 ~~~~~ngdva~D~Yh~ykeDv~Lmk~lgv~afRFSIsWSRIlP~G~~~~gVN~~Gi~fY~~LI~eL~~nGI~P~VTLfHw  156 (524)
T KOG0626|consen   77 ICDGSNGDVAVDFYHRYKEDVKLMKELGVDAFRFSISWSRILPNGRLTGGVNEAGIQFYNNLIDELLANGIEPFVTLFHW  156 (524)
T ss_pred             cccCCCCCeechhhhhhHHHHHHHHHcCCCeEEEEeehHhhCCCCCcCCCcCHHHHHHHHHHHHHHHHcCCeEEEEEecC
Confidence            34577899999999999999999999999999999999999999843368999999999999999999999999999999


Q ss_pred             CCchhhhhhhCCCCChHhHHHHHHHHHHHHHHhCCCcccEEeecCCcccccccccCCCCCCCCCCCCCCCCCCCCCCChH
Q 046612           82 DPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVGNCTAGDSATEP  161 (223)
Q Consensus        82 ~~P~~l~~~~gg~~~~~~~~~f~~y~~~~~~~~~~~v~~w~t~NEp~~~~~~~y~~g~~~pg~~~~~~~~~~~~~~~~~~  161 (223)
                      |+|++|+++||||.|++++++|.+||+.||++|||+||+|+|||||++++..||..|..|||+|+....+|+.++++.+.
T Consensus       157 DlPq~LeDeYgGwLn~~ivedF~~yA~~CF~~fGDrVK~WiT~NEP~v~s~~gY~~G~~aPGrCs~~~~~c~~g~s~~ep  236 (524)
T KOG0626|consen  157 DLPQALEDEYGGWLNPEIVEDFRDYADLCFQEFGDRVKHWITFNEPNVFSIGGYDTGTKAPGRCSKYVGNCSAGNSGTEP  236 (524)
T ss_pred             CCCHHHHHHhccccCHHHHHHHHHHHHHHHHHhcccceeeEEecccceeeeehhccCCCCCCCCCcccccCCCCCCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999877899999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhcCCCCCCeEEEeecCceeecCCCCHHHHHHHHHHHHHhcCC
Q 046612          162 YIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW  223 (223)
Q Consensus       162 ~~~~hn~l~AHa~a~~~~k~~~~~~~~~kvGi~~~~~~~~P~~~~~~D~~aa~~~~~~~~~~  223 (223)
                      |.+.|||++|||+||++||+.++..|+|+|||+++..|++|++.+++|++||+|+.+|.+||
T Consensus       237 Yiv~HNllLAHA~Av~~yr~kyk~~Q~G~IGi~~~~~w~eP~~~s~~D~~Aa~Ra~~F~~gw  298 (524)
T KOG0626|consen  237 YIVAHNLLLAHAAAVDLYRKKYKKKQGGKIGIALSARWFEPYDDSKEDKEAAERALDFFLGW  298 (524)
T ss_pred             chHHHHHHHHHHHHHHHHHHhhhhhcCCeEeEEEeeeeeccCCCChHHHHHHHHHHHhhhhh
Confidence            99999999999999999999988889999999999999999988899999999999999998

>PLN02998 beta-glucosidase Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02803 beta-amylase Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>PLN02161 beta-amylase Back     alignment and domain information
>PLN00197 beta-amylase; Provisional Back     alignment and domain information
>PLN02801 beta-amylase Back     alignment and domain information
>PLN02705 beta-amylase Back     alignment and domain information
>PLN02905 beta-amylase Back     alignment and domain information
>KOG0496 consensus Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>COG3250 LacZ Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3664 XynB Beta-xylosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>PF07488 Glyco_hydro_67M: Glycosyl hydrolase family 67 middle domain; InterPro: IPR011100 Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>KOG2233 consensus Alpha-N-acetylglucosaminidase [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR01210 conserved hypothetical protein TIGR01210 Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK05474 xylose isomerase; Provisional Back     alignment and domain information
>TIGR02630 xylose_isom_A xylose isomerase Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
3ptk_A 505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 4e-74
1cbg_A 490 The Crystal Structure Of A Cyanogenic Beta-Glucosid 7e-69
2jf6_A 532 Structure Of Inactive Mutant Of Strictosidine Gluco 2e-64
4a3y_A 540 Crystal Structure Of Raucaffricine Glucosidase From 2e-56
3gno_A 488 Crystal Structure Of A Rice Os3bglu6 Beta-glucosida 2e-56
4atd_A 513 Crystal Structure Of Native Raucaffricine Glucosida 2e-56
3u57_A 513 Structures Of Alkaloid Biosynthetic Glucosidases De 5e-56
2rgl_A 481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 1e-55
3scp_A 481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 1e-55
3scr_A 481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 1e-55
3scv_A 481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 1e-55
3scw_A 481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 1e-55
3scn_A 481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 1e-55
3f4v_A 481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 2e-55
1v03_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 2e-52
1v02_E 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 6e-52
1v02_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 1e-51
1dwa_M 499 Study On Radiation Damage On A Cryocooled Crystal. 4e-51
1e6q_M 501 Myrosinase From Sinapis Alba With The Bound Transit 4e-51
1myr_A 501 Myrosinase From Sinapis Alba Length = 501 7e-51
1e1e_A 512 Crystal Structure Of A Monocot (Maize Zmglu1) Beta- 2e-50
1hxj_A 507 Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos 3e-50
2dga_A 565 Crystal Structure Of Hexameric Beta-Glucosidase In 3e-50
1h49_A 512 Crystal Structure Of The Inactive Double Mutant Of 6e-50
1e4l_A 512 Crystal Structure Of The Inactive Mutant Monocot (M 7e-50
3ais_A 565 Crystal Structure Of A Mutant Beta-Glucosidase In W 2e-49
2e3z_A 465 Crystal Structure Of Intracellular Family 1 Beta- G 3e-48
3aiu_A 564 Crystal Structure Of Beta-Glucosidase In Rye Length 2e-47
2jfe_X 469 The Crystal Structure Of Human Cytosolic Beta-Gluco 2e-39
2e9l_A 469 Crystal Structure Of Human Cytosolic Neutral Beta-G 2e-39
2zox_A 469 Crystal Structure Of The Covalent Intermediate Of H 4e-39
3ahx_A 453 Crystal Structure Of Beta-Glucosidase A From Bacter 4e-38
3ahz_A 487 Crystal Structure Of Beta-Glucosidase From Termite 6e-38
3ai0_A 487 Crystal Structure Of Beta-Glucosidase From Termite 2e-37
3vik_A 487 Crystal Structure Of Beta-Glucosidase From Termite 3e-37
3vij_A 487 Crystal Structure Of Beta-Glucosidase From Termite 3e-37
4gxp_A 467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 1e-36
1wcg_A 464 Aphid Myrosinase Length = 464 2e-36
3ta9_A 458 Beta-Glucosidase A From The Halothermophile H. Oren 1e-34
3ahy_A 473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 3e-33
1od0_A 468 Family 1 B-Glucosidase From Thermotoga Maritima Len 2e-32
1qox_A 449 Beta-Glucosidase From Bacillus Circulans Sp. Alkalo 1e-31
2jie_A 454 Beta-Glucosidase B From Bacillus Polymyxa Complexed 5e-31
2o9p_A 454 Beta-Glucosidase B From Paenibacillus Polymyxa Leng 6e-31
2o9r_A 452 Beta-Glucosidase B Complexed With Thiocellobiose Le 7e-31
4hz6_A 444 Crystal Structure Of Bglb Length = 444 1e-29
3cmj_A 465 Crystal Structure Of Engineered Beta-Glucosidase Fr 2e-29
4f79_A 480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 3e-28
4f66_A 480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 3e-28
3pn8_A 480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 3e-28
1np2_A 436 Crystal Structure Of Thermostable Beta-Glycosidase 5e-28
3zjk_A 431 Crystal Structure Of Ttb-gly F401s Mutant Length = 2e-27
1ug6_A 431 Structure Of Beta-Glucosidase At Atomic Resolution 2e-27
1gnx_A 479 B-Glucosidase From Streptomyces Sp Length = 479 3e-27
1uyq_A 447 Mutated B-Glucosidase A From Paenibacillus Polymyxa 7e-27
1bgg_A 448 Glucosidase A From Bacillus Polymyxa Complexed With 7e-27
1bga_A 447 Beta-Glucosidase A From Bacillus Polymyxa Length = 8e-27
1e4i_A 447 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE 8e-27
1tr1_A 447 Crystal Structure Of E96k Mutated Beta-glucosidase 8e-27
3qom_A 481 Crystal Structure Of 6-Phospho-Beta-Glucosidase Fro 6e-26
2pbg_A 468 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 2e-25
4pbg_A 468 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 2e-25
1pbg_A 468 The Three-Dimensional Structure Of 6-Phospho-Beta G 3e-25
4b3k_A 479 Family 1 6-phospho-beta-d Glycosidase From Streptoc 4e-24
2xhy_A 479 Crystal Structure Of E.Coli Bgla Length = 479 4e-24
1vff_A 423 Beta-Glycosidase From Pyrococcus Horikoshii Length 1e-13
3apg_A 473 Crystal Structure Of Hyperthermophilic Beta-Glucosi 1e-07
1qvb_A 481 Crystal Structure Of The Beta-Glycosidase From The 1e-07
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure 
Iteration: 1

 Score =  273 bits (699), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 127/224 (56%), Positives = 158/224 (70%), Gaps = 1/224 (0%)
Query: 1   KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFY 60
           KI DRS GD+AS  YH YKED++LMK +G+D++RFSISWTRILP G + GGVN  G+K+Y
Sbjct: 73  KIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYY 132
Query: 61  KDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKL 120
            +LINELL+  ++PF+TL H+D PQALE++Y GFLSP I+ DF DY + CFK +GDRVK 
Sbjct: 133 NNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKN 192
Query: 121 WASMNEPNGMVMNGYNGGSFAPGRCSNYV-GNCTAGDSATEPYIAAHNMLLSHGALVNLY 179
           W + NEP     NGY  G FAPGRCS +  GNC+ GDS  EPY A H+ LL+H   V LY
Sbjct: 193 WITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLY 252
Query: 180 KHKYQPYQMGKIGITILTHWFEPKFKTXXXXXXXXXXXDFFFGW 223
           K KYQ  Q GKIGIT+++HWF P  ++           DF FGW
Sbjct: 253 KAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGW 296
>pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 Back     alignment and structure
>pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 Back     alignment and structure
>pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 Back     alignment and structure
>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 Back     alignment and structure
>pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 Back     alignment and structure
>pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1DWA|M Chain M, Study On Radiation Damage On A Cryocooled Crystal. Part 1: Structure Prior To Irradiation Length = 499 Back     alignment and structure
>pdb|1E6Q|M Chain M, Myrosinase From Sinapis Alba With The Bound Transition State Analogue Gluco-Tetrazole Length = 501 Back     alignment and structure
>pdb|1MYR|A Chain A, Myrosinase From Sinapis Alba Length = 501 Back     alignment and structure
>pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 Back     alignment and structure
>pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 Back     alignment and structure
>pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 Back     alignment and structure
>pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 Back     alignment and structure
>pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 Back     alignment and structure
>pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|3AHX|A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans Length = 453 Back     alignment and structure
>pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 Back     alignment and structure
>pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 Back     alignment and structure
>pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 Back     alignment and structure
>pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 Back     alignment and structure
>pdb|3TA9|A Chain A, Beta-Glucosidase A From The Halothermophile H. Orenii Length = 458 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 Back     alignment and structure
>pdb|1QOX|A Chain A, Beta-Glucosidase From Bacillus Circulans Sp. Alkalophilus Length = 449 Back     alignment and structure
>pdb|2JIE|A Chain A, Beta-Glucosidase B From Bacillus Polymyxa Complexed With 2- F-Glucose Length = 454 Back     alignment and structure
>pdb|2O9P|A Chain A, Beta-Glucosidase B From Paenibacillus Polymyxa Length = 454 Back     alignment and structure
>pdb|2O9R|A Chain A, Beta-Glucosidase B Complexed With Thiocellobiose Length = 452 Back     alignment and structure
>pdb|4HZ6|A Chain A, Crystal Structure Of Bglb Length = 444 Back     alignment and structure
>pdb|3CMJ|A Chain A, Crystal Structure Of Engineered Beta-Glucosidase From Soil Metagenome Length = 465 Back     alignment and structure
>pdb|4F79|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase Mutant (E375q) In Complex With Salicin 6-Phosphate Length = 480 Back     alignment and structure
>pdb|4F66|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 In Complex With Beta-D-Glucose-6-Phosphate. Length = 480 Back     alignment and structure
>pdb|3PN8|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 Length = 480 Back     alignment and structure
>pdb|1NP2|A Chain A, Crystal Structure Of Thermostable Beta-Glycosidase From Thermophilic Eubacterium Thermus Nonproteolyticus Hg102 Length = 436 Back     alignment and structure
>pdb|3ZJK|A Chain A, Crystal Structure Of Ttb-gly F401s Mutant Length = 431 Back     alignment and structure
>pdb|1UG6|A Chain A, Structure Of Beta-Glucosidase At Atomic Resolution From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|1GNX|A Chain A, B-Glucosidase From Streptomyces Sp Length = 479 Back     alignment and structure
>pdb|1UYQ|A Chain A, Mutated B-Glucosidase A From Paenibacillus Polymyxa Showing Increased Stability Length = 447 Back     alignment and structure
>pdb|1BGG|A Chain A, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate Length = 448 Back     alignment and structure
>pdb|1BGA|A Chain A, Beta-Glucosidase A From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1E4I|A Chain A, 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE Complex Of The Beta-Glucosidase From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1TR1|A Chain A, Crystal Structure Of E96k Mutated Beta-glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance Length = 447 Back     alignment and structure
>pdb|3QOM|A Chain A, Crystal Structure Of 6-Phospho-Beta-Glucosidase From Lactobacillus Plantarum Length = 481 Back     alignment and structure
>pdb|2PBG|A Chain A, 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 Back     alignment and structure
>pdb|4PBG|A Chain A, 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 Back     alignment and structure
>pdb|1PBG|A Chain A, The Three-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis Length = 468 Back     alignment and structure
>pdb|4B3K|A Chain A, Family 1 6-phospho-beta-d Glycosidase From Streptococcus Pyogenes Length = 479 Back     alignment and structure
>pdb|2XHY|A Chain A, Crystal Structure Of E.Coli Bgla Length = 479 Back     alignment and structure
>pdb|1VFF|A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii Length = 423 Back     alignment and structure
>pdb|3APG|A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus Length = 473 Back     alignment and structure
>pdb|1QVB|A Chain A, Crystal Structure Of The Beta-Glycosidase From The Hyperthermophile Thermosphaera Aggregans Length = 481 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 1e-127
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 1e-127
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 1e-127
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 1e-126
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 1e-126
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 1e-125
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 1e-124
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 1e-123
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 1e-122
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 1e-121
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 1e-117
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-116
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 1e-115
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 1e-115
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 1e-109
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-108
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 1e-106
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 1e-106
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 1e-106
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 1e-106
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 1e-105
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 1e-105
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 1e-104
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 1e-102
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 5e-99
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 5e-95
4eam_A 489 Lactase, beta-galactosidase; glycoside hydrolase, 4e-92
3apg_A 473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 6e-92
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 1e-89
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 6e-64
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 9e-63
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 1e-62
1ceo_A 343 Cellulase CELC; glycosyl hydrolase, family A/5 of 3e-06
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 7e-05
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 1e-04
3ayr_A 376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 3e-04
3qho_A 458 Endoglucanase, 458AA long hypothetical endo-1,4-be 4e-04
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 5e-04
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 7e-04
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
 Score =  367 bits (944), Expect = e-127
 Identities = 132/224 (58%), Positives = 163/224 (72%), Gaps = 1/224 (0%)

Query: 1   KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFY 60
           KI DR+ GD+A   YH YKEDI +MK + LD++RFSISW R+LPKGK+SGGVN  G+ +Y
Sbjct: 58  KIKDRTNGDVAIDEYHRYKEDIGIMKDMNLDAYRFSISWPRVLPKGKLSGGVNREGINYY 117

Query: 61  KDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKL 120
            +LINE+LAN ++P+VTL H+D PQALE+EY GFL   IV DF DY + CFK +GDRVK 
Sbjct: 118 NNLINEVLANGMQPYVTLFHWDVPQALEDEYRGFLGRNIVDDFRDYAELCFKEFGDRVKH 177

Query: 121 WASMNEPNGMVMNGYNGGSFAPGRCSNYVG-NCTAGDSATEPYIAAHNMLLSHGALVNLY 179
           W ++NEP G+ MN Y  G+FAPGRCS+++  NCT GDS  EPY+AAH  LL+H A   LY
Sbjct: 178 WITLNEPWGVSMNAYAYGTFAPGRCSDWLKLNCTGGDSGREPYLAAHYQLLAHAAAARLY 237

Query: 180 KHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW 223
           K KYQ  Q G IGIT+++HWFEP  K  A   AA R  DF  GW
Sbjct: 238 KTKYQASQNGIIGITLVSHWFEPASKEKADVDAAKRGLDFMLGW 281
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Length = 340 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 100.0
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 100.0
4atd_A 513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 100.0
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 100.0
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 100.0
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 100.0
4b3l_A 479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 100.0
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 100.0
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 100.0
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 100.0
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 100.0
4hz8_A 444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 100.0
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 100.0
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 100.0
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 100.0
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 100.0
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 100.0
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 100.0
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 100.0
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 100.0
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 100.0
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 100.0
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 100.0
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 100.0
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 100.0
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 100.0
1uwi_A 489 Beta-galactosidase; hydrolase, beta-glycosidase, g 100.0
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 100.0
4ha4_A 489 Beta-galactosidase; TIM barrel, beta-glycosidase, 100.0
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 100.0
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 100.0
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 100.0
3apg_A 473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 100.0
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 100.0
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.8
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 99.78
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.77
1vem_A 516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 99.76
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 99.76
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 99.76
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 99.75
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.75
1fob_A 334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 99.74
1ceo_A 343 Cellulase CELC; glycosyl hydrolase, family A/5 of 99.74
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 99.73
3ayr_A 376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 99.72
2osx_A 481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 99.72
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 99.72
2jep_A 395 Xyloglucanase; family 5, plant cell WALL, hydrolas 99.7
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 99.7
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.7
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 99.7
1edg_A 380 Endoglucanase A; family A, cellulases, xylanases, 99.7
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 99.69
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 99.68
1h4p_A 408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 99.63
3n9k_A 399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 99.63
3qho_A 458 Endoglucanase, 458AA long hypothetical endo-1,4-be 99.58
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 99.53
3d3a_A 612 Beta-galactosidase; protein structure initiative I 99.52
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 99.5
1uuq_A 440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 99.47
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 99.44
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 99.42
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 99.42
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 99.38
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 99.38
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 99.37
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 99.32
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 99.31
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 99.31
1g01_A 364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 99.27
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 99.25
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 99.23
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 99.21
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 99.21
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 99.19
3jug_A 345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 99.19
1ur1_A 378 Endoxylanase; hydrolase, family 10, glycoside hydr 99.17
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 99.17
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 99.15
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 99.15
2dep_A 356 Xylanase B, thermostable celloxylanase; glycosidas 99.15
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 99.13
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 99.12
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 99.12
1r85_A 379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 99.11
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 99.1
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 99.1
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 99.09
3emz_A 331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 99.06
3u7v_A 552 Beta-galactosidase; structural genomics, PSI-biolo 99.05
2uwf_A 356 Endoxylanase, alkaline active endoxylanase; hydrol 99.05
4f8x_A 335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 99.04
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 99.04
1us2_A 530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 99.02
1w32_A 348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 98.99
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 98.98
4awe_A 387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 98.91
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 98.91
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 98.81
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 98.77
1ur4_A 399 Galactanase; hydrolase, beta-1, glycoside hydrolas 98.68
3ro8_A 341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 98.52
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 98.26
3cmg_A 667 Putative beta-galactosidase; structural genomics, 97.89
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 97.79
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 97.77
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 97.68
2w5f_A 540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 97.66
1qw9_A 502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 97.65
2y2w_A 574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 97.64
3fn9_A 692 Putative beta-galactosidase; structural genomics, 97.6
2c7f_A 513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 97.59
1fa2_A 498 Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 97.57
1wdp_A 495 Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 97.57
2xfr_A 535 Beta-amylase; hydrolase, carbohydrate metabolism, 97.51
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 97.48
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 97.44
2y24_A 383 Xylanase; hydrolase, GH5 family, aldotetraouronic 97.33
3kzs_A 463 Glycosyl hydrolase family 5; structural genomics, 97.25
3gm8_A 801 Glycoside hydrolase family 2, candidate beta-GLYC; 97.22
2je8_A 848 Beta-mannosidase; glycoside hydrolase, hydrolase; 97.21
4h41_A340 Putative alpha-L-fucosidase; hydrolase, carbohydra 97.16
3clw_A 507 Conserved exported protein; structural genomics, u 96.97
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 96.75
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 96.58
3kl0_A 401 Glucuronoxylanase XYNC; alpha beta barrel, (beta/a 96.55
2wnw_A 447 Activated by transcription factor SSRB; hydrolase, 96.53
2vrq_A 496 Alpha-L-arabinofuranosidase; hydrolase, glycosidas 96.46
2vzs_A 1032 CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, 96.46
3vny_A 488 Beta-glucuronidase; TIM barrel, greek-KEY, glycosi 96.37
2nt0_A 497 Glucosylceramidase; cerezyme, glucocerebrosidase, 96.25
2yih_A 524 CEL44C, xyloglucanase; hydrolase, GH44, endo-gluca 96.24
3ug3_A 504 Alpha-L-arabinofuranosidase; TIM barrel, hydrolase 95.74
2e4t_A 519 Endoglucanase, xyloglucanase; TIM barrel, TIM-like 94.01
3zr5_A 656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 92.77
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 92.24
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 91.74
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 91.74
4aw7_A 591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 91.13
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 91.11
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 89.61
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 89.51
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 89.32
3mi6_A 745 Alpha-galactosidase; NESG, structural genomics, PS 89.01
3ii1_A 535 Cellulase; CELM2, glucanase-xyanase, glucanase, xy 88.56
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 88.4
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 87.91
2yfo_A 720 Alpha-galactosidase-sucrose kinase agask; hydrolas 87.9
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 87.9
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 87.69
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 87.64
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 87.51
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 87.49
3a24_A641 Alpha-galactosidase; glycoside hydrolase family 97 87.24
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 87.11
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 86.84
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 86.23
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 85.87
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 85.81
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 85.03
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 84.35
2v5d_A 737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 84.21
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 84.14
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 84.12
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 84.11
1gqi_A 708 Alpha-glucuronidase; (alpha-beta)8 barrel, glycosi 83.7
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 83.42
2v5c_A 594 O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrol 83.28
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 83.14
3ik2_A 517 Endoglucanase A; TIM-like barrel, hydrolase; 2.20A 83.12
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 82.81
3p14_A 424 L-rhamnose isomerase; TIM barrel; 2.51A {Bacillus 82.79
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 82.38
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 82.03
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 81.8
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 81.76
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 81.25
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 81.11
1l8n_A 679 Alpha-D-glucuronidase; hydrolase; HET: GCW XYP; 1. 80.73
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 80.72
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 80.51
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 80.29
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 80.11
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
Probab=100.00  E-value=5.8e-70  Score=504.72  Aligned_cols=222  Identities=58%  Similarity=1.110  Sum_probs=206.2

Q ss_pred             cCCCCCCcccCCcccChHHHHHHHHHcCCCEEEecccccccccCCCCCCCCChhHHHHHHHHHHHHHhCCCeeEEecCCC
Q 046612            2 IFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHF   81 (223)
Q Consensus         2 ~~~~~~~~~a~d~y~~~~eDi~l~~~lG~~~~R~si~W~ri~P~~~~~g~~n~~~l~~y~~~i~~l~~~gi~p~vtL~h~   81 (223)
                      +.+++++++||||||||+|||+||++||+++|||||+|+||+|++...|.+|++||++|+++|++|+++||+|+|||+||
T Consensus        74 i~~~~~gd~A~D~YhrykEDi~Lm~elG~~~yRfSIsWsRI~P~g~~~g~vN~~Gl~fY~~lid~l~~~GIeP~VTL~Hw  153 (505)
T 3ptm_A           74 IADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHW  153 (505)
T ss_dssp             STTSCCSSSTTCHHHHHHHHHHHHHHHTCSEEEEECCHHHHSTTSSSTTCCCHHHHHHHHHHHHHHHHTTCEEEEEEESS
T ss_pred             ccCCCCCCccccHHHHHHHHHHHHHHcCCCEEEeeccHHHcCcCCCCCCCcCHHHHHHHHHHHHHHHHCCCEEEEEecCC
Confidence            45678999999999999999999999999999999999999999831279999999999999999999999999999999


Q ss_pred             CCchhhhhhhCCCCChHhHHHHHHHHHHHHHHhCCCcccEEeecCCcccccccccCCCCCCCCCCCCCC-CCCCCCCCCh
Q 046612           82 DPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVG-NCTAGDSATE  160 (223)
Q Consensus        82 ~~P~~l~~~~gg~~~~~~~~~f~~y~~~~~~~~~~~v~~w~t~NEp~~~~~~~y~~g~~~pg~~~~~~~-~~~~~~~~~~  160 (223)
                      |+|+||+++||||.|+++++.|++||+.|+++|||+|++|+|||||++++..||..|.+|||+++.... +|+.+++.++
T Consensus       154 DlP~~L~~~yGGW~nr~~v~~F~~YA~~~f~~fgDrVk~W~T~NEp~~~~~~gy~~G~~~Pg~~~~~~~~~~~~g~~~~~  233 (505)
T 3ptm_A          154 DSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGRE  233 (505)
T ss_dssp             CCBHHHHHHHCGGGSTHHHHHHHHHHHHHHHHHTTTCCEEEEEECHHHHHHHHHTSCCSTTCCCCTTSTTCCSSCCTTTH
T ss_pred             CCcHHHHHhcCCcCCHHHHHHHHHHHHHHHHHhCccCceEEEecCcchhhhccccccccCCcccccccccccccccchHH
Confidence            999999998999999999999999999999999999999999999999999999999999998764322 5777777789


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCCCCCeEEEeecCceeecCCCCHHHHHHHHHHHHHhcCC
Q 046612          161 PYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW  223 (223)
Q Consensus       161 ~~~~~hn~l~AHa~a~~~~k~~~~~~~~~kvGi~~~~~~~~P~~~~~~D~~aa~~~~~~~~~~  223 (223)
                      .++++||+++|||+|++++|++++..|+++|||+++..+++|.+++|+|++||++.++|.++|
T Consensus       234 ~~~a~hh~llAHa~Av~~~r~~~~~~~~g~IGi~l~~~~~~P~~~~~~D~~Aa~~~~~~~~~~  296 (505)
T 3ptm_A          234 PYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNNDAAKRAIDFMFGW  296 (505)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTHHHHCCEEEEEEECCEEEESSSSHHHHHHHHHHHHHHTHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccCCCCeEEEEecCceeecCCCCHHHHHHHHHHHHHHhhh
Confidence            999999999999999999999864347899999999999999999999999999999988765
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 Back     alignment and structure
>1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* Back     alignment and structure
>2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3kl0_A Glucuronoxylanase XYNC; alpha beta barrel, (beta/alpha)8 barrel (beta/alpha)8 + beta motif family, hydrolase; HET: TAR HIS; 1.64A {Bacillus subtilis} PDB: 3gtn_A* 3kl3_A* 3kl5_A* Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A Back     alignment and structure
>2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* Back     alignment and structure
>3vny_A Beta-glucuronidase; TIM barrel, greek-KEY, glycoside hydrolase family 79, hydrol; 1.50A {Acidobacterium capsulatum} PDB: 3vnz_A* 3vo0_A* Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>2yih_A CEL44C, xyloglucanase; hydrolase, GH44, endo-glucanase, carbohydrate-binding protei; HET: BGC; 1.70A {Paenibacillus polymyxa} PDB: 2yjq_A* 2ykk_A* 3zq9_A* Back     alignment and structure
>3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A Back     alignment and structure
>2e4t_A Endoglucanase, xyloglucanase; TIM barrel, TIM-like barrel, composite domain of glycosyl HY families 5, 30, 39 and 51, hydrolase; 0.96A {Clostridium thermocellum} PDB: 2e0p_A 2eo7_A* 2ej1_A* 2eex_A* 2eqd_A* Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>3ii1_A Cellulase; CELM2, glucanase-xyanase, glucanase, xylanase, bifunctional enzyme, hydrolase; HET: BGC; 2.25A {Uncultured bacterium} PDB: 3fw6_A Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1gqi_A Alpha-glucuronidase; (alpha-beta)8 barrel, glycoside hydrolase; 1.48A {Pseudomonas cellulosa} SCOP: c.1.8.10 d.92.2.2 PDB: 1gqj_A* 1gqk_A* 1gql_A* 1h41_A* Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>2v5c_A O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrolase, coiled coil, family 84 glycoside hydrolase, carbohydrate binding module; 2.10A {Clostridium perfringens} PDB: 2cbj_A* 2cbi_A 2vur_A* 2x0y_A* 2j62_A* 2wb5_A* 2xpk_A* 2yds_A* 2ydr_A* 2ydq_A* Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>3ik2_A Endoglucanase A; TIM-like barrel, hydrolase; 2.20A {Clostridium acetobutylicum} Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3p14_A L-rhamnose isomerase; TIM barrel; 2.51A {Bacillus halodurans} SCOP: c.1.15.2 PDB: 3uu0_A 3uva_A 3uxi_A Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1l8n_A Alpha-D-glucuronidase; hydrolase; HET: GCW XYP; 1.50A {Geobacillus stearothermophilus} SCOP: c.1.8.10 d.92.2.2 PDB: 1k9d_A* 1mqq_A* 1mqp_A 1mqr_A* 1k9f_A* 1k9e_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 223
d1cbga_ 490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 1e-68
d1v02a_ 484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 1e-64
d1e4mm_ 499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 3e-62
d1gnxa_ 464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 3e-53
d2j78a1 443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 2e-52
d1wcga1 462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 3e-51
d1e4ia_ 447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 2e-49
d1qoxa_ 449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 5e-49
d1ug6a_ 426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 4e-47
d1qvba_ 481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 4e-46
d1pbga_ 468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 6e-45
d1uwsa_ 489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 2e-44
d1vffa1 423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 9e-39
d1kwga2 393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 5e-17
d1edga_ 380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 1e-06
d1ceoa_ 340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 1e-06
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 1e-05
d1ur4a_ 387 c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus lichen 5e-05
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 2e-04
d2pb1a1 394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 4e-04
d1h4pa_ 408 c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea 0.004
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Plant beta-glucosidase (myrosinase)
species: Creeping white clover (Trifolium repens) [TaxId: 3899]

 Score =  216 bits (550), Expect = 1e-68
 Identities = 132/224 (58%), Positives = 163/224 (72%), Gaps = 1/224 (0%)

Query: 1   KIFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFY 60
           KI DR+ GD+A   YH YKEDI +MK + LD++RFSISW R+LPKGK+SGGVN  G+ +Y
Sbjct: 58  KIKDRTNGDVAIDEYHRYKEDIGIMKDMNLDAYRFSISWPRVLPKGKLSGGVNREGINYY 117

Query: 61  KDLINELLANDIKPFVTLLHFDPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKL 120
            +LINE+LAN ++P+VTL H+D PQALE+EY GFL   IV DF DY + CFK +GDRVK 
Sbjct: 118 NNLINEVLANGMQPYVTLFHWDVPQALEDEYRGFLGRNIVDDFRDYAELCFKEFGDRVKH 177

Query: 121 WASMNEPNGMVMNGYNGGSFAPGRCSNYVG-NCTAGDSATEPYIAAHNMLLSHGALVNLY 179
           W ++NEP G+ MN Y  G+FAPGRCS+++  NCT GDS  EPY+AAH  LL+H A   LY
Sbjct: 178 WITLNEPWGVSMNAYAYGTFAPGRCSDWLKLNCTGGDSGREPYLAAHYQLLAHAAAARLY 237

Query: 180 KHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW 223
           K KYQ  Q G IGIT+++HWFEP  K  A   AA R  DF  GW
Sbjct: 238 KTKYQASQNGIIGITLVSHWFEPASKEKADVDAAKRGLDFMLGW 281
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Length = 387 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
d1v02a_ 484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 100.0
d1qoxa_ 449 Beta-glucosidase A {Bacillus circulans, subsp. alk 100.0
d1cbga_ 490 Plant beta-glucosidase (myrosinase) {Creeping whit 100.0
d1e4ia_ 447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 100.0
d1e4mm_ 499 Plant beta-glucosidase (myrosinase) {White mustard 100.0
d1gnxa_ 464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 100.0
d2j78a1 443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 100.0
d1pbga_ 468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 100.0
d1wcga1 462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 100.0
d1ug6a_ 426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 100.0
d1vffa1 423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 100.0
d1uwsa_ 489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 100.0
d1qvba_ 481 beta-Glycosidase {Archaeon Thermosphaera aggregans 100.0
d1kwga2 393 A4 beta-galactosidase {Thermus thermophilus [TaxId 99.91
d1edga_ 380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 99.75
d1ceoa_ 340 Endoglucanase CelC {Clostridium thermocellum [TaxI 99.71
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 99.69
d1uuqa_ 410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.57
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 99.49
d2pb1a1 394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 99.45
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 99.42
d1h4pa_ 408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 99.4
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.39
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 99.38
d1foba_ 334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 99.36
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 99.3
d1uhva2 346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 99.29
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 99.25
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 99.25
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 99.25
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 99.24
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 99.17
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 99.16
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 99.16
d1g01a_ 357 Alkaline cellulase K catalytic domain {Bacillus sp 99.11
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 99.08
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 99.07
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 99.06
d1ur4a_ 387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 99.04
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 99.01
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 98.91
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 98.9
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 98.88
d1us3a2 364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 98.78
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 98.7
d1vema2 417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 98.61
d1r85a_ 371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 98.49
d1ur1a_ 350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 98.48
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 98.23
d2vzsa5 339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 98.22
d1w32a_ 346 Xylanase A, catalytic core {Pseudomonas fluorescen 98.15
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 98.1
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 97.86
d2je8a5 348 Five-domain beta-mannosidase, domain 3 {Bacteroide 97.85
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 97.56
d1wdpa1 490 beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} 97.25
d1fa2a_ 498 beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI 97.13
d1b1ya_ 500 beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 97.01
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 95.52
d1qw9a2 367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 95.34
d2bhua3 420 Glycosyltrehalose trehalohydrolase, central domain 95.3
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 94.86
d1ud2a2 390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 94.27
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 94.16
d1h3ga3 422 Cyclomaltodextrinase, central domain {Flavobacteri 93.78
d1ea9c3 382 Maltogenic amylase, central domain {Bacillus sp., 93.65
d1eh9a3 400 Glycosyltrehalose trehalohydrolase, central domain 93.57
d1hvxa2 393 Bacterial alpha-amylase {Bacillus stearothermophil 93.21
d1e43a2 393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 92.81
d1mxga2 361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 92.25
d2d3na2 394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 92.16
d1qhoa4 407 Cyclodextrin glycosyltransferase {Bacillus stearot 91.92
d1lwha2 391 4-alpha-glucanotransferase {Thermotoga maritima [T 91.4
d1wzla3 382 Maltogenic amylase, central domain {Thermoactinomy 90.81
d2guya2 381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 90.74
d1ht6a2 347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 90.56
d2aaaa2 381 Fungal alpha-amylases {Aspergillus niger, acid amy 90.54
d3bmva4 406 Cyclodextrin glycosyltransferase {Thermoanaerobact 90.39
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 90.13
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 89.72
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 89.71
d1bxba_ 387 D-xylose isomerase {Thermus aquaticus, subsp. Ther 89.03
d1m7xa3 396 1,4-alpha-glucan branching enzyme, central domain 88.23
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 88.18
d1muwa_ 386 D-xylose isomerase {Streptomyces olivochromogenes 87.68
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 87.48
d1ua7a2 344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 87.16
d1hx0a2 403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 84.91
d1xima_ 392 D-xylose isomerase {Actinoplanes missouriensis [Ta 84.67
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 83.38
d1xlma_ 393 D-xylose isomerase {Arthrobacter, strain b3728 [Ta 83.09
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 82.17
d1a0ca_ 437 D-xylose isomerase {Clostridium thermosulfurogenes 81.37
d1jaea2 378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 80.61
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Plant beta-glucosidase (myrosinase)
species: Sorghum bicolor [TaxId: 4558]

Probab=100.00  E-value=3e-65  Score=470.59  Aligned_cols=221  Identities=44%  Similarity=0.868  Sum_probs=204.3

Q ss_pred             cCCCCCCcccCCcccChHHHHHHHHHcCCCEEEecccccccccCCCCCCCCChhHHHHHHHHHHHHHhCCCeeEEecCCC
Q 046612            2 IFDRSTGDIASGFYHHYKEDIKLMKKVGLDSFRFSISWTRILPKGKISGGVNPLGVKFYKDLINELLANDIKPFVTLLHF   81 (223)
Q Consensus         2 ~~~~~~~~~a~d~y~~~~eDi~l~~~lG~~~~R~si~W~ri~P~~~~~g~~n~~~l~~y~~~i~~l~~~gi~p~vtL~h~   81 (223)
                      +.+++++++||||||||+|||+||++||+++|||||+|+||+|+++..|.+|++||+||+++|++|+++||+|+|||+||
T Consensus        53 ~~~~~~~~~a~d~y~ry~eDi~l~~~lG~~~yRfSisWsRI~P~g~~~g~~n~~gl~~Y~~~id~l~~~GI~P~vTL~Hf  132 (484)
T d1v02a_          53 IVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFSISWPRILPKGTLAGGINEKRVEYYNKLIDLLLENGIEPYITIFHW  132 (484)
T ss_dssp             STTSCCSSSTTCHHHHHHHHHHHHHHTTCSEEEEECCHHHHSTTSSSTTCCCHHHHHHHHHHHHHHHHTTCEEEEEEESS
T ss_pred             ccCCCCCCcccchhhhhHHHHHHHHHhCCCEEEccCCHHHcCCCCCCCCCCCHHHHHHHHHHHHHHHHcCCeEEEEecCC
Confidence            45788999999999999999999999999999999999999999743489999999999999999999999999999999


Q ss_pred             CCchhhhhhhCCCCChHhHHHHHHHHHHHHHHhCCCcccEEeecCCcccccccccCCCCCCCCCCCCCC-CCCCCCCCCh
Q 046612           82 DPPQALEEEYGGFLSPKIVKDFVDYGDFCFKTYGDRVKLWASMNEPNGMVMNGYNGGSFAPGRCSNYVG-NCTAGDSATE  160 (223)
Q Consensus        82 ~~P~~l~~~~gg~~~~~~~~~f~~y~~~~~~~~~~~v~~w~t~NEp~~~~~~~y~~g~~~pg~~~~~~~-~~~~~~~~~~  160 (223)
                      |+|+||++++|||.|+++++.|++||+.|+++|||+|++|+|+|||++++..||+.|.+|||++++... .++..++..+
T Consensus       133 d~P~~l~~~~Ggw~n~~~~~~F~~Ya~~v~~~fgd~V~~W~T~NEP~~~~~~~y~~g~~~pg~~~~~~~~~~~~~~~~~~  212 (484)
T d1v02a_         133 DTPQALVDAYGGFLDERIIKDYTDFAKVCFEKFGKTVKNWLTFNEPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSE  212 (484)
T ss_dssp             CCBHHHHHHHCGGGSTHHHHHHHHHHHHHHHHHTTTCCEEEEEECHHHHHHHHHTSCCSTTCBCCTTSCSSBCSSCTTTH
T ss_pred             cccceeeeecCcccCHHHHHHHHHhhHHHHHHhcchhhceEEecCcceecccccccceecccccCccccccCcccccHHH
Confidence            999999999999999999999999999999999999999999999999999999999999998875433 3444566788


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCCCCCeEEEeecCceeecCCCCHHHHHHHHHHHHHhcCC
Q 046612          161 PYIAAHNMLLSHGALVNLYKHKYQPYQMGKIGITILTHWFEPKFKTAASRQAASRARDFFFGW  223 (223)
Q Consensus       161 ~~~~~hn~l~AHa~a~~~~k~~~~~~~~~kvGi~~~~~~~~P~~~~~~D~~aa~~~~~~~~~~  223 (223)
                      .++++||+++||++|++++|+.. ..++++||++++..+++|.+++++|++||++.+++.++|
T Consensus       213 ~~~~~hn~l~AHa~a~~~~~~~~-~~~~~~ig~~~~~~~~~p~~~~~~d~~aa~~~~~~~~~~  274 (484)
T d1v02a_         213 PYIVAHNLLRAHAETVDIYNKYH-KGADGRIGLALNVFGRVPYTNTFLDQQAQERSMDKCLGW  274 (484)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHT-CTTTCEEEEEEECCEEEESSSSHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHh-hccCCceeeEecccceecCCCchHHHHHHHHHHHHHhhh
Confidence            99999999999999999999754 367899999999999999999999999999999887764
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bxba_ c.1.15.3 (A:) D-xylose isomerase {Thermus aquaticus, subsp. Thermophilus [TaxId: 271]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xima_ c.1.15.3 (A:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1xlma_ c.1.15.3 (A:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1a0ca_ c.1.15.3 (A:) D-xylose isomerase {Clostridium thermosulfurogenes, also known as Thermoanaerobacter thermosulfurigenes [TaxId: 33950]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure