Citrus Sinensis ID: 046626

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------
QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGTMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILFPINDEKTNQSILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLSDNDKIKKLPNSICELHSLQTLSLGGCRELEELPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLNIEMEGEESHCDRNKTRLHLRKLFVEGLPPLLELPQWLLQGSTKTLKNLIIRNCPNFMALPESLRNLEALETLAIGGCPALSERCKPQTGEDWPKIAHIPQVRIDDESDN
cHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHccccccccEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccHHHHcccccccccHHHHHHHHccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcHHHHHHHHHHHHccEEEEcccccccccccEEEEEEccccccccHHHHccccccccEEEccccccccHHHHHHHHHHccccccEEEcccccccHHcccccccccccccccccccccccccHHHHHcccccEEEcccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccHHHcccccccccccccccccEEEEcccccc
cHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEcccHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHccHHccccccccccHHHHHEcHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEHHHHHHHHHHHHccccEEEEccccccccccEEEEEEEEcccccccccccHHHHHcccHHccccccccccccccHHHccccccEEEEEEcccccccccccccccccccEEEcccccccccccccccccccccEEEEcccccHHHccHHccccccccEEEEcccccccccccccccccccEEEEcccccHccccHHHcccccccEEEEEccccccccHHcHHHccccccccEEEEccccccccccHHcccccccccEEEEEccccccccccccccccccHcEEEEcccccHHEcccccccccccccccccEEEEcccccc
QLQQIMRSCLNGKRYLFVMDdvwnedpkvWDELKSLLwggakgskilVTTRSNKVASIMgtmrgtggykleglpyesCLSLFMKCAfkegqhknpnlVKIGEEIVKKSGGIPLAVRTLGsllygstdehyWEYVRDNEIWKLEQKendilpalklsydqlpphlkqcfaycsifpkdydfdsVLLIRFWMAhgllqspneneepenIGMRYLNELLSrsffqdfsngmlpegFEIFFFKMHDLMHDLAQLVAKGeflivgsdcqsipkrvchlsfvgantsrnDFSSLLSDLRRARTilfpindektnqsILTSCISKSQFLRVIDLSETAIEVLSREIGNlkhlryldlsdndkikklpnsicelhslqtlslggcreleelPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLniemegeeshcdrnktrLHLRKLFVeglppllelpqwlLQGSTKTLKNLIIrncpnfmalpESLRNLEALETLAiggcpalserckpqtgedwpkiahipqvriddesdn
QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLlwggakgskilvttrsnkvasimgtmrgtggykLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILfpindektnqsILTSCISKSQFLRVIDLSETAIEVLSReignlkhlryldLSDNDKIKKLPNSICELhslqtlslggcrELEELPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLNIEMEGEESHCDRNKTRLHLRKLFVEGLPPLLELPQWLLQGSTKTLKNLIIRNCPNFMALPESLRNLEALETLAIGGCPALSERCKPqtgedwpkiahipqvriddesdn
QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGTMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILFPINDEKTNQSILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLSDNDKIKKLPNSICELHSLQTLSLGGCRELEELPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLNIEMEGEESHCDRNKTRLHLRKLFVeglppllelpqwllqgSTKTLKNLIIRNCPNFMALPESLRNLEALETLAIGGCPALSERCKPQTGEDWPKIAHIPQVRIDDESDN
*****MRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGTMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFDSVLLIRFWMAHGLL***********IGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILFPINDEKTNQSILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLSDNDKIKKLPNSICELHSLQTLSLGGCRELEELPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLNIEMEGEESHCDRNKTRLHLRKLFVEGLPPLLELPQWLLQGSTKTLKNLIIRNCPNFMALPESLRNLEALETLAIGGCPALSERCK*****DWPKIAHI***********
QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGTMRGTGGYKLEGLPYESCLSLFMKCAF*********LVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFDSVLLIRFWMAHGLLQSPNE**EPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILFPINDEKTNQSILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLSDNDKIKKLPNSICELHSLQTLSLGGCRELEELPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLNIE**************LHLRKLFVEGLPPLLELPQWLLQGSTKTLKNLIIRNCPNFMALPESLRNLEALETLAIGGCPALSERCKPQTGEDWPKIAHIPQVRIDDES**
QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGTMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILFPINDEKTNQSILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLSDNDKIKKLPNSICELHSLQTLSLGGCRELEELPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLNIEMEGEESHCDRNKTRLHLRKLFVEGLPPLLELPQWLLQGSTKTLKNLIIRNCPNFMALPESLRNLEALETLAIGGCPALSERCKPQTGEDWPKIAHIPQVRIDDESDN
QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGTMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILFPINDEKTNQSILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLSDNDKIKKLPNSICELHSLQTLSLGGCRELEELPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLNIEMEGEESHCDRNKTRLHLRKLFVEGLPPLLELPQWLLQGSTKTLKNLIIRNCPNFMALPESLRNLEALETLAIGGCPALSERCKPQTGEDWPKIAHIPQVRIDD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGTMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILFPINDEKTNQSILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLSDNDKIKKLPNSICELHSLQTLSLGGCRELEELPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLNIEMEGEESHCDRNKTRLHLRKLFVEGLPPLLELPQWLLQGSTKTLKNLIIRNCPNFMALPESLRNLEALETLAIGGCPALSERCKPQTGEDWPKIAHIPQVRIDDESDN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query557 2.2.26 [Sep-21-2011]
Q7XA42 979 Putative disease resistan N/A no 0.861 0.490 0.376 9e-80
Q7XA39 988 Putative disease resistan N/A no 0.727 0.409 0.412 2e-78
Q7XA40 992 Putative disease resistan N/A no 0.877 0.492 0.368 2e-77
Q7XBQ9 970 Disease resistance protei N/A no 0.684 0.392 0.422 8e-77
Q9LRR5 1424 Putative disease resistan yes no 0.827 0.323 0.351 9e-58
Q9LRR4 1054 Putative disease resistan no no 0.703 0.371 0.371 3e-57
Q39214 926 Disease resistance protei no no 0.649 0.390 0.307 7e-33
Q38834852 Disease resistance RPP13- no no 0.700 0.457 0.289 1e-32
Q9SX38857 Putative disease resistan no no 0.940 0.611 0.270 5e-31
Q9M667835 Disease resistance protei no no 0.669 0.446 0.302 1e-29
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function desciption
 Score =  298 bits (762), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 207/550 (37%), Positives = 283/550 (51%), Gaps = 70/550 (12%)

Query: 2   LQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGT 61
           LQ+ ++  LNGKRY  V+DDVWNED   W  L+++L  GA G+ +L TTR  KV SIMGT
Sbjct: 243 LQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGT 302

Query: 62  MRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSL 121
           ++    Y+L  L  E C  LFM+ AF   +  NPNL+ IG+EIVKK GG+PLA +TLG +
Sbjct: 303 LQP---YELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGI 359

Query: 122 LYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFD 181
           L    +E  WE+VRD+ IW L Q E+ ILPAL+LSY  LP  L+QCF YC++FPKD    
Sbjct: 360 LRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMA 419

Query: 182 SVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMH 241
              LI FWMAHG L S   N E E++G    NEL  RSFFQ+     +  G    +FKMH
Sbjct: 420 KENLIAFWMAHGFLLSKG-NLELEDVGNEVWNELYLRSFFQEIE---VESGKT--YFKMH 473

Query: 242 DLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILFP 301
           DL+HDLA                         S   ANTS ++   + ++       +  
Sbjct: 474 DLIHDLAT------------------------SLFSANTSSSNIREINANY---DGYMMS 506

Query: 302 INDEKTNQSILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLSDNDKIKKLPN 361
           I   +   S   S + K   LRV++L  + +  L   IG+L HLRYLDLS N +I+ LP 
Sbjct: 507 IGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPK 566

Query: 362 SICELHSLQTLSLGGCRELEELPKDIRYLVSLRMFMVSTKQKSLLESGIG---CLSSLRF 418
            +C+L +LQTL L  C  L  LPK    L SLR  ++     +     IG   CL SL  
Sbjct: 567 RLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKSLSC 626

Query: 419 LMISDCENLEYFSLETLML-------------KDCESLNLNLNI-----------EMEGE 454
            +I   +  +   L+ L L             KD ++   NL+            +++G+
Sbjct: 627 FVIGKRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGK 686

Query: 455 ESH----CDRNKTRLHLRKLFVEGLPPLLELPQWLLQGSTKTLKNLIIRNCPNFMALPE- 509
             +     +  K   +L+ L + G    + LP W+ Q   K + ++ IR C N   LP  
Sbjct: 687 HRYDSEVLEALKPHSNLKYLEINGFGG-IRLPDWMNQSVLKNVVSIRIRGCENCSCLPPF 745

Query: 510 -SLRNLEALE 518
             L  LE+LE
Sbjct: 746 GELPCLESLE 755
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q9SX38|DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana GN=At1g50180 PE=3 SV=2 Back     alignment and function description
>sp|Q9M667|RPP13_ARATH Disease resistance protein RPP13 OS=Arabidopsis thaliana GN=RPP13 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query557
255577491 860 leucine-rich repeat containing protein, 0.969 0.627 0.466 1e-141
224120592 836 nbs-lrr resistance protein [Populus tric 0.978 0.651 0.474 1e-140
359491491 845 PREDICTED: disease resistance protein RG 0.980 0.646 0.477 1e-138
225456045 851 PREDICTED: putative disease resistance p 0.974 0.638 0.465 1e-137
225441815 874 PREDICTED: putative disease resistance p 0.946 0.602 0.451 1e-135
225456043 848 PREDICTED: putative disease resistance p 0.978 0.642 0.472 1e-135
225456092 849 PREDICTED: putative disease resistance p 0.983 0.645 0.464 1e-134
225456041 853 PREDICTED: disease resistance protein RG 0.980 0.640 0.461 1e-133
356570440 861 PREDICTED: disease resistance protein RG 0.967 0.626 0.453 1e-131
356570458 857 PREDICTED: disease resistance protein RG 0.958 0.623 0.458 1e-130
>gi|255577491|ref|XP_002529624.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223530909|gb|EEF32769.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 282/605 (46%), Positives = 377/605 (62%), Gaps = 65/605 (10%)

Query: 1   QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMG 60
           QLQ++MR  ++ K+Y  V+DDVWN+D   W+ELK LL G A GSKI+VTTRS  VASI+G
Sbjct: 264 QLQRVMREQISEKKYFLVLDDVWNDDRTKWNELKELLRGCAYGSKIMVTTRSKVVASIVG 323

Query: 61  TMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHK-NPNLVKIGEEIVKKSGGIPLAVRTLG 119
           T      Y L GLP + CLSLF++CAF EGQ K  PNLVKIG EIVKK GG+PLAVRT+G
Sbjct: 324 T---APAYNLSGLPDDKCLSLFLRCAFNEGQEKLYPNLVKIGSEIVKKCGGVPLAVRTVG 380

Query: 120 SLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYD 179
           + L+  TDE  W  V++++IW+L+Q  NDILPAL++SY QLP +LKQCFA CS+FPKDY+
Sbjct: 381 TQLFLKTDEADWNLVKESDIWELDQNPNDILPALRISYQQLPSYLKQCFASCSVFPKDYE 440

Query: 180 FDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFK 239
           F+S+ LI+FWMAHGLLQSP++ + PE +G++YL EL SR FFQD  +         F FK
Sbjct: 441 FNSLKLIQFWMAHGLLQSPDQVQLPEYLGLKYLKELFSRCFFQDIEDCSF-----YFVFK 495

Query: 240 MHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTIL 299
           MHDL+HDLAQ VA+ E LI  S      KRV HL+F        D   L  DL   +TIL
Sbjct: 496 MHDLVHDLAQSVAQRESLIPKSGRHYSCKRVRHLTFFDPEVLSKDPRKLFHDLDHVQTIL 555

Query: 300 FPINDEKTNQSILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLSDNDKIKKL 359
                   ++S+   CIS  Q LRV+DL+ +  EVL R IG LKHLRYLDL++N KI++L
Sbjct: 556 IA----GVSKSLAQVCISGFQNLRVLDLAWSTFEVLPRSIGTLKHLRYLDLTNNVKIRRL 611

Query: 360 PNSICELHSLQTLSLGGCRELEELPKDIRYLVSLRMFMVSTKQKSLLESGIGCLSSLRFL 419
           P+SIC L SLQTL L GC ELE LP++++ ++SL    ++ K + L  + IGCL SLR L
Sbjct: 612 PSSICNLQSLQTLILSGCEELEGLPRNMKCMISLSFLWITAKLRFLPSNRIGCLQSLRTL 671

Query: 420 MISDCENLEYF----------SLETLMLKDCESL--------------NLNL----NIEM 451
            I  C NLE+           +L TL++  C +L              NL +    N+++
Sbjct: 672 GIGGCGNLEHLFDDMIGLNLIALRTLVVGGCRNLIYLPHDIKYLTALENLTIATCENLDL 731

Query: 452 EGEESHCDRNKTRLHLRKLFVEGLPPLLELPQWLLQGSTKTLKNLIIRNCPNFMALPESL 511
             + +  D       L+ L +  LP L+ LP+WLLQ S  +L+++ I  C N + LPE L
Sbjct: 732 LIDGNVVDNEHCGFKLKTLSLHELPLLVALPRWLLQWSACSLESIAIWRCHNLVMLPEWL 791

Query: 512 RNLEALETLAIGG------------------------CPALSERCKPQTGEDWPKIAHIP 547
           ++  +L+ L I G                        CPAL+E C P+TG+DWP+IAH+ 
Sbjct: 792 QDFISLQKLDILGCPGLSSLPIGLHRLTSLRKLTVEDCPALAESCNPETGKDWPQIAHVS 851

Query: 548 QVRID 552
           ++ +D
Sbjct: 852 EIYLD 856

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224120592|ref|XP_002318368.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222859041|gb|EEE96588.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359491491|ref|XP_003634282.1| PREDICTED: disease resistance protein RGA2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456045|ref|XP_002277526.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225441815|ref|XP_002277987.1| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456043|ref|XP_002277498.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456092|ref|XP_002278041.1| PREDICTED: putative disease resistance protein RGA4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456041|ref|XP_002277479.1| PREDICTED: disease resistance protein RGA2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356570440|ref|XP_003553395.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] Back     alignment and taxonomy information
>gi|356570458|ref|XP_003553404.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query557
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.718 0.280 0.365 1.9e-60
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.701 0.370 0.372 4.2e-60
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.820 0.253 0.312 3.4e-52
TAIR|locus:504956483847 AT3G46730 [Arabidopsis thalian 0.739 0.486 0.314 7.1e-39
TAIR|locus:2077572 926 RPM1 "RESISTANCE TO P. SYRINGA 0.789 0.475 0.288 2.1e-38
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.807 0.528 0.298 1.8e-34
TAIR|locus:2075170835 RPP13 "RECOGNITION OF PERONOSP 0.667 0.445 0.314 1.8e-32
TAIR|locus:2011982857 AT1G50180 [Arabidopsis thalian 0.780 0.507 0.293 2.3e-32
TAIR|locus:504956184 1017 AT1G58807 "AT1G58807" [Arabido 0.779 0.426 0.275 1.3e-31
TAIR|locus:2827038 1017 AT1G59124 "AT1G59124" [Arabido 0.779 0.426 0.275 1.3e-31
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 580 (209.2 bits), Expect = 1.9e-60, Sum P(2) = 1.9e-60
 Identities = 157/429 (36%), Positives = 220/429 (51%)

Query:     2 LQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGT 61
             LQ  ++  L+GKR+L V+DD W+E    W+  +       +GSKI++TTRS  V+++   
Sbjct:   261 LQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVSTVA-- 318

Query:    62 MRGTGGYKLEGLPYESCLSLFMKCAFKEGQ--HKNPNLVKIGEEIVKKSGGIPLAVRTLG 119
              +    Y+++ +  E C  L  + AF        N  L  IG+ I ++  G+PLA R + 
Sbjct:   319 -KAEKIYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGKRIAEQCKGLPLAARAIA 377

Query:   120 SLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPHLKQCFAYCSIFPKDYD 179
             S L    +   W  V  N         N ILP LKLSYD LPP LK+CFA CSIFPK + 
Sbjct:   378 SHLRSKPNPDDWYAVSKN----FSSYTNSILPVLKLSYDSLPPQLKRCFALCSIFPKGHV 433

Query:   180 FDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFK 239
             FD   L+  WMA  LL  P  +   E+IG  YL +L+++SFFQ     M         F 
Sbjct:   434 FDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDITMTS-------FV 486

Query:   240 MHDLMHDLAQLVAKGEFL--IVGSDCQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRART 297
             MHDLM+DLA+ V+ G+F   +   +   IP    H SF  +    +     +      RT
Sbjct:   487 MHDLMNDLAKAVS-GDFCFRLEDDNIPEIPSTTRHFSFSRSQCDASVAFRSICGAEFLRT 545

Query:   298 ILFPINDEKTNQS------ILTSCISKSQFLRVIDLSETAIEVLSREIGNLKHLRYLDLS 351
             IL P N   + +S      +L   ++    LR++ LS   I  L + +  LK LRYLDLS
Sbjct:   546 IL-PFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLS 604

Query:   352 DNDKIKKLPNSICELHSLQTLSLGGCRELEELPKDIRYLVSLRMF-MVSTKQKSLLESGI 410
                KIK+LP  +C L +LQTL L  CR+L  LPK I  L++LR+  +V T    +   GI
Sbjct:   605 ST-KIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVEM-PPGI 662

Query:   411 GCLSSLRFL 419
               L SL+ L
Sbjct:   663 KKLRSLQKL 671
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00120124
nbs-lrr resistance protein (836 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 6e-49
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  170 bits (433), Expect = 6e-49
 Identities = 72/202 (35%), Positives = 113/202 (55%), Gaps = 6/202 (2%)

Query: 1   QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMG 60
           +L   ++  L  KR+L V+DDVW +    WD++      G  GS+++VTTRS  VA  MG
Sbjct: 88  ELAVKIKEALLRKRFLLVLDDVWEK--NDWDKIGVPFPDGENGSRVIVTTRSESVAGRMG 145

Query: 61  TMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGS 120
               +  +++E L  E    LF    F++     P L ++ +EIV+K  G+PLA++ LG 
Sbjct: 146 G--TSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGG 203

Query: 121 LLYGSTDEHYWEYVRDNEIWKLEQKE--NDILPALKLSYDQLPPHLKQCFAYCSIFPKDY 178
           LL   +    WE+V +    +L  ++  N++L  L LSYD LP HLK+CF Y ++FP+DY
Sbjct: 204 LLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDY 263

Query: 179 DFDSVLLIRFWMAHGLLQSPNE 200
           +     LI+ W+A G +   + 
Sbjct: 264 NIRKEQLIKLWIAEGFVIPSDI 285

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 557
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.78
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.64
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.63
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.46
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.4
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.38
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.34
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.32
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.31
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.3
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.18
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.1
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.98
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.76
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.73
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.71
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.69
PLN03150623 hypothetical protein; Provisional 98.68
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.61
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.53
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.39
PRK15386 426 type III secretion protein GogB; Provisional 98.38
PLN03150623 hypothetical protein; Provisional 98.3
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.26
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.19
PRK15386 426 type III secretion protein GogB; Provisional 98.19
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.18
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.1
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.05
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.97
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.92
PRK04841 903 transcriptional regulator MalT; Provisional 97.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.77
KOG4341483 consensus F-box protein containing LRR [General fu 97.74
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.65
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.48
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.46
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.25
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.21
KOG4341483 consensus F-box protein containing LRR [General fu 96.91
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.41
PRK06893229 DNA replication initiation factor; Validated 96.37
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.21
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 96.13
PF05729166 NACHT: NACHT domain 96.06
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.81
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 95.7
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.28
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.25
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.19
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.93
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.75
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.54
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.43
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.43
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.4
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.38
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.23
COG3903414 Predicted ATPase [General function prediction only 92.03
PF13173128 AAA_14: AAA domain 91.74
PRK07471365 DNA polymerase III subunit delta'; Validated 91.65
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.12
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.06
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 90.51
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.06
PRK13342413 recombination factor protein RarA; Reviewed 89.71
PRK09087226 hypothetical protein; Validated 89.38
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 89.23
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 88.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 87.95
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 87.87
PRK05564313 DNA polymerase III subunit delta'; Validated 87.57
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 86.96
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.54
PRK08727233 hypothetical protein; Validated 86.35
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 85.92
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 85.31
PRK09112351 DNA polymerase III subunit delta'; Validated 84.66
PRK08084235 DNA replication initiation factor; Provisional 84.54
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 84.15
PRK12402337 replication factor C small subunit 2; Reviewed 84.04
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 83.8
COG3899 849 Predicted ATPase [General function prediction only 83.71
PRK07940394 DNA polymerase III subunit delta'; Validated 83.3
PRK05642234 DNA replication initiation factor; Validated 83.17
PRK06620214 hypothetical protein; Validated 83.05
smart0037026 LRR Leucine-rich repeats, outliers. 82.71
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.71
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 81.81
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 80.79
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 80.79
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=8.4e-61  Score=511.60  Aligned_cols=515  Identities=29%  Similarity=0.418  Sum_probs=387.5

Q ss_pred             HHHHHHHHcCCceEEEEEeCCCCCChhhHHHHHHhcCCCCCCcEEEEecCChHHHHH-hcCCCCCCcEEcCCCChhhhHH
Q 046626            2 LQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASI-MGTMRGTGGYKLEGLPYESCLS   80 (557)
Q Consensus         2 l~~~l~~~L~~kr~LlVlDdv~~~~~~~~~~l~~~~~~~~~gsrIivTtr~~~v~~~-~~~~~~~~~~~~~~L~~~~a~~   80 (557)
                      ++..|.+.|++|||+|||||||+.  ..|+.+..++|....||||++|||++.|+.. +++..   .++++.|..+|||+
T Consensus       250 ~~~~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~---~~~v~~L~~~eaW~  324 (889)
T KOG4658|consen  250 LASKLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDY---PIEVECLTPEEAWD  324 (889)
T ss_pred             HHHHHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCc---cccccccCccccHH
Confidence            567899999999999999999977  4599999999999889999999999999988 77755   89999999999999


Q ss_pred             HHHHHhccCCCCCChhHHHHHHHHHHHhCCChhHHHHHHHhhcCCCChHHHHHHHhhhccc----cccccCCchhhHhhc
Q 046626           81 LFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWK----LEQKENDILPALKLS  156 (557)
Q Consensus        81 Lf~~~a~~~~~~~~~~~~~l~~~i~~~c~glPlal~~ig~~L~~~~~~~~w~~l~~~~~~~----~~~~~~~i~~~L~~s  156 (557)
                      ||++.||......++.+.++|+++|++|+|+|||+.++|+.|+.+.+.++|+++.+...+.    .....+.++.+|+.|
T Consensus       325 LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklS  404 (889)
T KOG4658|consen  325 LFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLS  404 (889)
T ss_pred             HHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhcc
Confidence            9999999886666677999999999999999999999999999999999999988865443    222356889999999


Q ss_pred             ccCCChhhHHHhhhhccCCCCcccChHHHHHHHHHcCCccCCCCCCChHhHHHHHHHHHHhCCCceeccCCCCCCCccee
Q 046626          157 YDQLPPHLKQCFAYCSIFPKDYDFDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIF  236 (557)
Q Consensus       157 y~~L~~~~k~~fl~~a~fp~~~~~~~~~li~~w~~~g~i~~~~~~~~~~~~~~~~l~~Li~~~ll~~~~~~~~~~~~~~~  236 (557)
                      ||.|+++.|.||+|||.||+|++++++.++.+|+||||+....+...+++.|+.++.+|++++++......     +...
T Consensus       405 yd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~-----~~~~  479 (889)
T KOG4658|consen  405 YDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE-----GRKE  479 (889)
T ss_pred             HhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc-----ccee
Confidence            99999889999999999999999999999999999999998777888999999999999999999876532     4567


Q ss_pred             EEEEcHHHHHHHHHHhc-----CCeEEeccC-------CCCCCCceEEEEeecCCCCcccccccccCCCCCcEEEecCCC
Q 046626          237 FFKMHDLMHDLAQLVAK-----GEFLIVGSD-------CQSIPKRVCHLSFVGANTSRNDFSSLLSDLRRARTILFPIND  304 (557)
Q Consensus       237 ~~~~h~~i~~l~~~~~~-----~~~~~~~~~-------~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~  304 (557)
                      .|+|||++|++|.+++.     .+..++..+       ....+..++++++.++.....   ..-..++.+++|.+..+.
T Consensus       480 ~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~---~~~~~~~~L~tLll~~n~  556 (889)
T KOG4658|consen  480 TVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHI---AGSSENPKLRTLLLQRNS  556 (889)
T ss_pred             EEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhc---cCCCCCCccceEEEeecc
Confidence            99999999999999998     554444432       122335678888888776554   334456689999998654


Q ss_pred             ccchhHHHHHHhhcCCCcceEeeCCC-ChhhhccccCCCCccCeeeccCCcCccccchhhhcCCcCcEeecCCcCCCccc
Q 046626          305 EKTNQSILTSCISKSQFLRVIDLSET-AIEVLSREIGNLKHLRYLDLSDNDKIKKLPNSICELHSLQTLSLGGCRELEEL  383 (557)
Q Consensus       305 ~~~~~~~~~~~~~~~~~L~~L~l~~~-~~~~l~~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~L~l~~~~~~~~~  383 (557)
                      . ........+|..++.|++|||++| .+.++|.+++.|.+||||+++++. +..+|.++++|..|.+||+..+..+..+
T Consensus       557 ~-~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~  634 (889)
T KOG4658|consen  557 D-WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESI  634 (889)
T ss_pred             h-hhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCC-ccccchHHHHHHhhheeccccccccccc
Confidence            2 133455666889999999999965 466999999999999999999974 9999999999999999999998877777


Q ss_pred             cccccCCCCCcEEEccccccc---ccccCcCCCCCCCeecccccccccccccceEecccCCCccccCccccccccccccc
Q 046626          384 PKDIRYLVSLRMFMVSTKQKS---LLESGIGCLSSLRFLMISDCENLEYFSLETLMLKDCESLNLNLNIEMEGEESHCDR  460 (557)
Q Consensus       384 p~~~~~l~~L~~L~l~~~~~~---~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~l~~l~~l~l~~~~~~~~~~~~~~~  460 (557)
                      |..+..|++||+|.+......   ..-..+.+|.+|+.+....++.  .+-........+..................+.
T Consensus       635 ~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~--~~~e~l~~~~~L~~~~~~l~~~~~~~~~~~~~  712 (889)
T KOG4658|consen  635 PGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSV--LLLEDLLGMTRLRSLLQSLSIEGCSKRTLISS  712 (889)
T ss_pred             cchhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchh--HhHhhhhhhHHHHHHhHhhhhcccccceeecc
Confidence            777778999999998876532   1223345566666665544332  01011111111111110000000111222334


Q ss_pred             cCCCCCcceEEEeCCCCCCCCChhhc---cCC-CcccceEecccccccccCCccCCCCCCcceeeecCCCccccccCC
Q 046626          461 NKTRLHLRKLFVEGLPPLLELPQWLL---QGS-TKTLKNLIIRNCPNFMALPESLRNLEALETLAIGGCPALSERCKP  534 (557)
Q Consensus       461 ~~~~~~L~~L~l~~~~~l~~lp~~~~---~~~-l~~L~~L~L~~c~~~~~lp~~l~~l~~L~~L~l~~c~~l~~~~~~  534 (557)
                      ...+.+|+.|.+.+|........+..   ... ++++..+.+.+|.... .+.+....|+|+.|.+..|+.++.+...
T Consensus       713 ~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r-~l~~~~f~~~L~~l~l~~~~~~e~~i~~  789 (889)
T KOG4658|consen  713 LGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLR-DLTWLLFAPHLTSLSLVSCRLLEDIIPK  789 (889)
T ss_pred             cccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhcccccc-ccchhhccCcccEEEEecccccccCCCH
Confidence            46677888888888766432222210   011 4456666666665433 3444455677777777777666544433

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 1e-04
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-04
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 5e-04
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 107/246 (43%), Gaps = 50/246 (20%)
Query: 14  RYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVA-SIMGT-----MRGTGG 67
           R L ++DDVW+     W     +L       +IL+TTR   V  S+MG      +  + G
Sbjct: 237 RSLLILDDVWDS----W-----VLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLG 287
Query: 68  YKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLL--YGS 125
            K +GL     LSLF+         K  +L +    I+K+  G PL V  +G+LL  + +
Sbjct: 288 -KEKGL---EILSLFVNM-------KKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPN 336
Query: 126 TDEHYWEYVRDNEIWKLEQKEN----DILPALKLSYDQLPPHLKQCFAYCSIFPKDYDFD 181
             E+Y + +++ +  ++ +  +     +  A+ +S + L   +K  +   SI  KD    
Sbjct: 337 RWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVP 396
Query: 182 SVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEGFEIFFFKMH 241
           + +L   W          E EE E+I    L E +++S      NG      + F + +H
Sbjct: 397 TKVLCILW--------DMETEEVEDI----LQEFVNKSLLFCDRNG------KSFRYYLH 438
Query: 242 DLMHDL 247
           DL  D 
Sbjct: 439 DLQVDF 444
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-79
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-68
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-36
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 9e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 9e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  259 bits (664), Expect = 2e-79
 Identities = 69/389 (17%), Positives = 125/389 (32%), Gaps = 72/389 (18%)

Query: 1   QLQQIMRSCLNGK--RYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASI 58
           + +  +R  +  K  R L ++DDVW+    V               +IL+TTR   V   
Sbjct: 222 EAKDRLRILMLRKHPRSLLILDDVWDSW--VLKA-------FDSQCQILLTTRDKSVTDS 272

Query: 59  MGTMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTL 118
           +   +         L  E  L +           K  +L +    I+K+  G PL V  +
Sbjct: 273 VMGPKYVV-PVESSLGKEKGLEILSLFVN----MKKADLPEQAHSIIKECKGSPLVVSLI 327

Query: 119 GSLLYGSTDEH-YWEYVRDNEIWKLEQKE-----NDILPALKLSYDQLPPHLKQCFAYCS 172
           G+LL    +   Y+     N+ +K  +K        +  A+ +S + L   +K  +   S
Sbjct: 328 GALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLS 387

Query: 173 IFPKDYDFDSVLLIRFWMAHGLLQSPNENEEPENIGMRYLNELLSRSFFQDFSNGMLPEG 232
           I  KD    + +L   W          E EE E+     L E +++S      NG     
Sbjct: 388 ILQKDVKVPTKVLCILWDM--------ETEEVED----ILQEFVNKSLLFCDRNG----- 430

Query: 233 FEIFFFKMHDLMHDLAQLVAKGEFLIVGSDCQSIPKRVCHLSFVGANTSRND-------- 284
            + F + +HDL  D        +  +     + I +   +      +  + D        
Sbjct: 431 -KSFRYYLHDLQVDFLTEKNCSQ--LQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFL 487

Query: 285 ------------FSSLLSDLR------RARTILFPINDEKTNQSILTS--CISKSQFLRV 324
                         +L+  L               I++    + IL    C     F   
Sbjct: 488 AYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEF 547

Query: 325 IDLSETAIEVLSREIGNLKHLRYLDLSDN 353
           + L+   +        N+  L   +   +
Sbjct: 548 LSLNGHLLGRQP--FPNIVQLGLCEPETS 574
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query557
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.98
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.92
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.88
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.86
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.84
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.84
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.84
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.84
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.84
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.83
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.81
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.81
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.81
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.8
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.79
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.79
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.79
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.79
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.79
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.78
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.73
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.7
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.68
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.68
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.66
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.63
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.63
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.62
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.62
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.59
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.58
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.54
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.53
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.51
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.49
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.48
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.47
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.47
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.45
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.44
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.44
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.43
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.42
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.42
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.42
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.36
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.3
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.27
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.26
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.26
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.25
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.23
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.23
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.13
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.1
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.08
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.88
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.82
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.74
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.53
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.49
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.23
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.16
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.15
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.96
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.94
2fna_A357 Conserved hypothetical protein; structural genomic 97.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.84
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.77
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.68
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.65
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.54
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.43
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.27
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 96.77
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.65
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.48
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.43
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.16
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.53
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.48
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.01
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.38
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 93.02
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.63
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.19
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 91.94
2chq_A319 Replication factor C small subunit; DNA-binding pr 90.05
3bos_A242 Putative DNA replication factor; P-loop containing 87.69
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 85.59
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 82.23
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 81.76
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 80.24
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.98  E-value=1.6e-32  Score=288.28  Aligned_cols=226  Identities=17%  Similarity=0.280  Sum_probs=176.7

Q ss_pred             HHHHHHHHcCCc-eEEEEEeCCCCCChhhHHHHHHhcCCCCCCcEEEEecCChHHHHHhcCCCCCCcEEcCCCChhhhHH
Q 046626            2 LQQIMRSCLNGK-RYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGTMRGTGGYKLEGLPYESCLS   80 (557)
Q Consensus         2 l~~~l~~~L~~k-r~LlVlDdv~~~~~~~~~~l~~~~~~~~~gsrIivTtr~~~v~~~~~~~~~~~~~~~~~L~~~~a~~   80 (557)
                      +++.+++.|++| ||||||||||+.+...|..        .+|||||||||++.++..++..  ...|++++|+.++||+
T Consensus       231 l~~~l~~~L~~~kr~LlVLDdv~~~~~~~~~~--------~~gs~ilvTTR~~~v~~~~~~~--~~~~~l~~L~~~ea~~  300 (549)
T 2a5y_B          231 LKRMICNALIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRCLVTTRDVEISNAASQT--CEFIEVTSLEIDECYD  300 (549)
T ss_dssp             HHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH--------HTTCEEEEEESBGGGGGGCCSC--EEEEECCCCCHHHHHH
T ss_pred             HHHHHHHHHcCCCcEEEEEECCCCchhhcccc--------cCCCEEEEEcCCHHHHHHcCCC--CeEEECCCCCHHHHHH
Confidence            467899999996 9999999998753222332        1799999999999999876532  1379999999999999


Q ss_pred             HHHHHhccCCCCCChhHHHHHHHHHHHhCCChhHHHHHHHhhcCCCChHHHHHH--HhhhccccccccCCchhhHhhccc
Q 046626           81 LFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYV--RDNEIWKLEQKENDILPALKLSYD  158 (557)
Q Consensus        81 Lf~~~a~~~~~~~~~~~~~l~~~i~~~c~glPlal~~ig~~L~~~~~~~~w~~l--~~~~~~~~~~~~~~i~~~L~~sy~  158 (557)
                      ||.++||....  .+.+.+++++|+++|+|+||||+++|+.++.+ .   |+.+  .....+.  .....+...+.+||+
T Consensus       301 Lf~~~a~~~~~--~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~---w~~~~~l~~~l~~--~~~~~i~~~l~~Sy~  372 (549)
T 2a5y_B          301 FLEAYGMPMPV--GEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-T---FEKMAQLNNKLES--RGLVGVECITPYSYK  372 (549)
T ss_dssp             HHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-S---HHHHHHHHHHHHH--HCSSTTCCCSSSSSS
T ss_pred             HHHHHhcCCCC--chhHHHHHHHHHHHhCCChHHHHHHHHHhccc-h---HHHHHHhHHHhhc--ccHHHHHHHHhcccc
Confidence            99999986532  36788899999999999999999999999865 2   3333  2211111  135678899999999


Q ss_pred             CCChhhHHHhh-----------hhccCCCCcccChHHHHHHHHHc--CCccCCCCCCChHhHHHHHHHHHHhCCCceecc
Q 046626          159 QLPPHLKQCFA-----------YCSIFPKDYDFDSVLLIRFWMAH--GLLQSPNENEEPENIGMRYLNELLSRSFFQDFS  225 (557)
Q Consensus       159 ~L~~~~k~~fl-----------~~a~fp~~~~~~~~~li~~w~~~--g~i~~~~~~~~~~~~~~~~l~~Li~~~ll~~~~  225 (557)
                      .|++..|.||+           |||+||+++.++    ++.|+++  ||+.........++.+. ++++|+++++++...
T Consensus       373 ~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~  447 (549)
T 2a5y_B          373 SLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGK  447 (549)
T ss_dssp             SHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEE
T ss_pred             cccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEec
Confidence            99999999999           999999999988    7999999  99987654556777777 999999999998764


Q ss_pred             CCCCCCCcceeEEEEcHHHHHHHHHHhcCCe
Q 046626          226 NGMLPEGFEIFFFKMHDLMHDLAQLVAKGEF  256 (557)
Q Consensus       226 ~~~~~~~~~~~~~~~h~~i~~l~~~~~~~~~  256 (557)
                      .+      ....|+|||+++++|+.++..++
T Consensus       448 ~~------~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          448 RM------PVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             CS------SSCEEECCHHHHHHHHTTSCTHH
T ss_pred             CC------CceEEEeChHHHHHHHHHHHHHH
Confidence            32      34589999999999998887764
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 557
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-28
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  112 bits (281), Expect = 2e-28
 Identities = 29/171 (16%), Positives = 55/171 (32%), Gaps = 18/171 (10%)

Query: 1   QLQQIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMG 60
             + I  + ++    LFV DDV  E+        ++ W      + LVTTR  ++++   
Sbjct: 123 LKRMICNALIDRPNTLFVFDDVVQEE--------TIRWAQELRLRCLVTTRDVEISNAA- 173

Query: 61  TMRGTGGYKLEGLPYESCLSLFMKCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGS 120
             +     ++  L  + C                     +  + ++ S G P  +     
Sbjct: 174 -SQTCEFIEVTSLEIDECYDFLEAYGMP--MPVGEKEEDVLNKTIELSSGNPATLMMFFK 230

Query: 121 LLYGSTDEHYWEYVRDNEIWKLEQKE-NDILPALKLSYDQLPPHLKQCFAY 170
                T E   +        KLE +    +      SY  L   L++C   
Sbjct: 231 SCEPKTFEKMAQLN-----NKLESRGLVGVECITPYSYKSLAMALQRCVEV 276
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query557
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.67
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.62
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.54
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.52
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.47
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.45
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.4
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.35
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.33
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.26
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.22
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.19
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.18
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.02
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.92
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.88
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.8
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.62
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.53
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.84
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.84
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.27
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.55
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.59
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.1
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 88.96
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.88  E-value=1.2e-23  Score=197.98  Aligned_cols=151  Identities=15%  Similarity=0.150  Sum_probs=119.3

Q ss_pred             HHHHHHcCCceEEEEEeCCCCCChhhHHHHHHhcCCCCCCcEEEEecCChHHHHHhcCCCCCCcEEcCCCChhhhHHHHH
Q 046626            4 QIMRSCLNGKRYLFVMDDVWNEDPKVWDELKSLLWGGAKGSKILVTTRSNKVASIMGTMRGTGGYKLEGLPYESCLSLFM   83 (557)
Q Consensus         4 ~~l~~~L~~kr~LlVlDdv~~~~~~~~~~l~~~~~~~~~gsrIivTtr~~~v~~~~~~~~~~~~~~~~~L~~~~a~~Lf~   83 (557)
                      ..+++.+.+||+|+||||||+.  ..|..+.      ..|||||||||+++++..+...  ...|++++|+.+|||+||+
T Consensus       126 ~~~~~~L~~kr~LlVLDDv~~~--~~~~~~~------~~~srilvTTR~~~v~~~~~~~--~~~~~l~~L~~~ea~~Lf~  195 (277)
T d2a5yb3         126 MICNALIDRPNTLFVFDDVVQE--ETIRWAQ------ELRLRCLVTTRDVEISNAASQT--CEFIEVTSLEIDECYDFLE  195 (277)
T ss_dssp             HHHHHHTTSTTEEEEEEEECCH--HHHHHHH------HTTCEEEEEESBGGGGGGCCSC--EEEEECCCCCHHHHHHHHH
T ss_pred             HHHHHHhccCCeeEecchhhHH--hhhhhhc------ccCceEEEEeehHHHHHhcCCC--CceEECCCCCHHHHHHHHH
Confidence            3577888999999999999865  3444332      2489999999999999876543  1379999999999999999


Q ss_pred             HHhccCCCCCChhHHHHHHHHHHHhCCChhHHHHHHHhhcCCCChHHHHHHHhhhccccccccCCchhhHhhcccCCChh
Q 046626           84 KCAFKEGQHKNPNLVKIGEEIVKKSGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKENDILPALKLSYDQLPPH  163 (557)
Q Consensus        84 ~~a~~~~~~~~~~~~~l~~~i~~~c~glPlal~~ig~~L~~~~~~~~w~~l~~~~~~~~~~~~~~i~~~L~~sy~~L~~~  163 (557)
                      .++|.....  +..++++++|+++|+|+||||+++|+.|+.+ +.+.|.++.+...   ......+..++..||+.||.+
T Consensus       196 ~~~~~~~~~--~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~~~~~~~~~L~---~~~~~~v~~il~~sY~~L~~~  269 (277)
T d2a5yb3         196 AYGMPMPVG--EKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLE---SRGLVGVECITPYSYKSLAMA  269 (277)
T ss_dssp             HTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHHHHHHHHH---HHCSSTTCCCSSSSSSSHHHH
T ss_pred             HHhCCccCc--hhhHHHHHHHHHHhCCCHHHHHHHHHHhccC-CHHHHHHHHHHHh---cCcHHHHHHHHHHHHhcccHH
Confidence            999865433  4668899999999999999999999999865 4555655544321   123477899999999999999


Q ss_pred             hHHHhhh
Q 046626          164 LKQCFAY  170 (557)
Q Consensus       164 ~k~~fl~  170 (557)
                      .|.||-+
T Consensus       270 lk~c~~~  276 (277)
T d2a5yb3         270 LQRCVEV  276 (277)
T ss_dssp             HHHHHHT
T ss_pred             HHHHHHh
Confidence            9999965
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure