Citrus Sinensis ID: 046764

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110---
MAPNLTTTSTLINAVPFENNPENQFISNLYSPEMIYEFLGLYQRRRLMGERCEELQEFMKLVSEFEQKYEISFSLLVKLKQAVLCRSHSLCVQNSIPGVNPFVFMDLVDMIRQAEILRNIQSWENQNLTPSTVLQVSGENRNGNQTRAPNKSMKLGKTFFPLTAQAGLSVLTSVFDAGGFSSTDEAKQLLQVAALSNVVGYIGCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDDAEEKQKREQSVKMWLGELQNLAYDVDVLLDEFETEATDSRFEEILTQKDQLELKEKSLGKSRKDRQRLPAVHLQWAVWARLHLLSLSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSVRDYPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPRFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPTTVSHGGDLKHLRHLDLSETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLDNFDFCCWKDIDSALQELKLLHLHGALEISKLENVRDASEAGEAQLNGKKNLKTLLLQRTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGETLRFENMQEREDWIPYSSSQEVEFYGNGCLIPFPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPKHLPSLQKLVIQRCEKLLVDLPSLPSLNELKLGGCKKGGLQKGQPIIGRRIHYGCADTSSSLRVCLQCCNSLTNNARVQLPLSLKDLSIAFCDNLRTLVEEEGIPKGSRKYSSHLECLHILSCPSPTSIFSENELPATLQRLEVNSCSKLALLTLSGNLPQGPKYLELTSCSKWESIADNNTSLQVITVFRCKNLKTLPDGLHKLNNLQAFTICKNLVSFPKGGLPSTQLRDPDITGCQKLEALPDGDLSSTFKTGKSSKCGIFPGGWLSHRSCFP
cccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccEEEEcccccccccccccccccEEEEEEccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHccccccEEEEEcccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccccEEEEccccHHHHHHcccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEEcccccccccccccccccEEEEccccccccccHHHHHcccccccccEEEEEEcccccccccccHHHHHHccccccccccEEEEEEcccccccccccccccccccccccEEEEEccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccEEEEcccccccccccccccccHHcccccccccccHHcccccccccccccccccccccEEEEEEccccccccccccccccccccccccccEEEccccccccccccccccccccEEEEcccccccccccccccccccccEEEcccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccc
ccccccccHHHEcccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccHHHHHHcccHHHHHEccccccHHHHHHHHHHHHHHccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccEEcccHHHHHHHHHHHccccccccEEEEEEEccccccHHHHHHHHHccHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHcccHHHcccccHHHHHHHHHHccccHHHHccccccEEEEcccccccccccccccccccEEEEEcccHHHHHccccccccccccEEEEcccccccccccccHHHcccccccccEEccccccccHHHHHHHcccccccccEEEEccccccccccccccHHHHHHcccccccccEEEEEccccccccccHccccccccccccccccccccccccccccccEEEEcccccHHHcccccccccccccccccEEEEcccHHHHHccccccccccEEEEcccccccccccccccccEEEEEcccccEccccccHHHHcccccccccccccEEEEcccccccccccccccccccEEEEEcccccccccHHcccccccccccccccEEEEccccccccccccccccccccEEEEcccHHHccccccccccccccEEEEcccccccccccccccccEEEEccccccccccccccccccccEEEEcccHccccccccccccccEEEEcccccHHHcccccccccccEEEEcccHHHHccccccccccc
mapnltttstlinavpfennpenqfisnlyspEMIYEFLGLYQRRRLMGERCEELQEFMKLVSEFEQKYEISFSLLVKLKQAVLCrshslcvqnsipgvnpfvFMDLVDMIRQAEILRNIQSwenqnltpstvlqvsgenrngnqtrapnksmklgktffpltaqaGLSVLTSvfdaggfsstdEAKQLLQVAALSNVVGYIGCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDDAEEKQKREQSVKMWLGELQNLAYDVDVLLDEFETEATDSRFEEILTQKDQLELKEKSLgksrkdrqrlpavHLQWAVWARLHLLSLSIMMPNIIRFIAtadqpvngtdELGLLQEKLKNQMSGKKFLLVLGDVwnenysdwdslslpfeagapgsqiiVTTRNRDVAAIMgsvrdyplkestkddcLQVFTQHClgmrdfsmqqsLKDISKKIVIRCNGLPLAAKTLAGLlrgkndprfsacsiarygiyqknyefheeEEVTLLWmaegfpyhidtKEEIQDLGHKFFHelysrssfqqsssdpcRFLMHDLINDLAQWagdldgikmfepffefenlqtflpttvshggdlkhlrhldlsetdiqILPESVNTLYNLRMLMLQKCNQLEKMCSDmgnllklhhldnfdfccWKDIDSALQELKLLHLHGaleisklenvrdaseagEAQLNGKKNLKTLLLQRtsnngdsrepeiETHVLDMLKPHQNLERFCISGYgetlrfenmqeredwipysssqevefygngclipfpsletlrfenmqeredwipysssqevevfpnlrDLFLLRCSKLlgtlpkhlpSLQKLVIQRCEKLLvdlpslpslnelklggckkgglqkgqpiigrrihygcadtsssLRVCLQCCNSltnnarvqlplslkdlSIAFCDNLRTLVeeegipkgsrkysshleclhilscpsptsifsenelpatLQRLEVNSCSKLALLTlsgnlpqgpkyleltscSKWESIADNNTSLQVITVFRCknlktlpdglhklnNLQAFticknlvsfpkgglpstqlrdpditgcqklealpdgdlsstfktgksskcgifpggwlshrscfp
mapnltttstlinavpfennpeNQFISNLYSPEMIYEFLGLYQRRRLMGERCEELQEFMKLVSEFEQKYEISFSLLVKLKQAVLCRSHSLcvqnsipgvNPFVFMDLVDMIRQAEILRNIQSWENQNLTPStvlqvsgenrngnqtrapnksmKLGKTFFPLTAQAGLSVLTSVFDAGGFSSTDEAKQLLQVAALSNVVGYIGCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDDAEEKQKREQSVKMWLGELQNLAYDVDVLLDEFETEAtdsrfeeiltqkdqlelkekslgksrkdrqrlpaVHLQWAVWARLHLLSLSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSVrdyplkestkdDCLQVFTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPRFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPTTVSHGGDLKHLRHLDLSETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLDNFDFCCWKDIDSALQELKLLHLHGALEISKLENVRDASEAGeaqlngkknlktlLLQRtsnngdsrepEIETHVLDMLKPHQNLERFCISGYGETLRFENMQEREDWIPYSSSQEVEFYGNGCLIPFPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPKHLPSLQKLVIQRCEKLLVDLPSLPSLNELKLGGCKKGGLQKGQPIIGRRIHYGCADTSSSLRVCLQCCNSLTNNARVQLPLSLKDLSIAFCDNLRTLVEEEGIPKGSRKYSSHLECLHILSCPSPTSIFSENELPATLQRLEVNSCSKLALLTLsgnlpqgpKYLELTSCSKWESIADNNTSLQVITVFRCKNLKTLPDGLHKLNNLQAFTICKNLVSFPKGGLPSTQLRDPDITGCQKLEALPDgdlsstfktgksskcgifpggwlshrscfp
MAPNLTTTSTLINAVPFENNPENQFISNLYSPEMIYEFLGLYQRRRLMGERCEELQEFMKLVSEFEQKYEISFSLLVKLKQAVLCRSHSLCVQNSIPGVNPFVFMDLVDMIRQAEILRNIQSWENQNLTPSTVLQVSGENRNGNQTRAPNKSMKLGKTFFPLTAQAGLSVLTSVFDAGGFSSTDEAKQLLQVAALSNVVGYIGCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDDAEEKQKREQSVKMWLGELQNLAYDVDVLLDEFETEATDSRFEEILTQKDQLELKEKSLGKSRKDRQRLPAVHLQWAVWARLHLLSLSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSVRDYPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPRFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELYsrssfqqsssDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPTTVSHGGDLKHLRHLDLSETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLDNFDFCCWKDIDSALQELKLLHLHGALEISKLENVRDASEAGEAQlngkknlktlllQRTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGETLRFENMQEREDWIPYSSSQEVEFYGNGCLIPFPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPKHLPSLQKLVIQRCEKLLVDLPSLPSLNElklggckkgglqkgqPIIGRRIHYGCADTSSSLRVCLQCCNSLTNNARVQLPLSLKDLSIAFCDNLRTLVEEEGIPKGSRKYSSHLECLHILSCPSPTSIFSENELPATLQRLEVNSCSKLALLTLSGNLPQGPKYLELTSCSKWESIADNNTSLQVITVFRCKNLKTLPDGLHKLNNLQAFTICKNLVSFPKGGLPSTQLRDPDITGCQKLEALPDGDLSSTFKTGKSSKCGIFPGGWLSHRSCFP
**********LINAVPFENNPENQFISNLYSPEMIYEFLGLYQRRRLMGERCEELQEFMKLVSEFEQKYEISFSLLVKLKQAVLCRSHSLCVQNSIPGVNPFVFMDLVDMIRQAEILRNIQSWENQNL***************************GKTFFPLTAQAGLSVLTSVFDAGGFSSTDEAKQLLQVAALSNVVGYIGCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDD**********VKMWLGELQNLAYDVDVLLDEFETE********************************LPAVHLQWAVWARLHLLSLSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSVRDYPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPRFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELYSR*********PCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPTTVSHGGDLKHLRHLDLSETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLDNFDFCCWKDIDSALQELKLLHLHGALEISKL*****************************************HVLDMLKPHQNLERFCISGYGETLRFENMQEREDWIPYSSSQEVEFYGNGCLIPFPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPKHLPSLQKLVIQRCEKLLVDLPSLPSLNELKLGGCKKGGLQKGQPIIGRRIHYGCADTSSSLRVCLQCCNSLTNNARVQLPLSLKDLSIAFCDNLRTLVEEEGIPKGSRKYSSHLECLHILSCPSPTSIFSENELPATLQRLEVNSCSKLALLTLSGNLPQGPKYLELTSCSKWESIADNNTSLQVITVFRCKNLKTLPDGLHKLNNLQAFTICKNLVSFPKGGL************C*********************KCGIFPGGWLS******
*****TTTSTLINAVPFENNPENQFISNLYSPEMIYEFLGLYQRRRLMGERCEELQEFMKLVSEFEQKYEISFSLLVKLKQAVLCRSHSLCVQNSIPGVNPFVFMDLVDMIRQAEILRNIQSWENQNLTPST**********************LGKTFFPLTAQAGLSVLTSVFDAGGFSSTDEAKQLLQVAALSNVVGYIGCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDDAEEKQKREQSVKMWLGELQNLAYDVDVLLDEFETEATDSRFEEILTQKDQLELKEKSLGKSRKDRQRLPAVHLQWAVWARLHLLSLSIMMPNIIRFIATADQ**N**DELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSVRDYPLKESTKDDCLQVFTQHCLG********SLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPRFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPY******EIQDLGHKFFHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPTTVSHGGDLKHLRHLDLSETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLDNFDFCCWKDI******LKLLHLHGALEISKLENVRDASEAGEAQLNGKKNLKTLLLQRTSNN***********VLDMLKPHQNLERFCISGYGETLRFENMQEREDWIPYSSSQEVEFYGNGCLIPFPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPKHLPSLQKLVIQRCEKLLVDLPSLPSLNELKLGGCKKGGLQKGQPIIGRRIHYGCADTSSSLRVCLQCCNSLTNNARVQLPLSLKDLSIAFCDNLRTLVEEEGIPKGSRKYSSHLECLHILSCPSPTSIFSENELPATLQRLEVNSCSKLALLTLSGNLPQGPKYLELTSCSKWESIADNNTSLQVITVFRCKNLKTLPDGLHKLNNLQAFTICKNLVSFPKGGLPSTQLRDPDITGCQKLEALPDGDLSSTFKTGKSSKCGIFPGGWLSHR**F*
MAPNLTTTSTLINAVPFENNPENQFISNLYSPEMIYEFLGLYQRRRLMGERCEELQEFMKLVSEFEQKYEISFSLLVKLKQAVLCRSHSLCVQNSIPGVNPFVFMDLVDMIRQAEILRNIQSWENQNLTPSTVLQVSGENRNGNQTRAPNKSMKLGKTFFPLTAQAGLSVLTSVFDAGGFSSTDEAKQLLQVAALSNVVGYIGCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDDA********SVKMWLGELQNLAYDVDVLLDEFETEATDSRFEEILTQKDQLELKEKSLGKSRKDRQRLPAVHLQWAVWARLHLLSLSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSVRDYPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPRFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELYSR********DPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPTTVSHGGDLKHLRHLDLSETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLDNFDFCCWKDIDSALQELKLLHLHGALEISKLEN*********AQLNGKKNLKTLLLQRTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGETLRFENMQEREDWIPYSSSQEVEFYGNGCLIPFPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPKHLPSLQKLVIQRCEKLLVDLPSLPSLNELKLGGCKKGGLQKGQPIIGRRIHYGCADTSSSLRVCLQCCNSLTNNARVQLPLSLKDLSIAFCDNLRTLVEEEGIPKGSRKYSSHLECLHILSCPSPTSIFSENELPATLQRLEVNSCSKLALLTLSGNLPQGPKYLELTSCSKWESIADNNTSLQVITVFRCKNLKTLPDGLHKLNNLQAFTICKNLVSFPKGGLPSTQLRDPDITGCQKLEALPDGDLSSTFKTGKSSKCGIFPGGWLSHRSCFP
****LTTTSTLINAVPFENNPENQFISNLYSPEMIYEFLGLYQRRRLMGERCEELQEFMKLVSEFEQKYEISFSLLVKLKQAVLCRSHSLCVQNSIPGVNPFVFMDLVDMIRQAEILRNIQSWENQNLTPSTVLQVSG***************KLGKTFFPLTAQAGLSVLTSVFDAGGFSSTDEAKQLLQVAALSNVVGYIGCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDDA*******QSVKMWLGELQNLAYDVDVLLDEFETEATDSRFEEILTQKDQLELKEKSLGKSRKDRQRLPAVHLQWAVWARLHLLSLSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSVRDYPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPRFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPTTVSHGGDLKHLRHLDLSETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLDNFDFCCWKDIDSALQELKLLHLHGALEISKLENVRDASEAGEAQLNGKKNLKTLLLQRTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGETLRFENMQEREDWIPYSSSQEVEFYGNGCLIPFPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPKHLPSLQKLVIQRCEKLLVDLPSLPSLNELKLGGCKKGGLQKGQPIIGRRIHYGCADTSSSLRVCLQCCNSLTNNARVQLPLSLKDLSIAFCDNLRTLVEEEGIPKGSRKYSSHLECLHILSCPSPTSIFSENELPATLQRLEVNSCSKLALLTLSGNLPQGPKYLELTSCSKWESIADNNTSLQVITVFRCKNLKTLPDGLHKLNNLQAFTICKNLVSFPKGGLPSTQLRDPDITGCQKLEALPDGDLSSTFKTGKSSKCGIFPGG*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPNLTTTSTLINAVPFENNPENQFISNLYSPEMIYEFLGLYQRRRLMGERCEELQEFMKLVSEFEQKYEISFSLLVKLKQAVLCRSHSLCVQNSIPGVNPFVFMDLVDMIRQAEILRNIQSWENQNLTPSTVLQVSGENRNGNQTRAPNKSMKLGKTFFPLTAQAGLSVLTSVFDAGGFSSTDEAKQLLQVAALSNVVGYIGCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDDAEEKQKREQSVKMWLGELQNLAYDVDVLLDEFETEATDSRFEEILTQKDQLELKEKSLGKSRKDRQRLPAVHLQWAVWARLHLLSLSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSVRDYPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPRFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPTTVSHGGDLKHLRHLDLSETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLDNFDFCCWKDIDSALQELKLLHLHGALEISKLENVRDASEAGEAQLNGKKNLKTLLLQRTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGETLRFENMQEREDWIPYSSSQEVEFYGNGCLIPFPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPKHLPSLQKLVIQRCEKLLVDLPSLPSLNELKLGGCKKGGLQKGQPIIGRRIHYGCADTSSSLRVCLQCCNSLTNNARVQLPLSLKDLSIAFCDNLRTLVEEEGIPKGSRKYSSHLECLHILSCPSPTSIFSENELPATLQRLEVNSCSKLALLTLSGNLPQGPKYLELTSCSKWESIADNNTSLQVITVFRCKNLKTLPDGLHKLNNLQAFTICKNLVSFPKGGLPSTQLRDPDITGCQKLEALPDGDLSSTFKTGKSSKCGIFPGGWLSHRSCFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1113 2.2.26 [Sep-21-2011]
Q9LRR41054 Putative disease resistan yes no 0.514 0.543 0.282 1e-68
Q9LRR5 1424 Putative disease resistan no no 0.431 0.337 0.280 4e-48
Q7XA42979 Putative disease resistan N/A no 0.546 0.621 0.284 1e-47
Q7XA39988 Putative disease resistan N/A no 0.553 0.623 0.278 1e-46
Q7XA40992 Putative disease resistan N/A no 0.535 0.600 0.288 4e-46
Q7XBQ9970 Disease resistance protei N/A no 0.547 0.627 0.264 4e-46
Q38834852 Disease resistance RPP13- no no 0.127 0.166 0.32 2e-12
O81825919 Probable disease resistan no no 0.245 0.297 0.254 6e-12
Q9SX38857 Putative disease resistan no no 0.257 0.334 0.260 7e-12
Q39214926 Disease resistance protei no no 0.257 0.309 0.237 2e-11
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  262 bits (670), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 218/771 (28%), Positives = 358/771 (46%), Gaps = 198/771 (25%)

Query: 351 FIATADQPVNGTDELGLLQEKLKNQMSGK--KFLLVLGDVWNENYSDWDSLSLPFEAGAP 408
           + +   +P   TD L +LQ KLK +++G    FLLVL D+WNEN++DWD L  PF   A 
Sbjct: 248 YESVTSRPCEFTD-LDVLQVKLKERLTGTGLPFLLVLDDLWNENFADWDLLRQPFIHAAQ 306

Query: 409 GSQIIVTTRNRDVAAIMGSVRDYPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDISKKI 468
           GSQI+VTTR++ VA+IM +V  + L+  +  DC  +F +   G ++  + + + D++++I
Sbjct: 307 GSQILVTTRSQRVASIMCAVHVHNLQPLSDGDCWSLFMKTVFGNQEPCLNREIGDLAERI 366

Query: 469 VIRCNGLPLAAKTLAGLLRGKND---------------------------------PRFS 495
           V +C GLPLA KTL G+LR +                                   P   
Sbjct: 367 VHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHL 426

Query: 496 ACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELYSRSSFQQ 555
               A   I+ K + F E+++V LLWMAEGF     + + +++LG+++F EL SRS  Q+
Sbjct: 427 KRCFAYCSIFPKGHAF-EKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQK 485

Query: 556 SSSDPCRFLMHDLINDLAQWA-GDL-----DGIKM---------------------FEPF 588
           + +   R++MHD IN+LAQ+A G+      DG K+                     FE  
Sbjct: 486 TKT---RYIMHDFINELAQFASGEFSSKFEDGCKLQVSERTRYLSYLRDNYAEPMEFEAL 542

Query: 589 FEFENLQTFLPTTVSHGG---------------------------------------DLK 609
            E + L+TFLP ++++                                         ++ 
Sbjct: 543 REVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNIS 602

Query: 610 HLRHLDLSETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLDNF----- 664
           H R LDLS T+++ LP+S+  +YNL+ L+L  C+ L+++ +D+ NL+ L +LD       
Sbjct: 603 HARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTKLR 662

Query: 665 ----------------DFCCWKDIDSALQELKLLH-LHGALEISKLENVRDASEAGEAQL 707
                            F       S + EL  LH LHG L+I +L+ V D ++A EA L
Sbjct: 663 QMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEANL 722

Query: 708 NGKKNLKTL-LLQRTS-----NNGDSREPEIETHVLDMLKPHQNLERFCISGYGETLRFE 761
           N KK+L+ +  + RT      NN +    + E  V + L+PH+++E+  I  Y +  RF 
Sbjct: 723 NSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERY-KGRRF- 780

Query: 762 NMQEREDWIPYSSSQEV------------------------EFYGNGCL----------- 786
                 DW+   S   +                        E + +G +           
Sbjct: 781 -----PDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYF 835

Query: 787 ----------IPFPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTL 836
                      PF SLETLRF+N+ + ++W+    ++  ++FP+L+ LF+LRC +L GTL
Sbjct: 836 SDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRG-DLFPSLKKLFILRCPELTGTL 894

Query: 837 PKHLPSLQKLVIQRCEKLLVDLPSLPSLNELKLGGCKKGGLQKGQPIIGRRIHYGCADTS 896
           P  LPSL  L I +C   L+D    P  +E      +   ++     +   + +     +
Sbjct: 895 PTFLPSLISLHIYKCG--LLDFQ--PDHHEYSYRNLQTLSIKSSCDTL---VKFPLNHFA 947

Query: 897 SSLRVCLQCCNSLT----NNARVQLPLSLKDLSIAFCDNLRTLVEEEGIPK 943
           +  ++ +  C SL     +N  ++ P +L++L I  C NL+ L +   +P+
Sbjct: 948 NLDKLEVDQCTSLYSLELSNEHLRGPNALRNLRINDCQNLQLLPKLNALPQ 998
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q9SX38|DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana GN=At1g50180 PE=3 SV=2 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1113
356554923 1399 PREDICTED: putative disease resistance R 0.635 0.505 0.318 1e-107
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.672 0.525 0.319 1e-107
225465831 1483 PREDICTED: putative disease resistance R 0.631 0.474 0.327 1e-102
359487257 1330 PREDICTED: putative disease resistance p 0.626 0.524 0.344 1e-101
225449649 1418 PREDICTED: putative disease resistance p 0.625 0.490 0.333 1e-101
359487172 1310 PREDICTED: putative disease resistance R 0.645 0.548 0.317 1e-101
147860511 1406 hypothetical protein VITISV_014536 [Viti 0.654 0.518 0.316 1e-100
147766792 2277 hypothetical protein VITISV_039904 [Viti 0.645 0.315 0.317 1e-100
359495024 1390 PREDICTED: putative disease resistance p 0.654 0.524 0.316 1e-100
359495026 2204 PREDICTED: uncharacterized protein LOC10 0.654 0.330 0.316 1e-99
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  398 bits (1022), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 314/986 (31%), Positives = 462/986 (46%), Gaps = 279/986 (28%)

Query: 363  DELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVA 422
            + L  LQ KL+  +SGKKFL+VL DVWN+NY++W  L  PF   A GS +IVTTR+ +VA
Sbjct: 255  NNLHQLQVKLRAVLSGKKFLIVLDDVWNKNYNEWIKLVAPFRGAARGSSVIVTTRSAEVA 314

Query: 423  AIMGSVRDYPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDIS-----KKIVIRCNGLPL 477
             +MG+V  + + + +  DC  VF QH    +     Q+  +I      KKI  +C G PL
Sbjct: 315  NMMGTVESHHVNQLSDKDCWSVFVQHAFRSKTIDANQAFAEIGNFLIGKKIAEKCKGSPL 374

Query: 478  AAKTLAGLLRGKNDPR--------------------------------------FSACSI 499
             A T  G+L  + D R                                      F+ CSI
Sbjct: 375  MATTFGGILSSQKDARDWENVMDFEIWDLAEEESNILQTLRLSYNQLPSYLKRCFAYCSI 434

Query: 500  ARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELYSRSSFQQSSSD 559
                   K +EF EE+E+ LLWMAEG      ++++++D+GH++F EL S S FQ+SSS+
Sbjct: 435  -----LPKGFEF-EEKEIVLLWMAEGL-LEQKSQKQMEDVGHEYFQELLSASLFQKSSSN 487

Query: 560  PCRFLMHDLINDLAQWA---------------------------------GDLDGIKMFE 586
               ++MHDLINDLAQW                                  G+ DGI+MF+
Sbjct: 488  RSLYVMHDLINDLAQWVAGESCFKLDNNFQSHKQKKKKISKMTRYASYVGGEYDGIQMFQ 547

Query: 587  PFFEFENLQTFLP----------TTVSHGG-----DLKHLRHLDLS-------------- 617
             F E ++L+TFLP             +H       +L+ LR L LS              
Sbjct: 548  AFKEAKSLRTFLPLKHRRLEEWSYITNHVPFELLPELRCLRALSLSGYFISKLPNSVSNL 607

Query: 618  ---------ETDIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHLD------ 662
                      TD++ LPES+ +L NL+ L+L+ C  LE++ S+M +L+ L HLD      
Sbjct: 608  NLLRYLNLSSTDLRQLPESICSLCNLQTLLLRDCFNLEELPSNMSDLINLRHLDITRSHS 667

Query: 663  ------------------NFDFCCWKDIDSALQEL-KLLHLHGALEISKLENVRDASEAG 703
                              NF         S + EL KL ++ G L +S+LE+V D  EA 
Sbjct: 668  LTRMPHGIGKLTHLQTLSNFVVG-----SSGIGELMKLSNIRGVLSVSRLEHVTDTREAS 722

Query: 704  EAQLNGKKNLKTLLLQRTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGET------ 757
            EA +N K  +  L L+ TS   +    E    VL ML+PH+NL +  I  YG T      
Sbjct: 723  EAMINKKVGIDVLKLKWTSCMNNQSHTERAKEVLQMLQPHKNLAKLTIKCYGGTSFPKWI 782

Query: 758  -------LRFENMQE----------------REDWIPYSSSQEV-----EFYGNGCLIPF 789
                   L F  +++                +E +I     +EV     EF GN CL PF
Sbjct: 783  GDPSYKSLVFLKLKDCAHCTSLPALGNLHALKELYII--GMKEVCCIDGEFCGNACLRPF 840

Query: 790  PSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPKHLPS------- 842
            PSLE L F +M++ E+W    ++++ ++F +L+ LF+++C KLLG LP++LPS       
Sbjct: 841  PSLERLYFMDMEKWENWFLSDNNEQNDMFSSLQQLFIVKCPKLLGKLPENLPSLKHVIVK 900

Query: 843  --------------LQKLVIQRCEKLLVD--------------------------LPSLP 862
                          L KL I+ C+ L+++                          + +  
Sbjct: 901  ECEQLLVTISSLPVLYKLEIEGCKGLVLNCANEFNSLNSMSVSRILEFTFLMERLVQAFK 960

Query: 863  SLNELKLGGC------------KKGGLQK---GQPIIGRRIHYGCADTSSSL-------- 899
            ++ ELK+  C             +  L+K   G   I R I     +   S+        
Sbjct: 961  TVEELKIVSCALDETVLNDLWVNEVWLEKNPHGLSSILRLIEIRNCNIMKSIPKVLMVNS 1020

Query: 900  ----RVCLQCCNSLTNNARVQLPLSLKDLSIAFCDNLRTLVE------------EEGIPK 943
                R+ +  C+S+      QLP SLK L I+ C NLR L++            ++ +  
Sbjct: 1021 HFLERLYICHCDSIVFVTMDQLPHSLKSLEISNCKNLRCLLDNGTCTSSSIIMHDDNVQH 1080

Query: 944  GSRKYSSHLECLHILSCPSPTSIFSENELPATLQRLEVNSCSKLALLTLSGNLPQGPKYL 1003
            GS    SHLE ++I  CPS T I    ELP +++ L + +CS+L+ L++ G LP+  + L
Sbjct: 1081 GS-TIISHLEYVYIGWCPSLTCISRSGELPESVKHLFIWNCSELSCLSMKGQLPKSIERL 1139

Query: 1004 ELTSCSKWESIAD---NNTSLQVITVFRCKNLKTLPDGLHKLNNLQAFTI--CKNLVSFP 1058
            E+ SC K ESIA+    NTSL+ I ++ C+NLK+LP+GLH L NL+   I  C NLVSFP
Sbjct: 1140 EIQSCPKLESIANRLHRNTSLESIQIWNCENLKSLPEGLHFLVNLKEIKIIGCPNLVSFP 1199

Query: 1059 KGGLPSTQLRDPDITGCQKLEALPDG 1084
            + GLP++ L +  I  C+KL ALP+ 
Sbjct: 1200 EEGLPASSLSELSIMSCEKLVALPNS 1225

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|225465831|ref|XP_002264750.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487257|ref|XP_002269571.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487172|ref|XP_002264364.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860511|emb|CAN79726.1| hypothetical protein VITISV_014536 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766792|emb|CAN69685.1| hypothetical protein VITISV_039904 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495024|ref|XP_002267933.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495026|ref|XP_003634900.1| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1113
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.120 0.127 0.437 2.9e-56
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.119 0.093 0.392 2.1e-43
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.121 0.074 0.351 9e-27
TAIR|locus:2098110 1219 AT3G44670 [Arabidopsis thalian 0.152 0.139 0.297 5.8e-18
TAIR|locus:2011982857 AT1G50180 [Arabidopsis thalian 0.106 0.138 0.351 1.8e-17
TAIR|locus:5049561821049 AT1G58848 [Arabidopsis thalian 0.106 0.113 0.293 2.6e-17
TAIR|locus:28269781049 AT1G59218 [Arabidopsis thalian 0.106 0.113 0.293 2.6e-17
TAIR|locus:504956483847 AT3G46730 [Arabidopsis thalian 0.106 0.140 0.308 4.9e-16
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.154 0.144 0.301 2.3e-15
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.127 0.166 0.326 9.9e-15
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 2.9e-56, Sum P(5) = 2.9e-56
 Identities = 60/137 (43%), Positives = 90/137 (65%)

Query:   353 ATADQPVNGTDELGLLQEKLKNQMSGK--KFLLVLGDVWNENYSDWDSLSLPFEAGAPGS 410
             +   +P   TD L +LQ KLK +++G    FLLVL D+WNEN++DWD L  PF   A GS
Sbjct:   250 SVTSRPCEFTD-LDVLQVKLKERLTGTGLPFLLVLDDLWNENFADWDLLRQPFIHAAQGS 308

Query:   411 QIIVTTRNRDVAAIMGSVRDYPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDISKKIVI 470
             QI+VTTR++ VA+IM +V  + L+  +  DC  +F +   G ++  + + + D++++IV 
Sbjct:   309 QILVTTRSQRVASIMCAVHVHNLQPLSDGDCWSLFMKTVFGNQEPCLNREIGDLAERIVH 368

Query:   471 RCNGLPLAAKTLAGLLR 487
             +C GLPLA KTL G+LR
Sbjct:   369 KCRGLPLAVKTLGGVLR 385
GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1113
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 5e-27
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 7e-04
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  112 bits (281), Expect = 5e-27
 Identities = 63/240 (26%), Positives = 100/240 (41%), Gaps = 59/240 (24%)

Query: 324 PAVHLQWAVWARLHLLSLSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGKKFLL 383
               LQ  +   L L                             L  K+K  +  K+FLL
Sbjct: 62  TEFRLQKDILQELGLDDSDW-----------------VEKNESELAVKIKEALLRKRFLL 104

Query: 384 VLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSVRDYPLKES--TKDDC 441
           VL DVW +N  DWD + +PF  G  GS++IVTTR+  VA  MG     P +      ++ 
Sbjct: 105 VLDDVWEKN--DWDKIGVPFPDGENGSRVIVTTRSESVAGRMG-GTSKPHEVESLEPEES 161

Query: 442 LQVFTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPR-------- 493
            ++F+   +  ++      L++++K+IV +C GLPLA K L GLL  K+  +        
Sbjct: 162 WELFSNK-VFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQ 220

Query: 494 --------------FSACSIA---------RY----GIYQKNYEFHEEEEVTLLWMAEGF 526
                          S  S++         R      ++ ++Y    +E++  LW+AEGF
Sbjct: 221 LNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIR-KEQLIKLWIAEGF 279

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1113
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.73
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.72
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.67
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.67
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.5
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.41
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.29
KOG4237498 consensus Extracellular matrix protein slit, conta 99.17
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.08
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.03
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.01
KOG0617264 consensus Ras suppressor protein (contains leucine 98.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.64
KOG0617264 consensus Ras suppressor protein (contains leucine 98.63
PRK15386 426 type III secretion protein GogB; Provisional 98.6
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.47
PRK15386 426 type III secretion protein GogB; Provisional 98.37
KOG4341483 consensus F-box protein containing LRR [General fu 98.26
KOG4341483 consensus F-box protein containing LRR [General fu 98.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.08
KOG4237498 consensus Extracellular matrix protein slit, conta 98.07
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.05
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.73
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.67
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.66
PLN03150623 hypothetical protein; Provisional 97.56
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.56
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.46
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.27
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 97.22
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.16
PLN03150623 hypothetical protein; Provisional 97.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.09
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.04
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.04
PRK04841903 transcriptional regulator MalT; Provisional 97.0
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 96.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.65
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.44
PF05729166 NACHT: NACHT domain 96.34
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.3
PRK06893229 DNA replication initiation factor; Validated 96.04
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.9
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.89
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 95.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.76
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.47
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 95.32
PRK13342413 recombination factor protein RarA; Reviewed 95.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.02
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.58
PF13173128 AAA_14: AAA domain 94.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 94.06
PRK09087226 hypothetical protein; Validated 93.96
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 93.65
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.64
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 93.54
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.75
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 92.12
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.03
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 91.79
PRK00411394 cdc6 cell division control protein 6; Reviewed 91.79
PRK05564313 DNA polymerase III subunit delta'; Validated 91.4
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.2
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 91.17
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 90.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 90.52
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 90.03
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 89.49
PRK13341725 recombination factor protein RarA/unknown domain f 89.46
PLN03025319 replication factor C subunit; Provisional 88.81
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 88.72
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 88.04
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 87.79
PRK08727233 hypothetical protein; Validated 87.56
KOG2123388 consensus Uncharacterized conserved protein [Funct 87.01
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 86.02
KOG2123 388 consensus Uncharacterized conserved protein [Funct 84.51
smart0037026 LRR Leucine-rich repeats, outliers. 84.11
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.11
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.1
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 83.85
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 82.57
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.25
PRK08084235 DNA replication initiation factor; Provisional 81.24
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 81.17
TIGR02928365 orc1/cdc6 family replication initiation protein. M 80.81
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=7.5e-61  Score=591.44  Aligned_cols=457  Identities=25%  Similarity=0.372  Sum_probs=346.1

Q ss_pred             HHHHHHHHHHhhhccchhhhhccchhhHHHhHHHHHHHHHHhchHHHHHHHHHHHhhccchHHHHHHHHHHHHHHhhhhh
Q 046764          203 GCLADILLNQHGKHKAADIMGRIGASAAVFGFLTMMGTLIEVNPAVINAVIDDAEEKQKREQSVKMWLGELQNLAYDVDV  282 (1113)
Q Consensus       203 ~kl~~~l~~e~~~~~~v~~~~~~~d~~~i~~e~~~~~~fl~~~l~~i~~~l~dae~~~~~~~~v~~W~~~lr~~ayd~ed  282 (1113)
                      +|+..++..++..+.++     ++.+.-+++++..++.           +++|+++++.....+..|.+.+++++|++||
T Consensus        10 ~~~~~~l~~~~~~~~~~-----~~~i~~Lk~~L~~l~~-----------~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~   73 (889)
T KOG4658|consen   10 EKLDQLLNRESECLDGK-----DNYILELKENLKALQS-----------ALEDLDAKRDDLERRVNWEEDVGDLVYLAED   73 (889)
T ss_pred             hhHHHHHHHHHHHHhch-----HHHHHHHHHHHHHHHH-----------HHHHHHhhcchHHHHHHHHHHHHHHHHHHHH
Confidence            55667777778777787     7777766665555554           4777999988889999999999999999999


Q ss_pred             hhhhhhhhhhhh----------------------------------hHHHHHHhhccccccccccCCc--ccCCCCCCcc
Q 046764          283 LLDEFETEATDS----------------------------------RFEEILTQKDQLELKEKSLGKS--RKDRQRLPAV  326 (1113)
Q Consensus       283 ~id~~~~~~~~~----------------------------------~~~~i~~~~~~~~~~~~~~~~~--~~~~~~~~~~  326 (1113)
                      .++.|..+....                                  |+.++.+....++.........  .......++.
T Consensus        74 ~~~~~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~  153 (889)
T KOG4658|consen   74 IIWLFLVEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETR  153 (889)
T ss_pred             HHHHHHHHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccC
Confidence            999988655432                                  3444444444444332111100  0000011111


Q ss_pred             cccccc-cce---------------eEEEEEEeccc----chhhhc------------------ccc-------------
Q 046764          327 HLQWAV-WAR---------------LHLLSLSIMMP----NIIRFI------------------ATA-------------  355 (1113)
Q Consensus       327 ~~~~ei-~G~---------------~~vi~I~G~gG----tLA~~v------------------i~~-------------  355 (1113)
                      +...+. ||.               ..++||+||||    |||++|                  |+.             
T Consensus       154 ~~~~~~~VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~  233 (889)
T KOG4658|consen  154 PIQSESDVGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILE  233 (889)
T ss_pred             CCCccccccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHH
Confidence            111111 333               78999999999    999999                  110             


Q ss_pred             ----cCCcCCCCCHHHHHHHHHHHhcCcEEEEEEecCCCCChhhhhhhcccccCCCCCcEEEEecCChhhHhh-hCCCce
Q 046764          356 ----DQPVNGTDELGLLQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAI-MGSVRD  430 (1113)
Q Consensus       356 ----~~~~~~~~~~~~l~~~l~~~L~~kr~LiVLDDv~~~~~~~w~~l~~~l~~~~~gSrIivTTR~~~va~~-~~~~~~  430 (1113)
                          ..........++++..|.+.|++|||+|||||||++  .+|+.|+.++|....||||++|||++.||.. |++...
T Consensus       234 ~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~  311 (889)
T KOG4658|consen  234 RLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYP  311 (889)
T ss_pred             HhccCCcccchhhHHHHHHHHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCcc
Confidence                000012223468888999999999999999999999  8899999999999999999999999999999 888899


Q ss_pred             EecCCCCHHHHHHHHHhcccCCCCCCCchhHHHHHHHHHHHhCCChHHHHHHHhhhcCCCCc------------------
Q 046764          431 YPLKESTKDDCLQVFTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDP------------------  492 (1113)
Q Consensus       431 ~~l~~L~~~~s~~LF~~~af~~~~~~~~~~l~~i~~~I~~~c~GlPLAi~~ig~~L~~~~~~------------------  492 (1113)
                      +++++|+.+|||.||++.||..... ..+.++++|++|+++|+|+|||++++|+.|+.|...                  
T Consensus       312 ~~v~~L~~~eaW~LF~~~v~~~~~~-~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~  390 (889)
T KOG4658|consen  312 IEVECLTPEEAWDLFQKKVGPNTLG-SHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADF  390 (889)
T ss_pred             ccccccCccccHHHHHHhhcccccc-ccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCC
Confidence            9999999999999999999876432 234599999999999999999999999999999865                  


Q ss_pred             ------------------------ccccccccccccCcCCcccchhhHHHHHHHHcCCCccCCchhhHHHHHHHHHHHHH
Q 046764          493 ------------------------RFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDTKEEIQDLGHKFFHELY  548 (1113)
Q Consensus       493 ------------------------cfly~~~~~~~~fp~~~~i~~~~~Li~~Wiaegfi~~~~~~~~~e~~~~~~~~~Lv  548 (1113)
                                              ||+|||     +|||||+|++ ++||.+||||||+.+.+.++++++.|+.|+.+|+
T Consensus       391 ~~~~~~i~~iLklSyd~L~~~lK~CFLyca-----lFPED~~I~~-e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV  464 (889)
T KOG4658|consen  391 SGMEESILPILKLSYDNLPEELKSCFLYCA-----LFPEDYEIKK-EKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELV  464 (889)
T ss_pred             CchhhhhHHhhhccHhhhhHHHHHHHHhhc-----cCCcccccch-HHHHHHHHhccCcCccccccchhcchHHHHHHHH
Confidence                                    999999     9999999999 9999999999999997778999999999999999


Q ss_pred             hCCCccccC--CCCCceeechHHHHHHHHhcc-----ccC--cc------------c----------------ccccCCC
Q 046764          549 SRSSFQQSS--SDPCRFLMHDLINDLAQWAGD-----LDG--IK------------M----------------FEPFFEF  591 (1113)
Q Consensus       549 ~rsli~~~~--~~~~~~~mHdlv~d~~~~i~~-----~~~--~~------------~----------------~~~~~~l  591 (1113)
                      ++||++..+  ++..+|+|||+|||||.|+++     .+.  ..            .                ...-..+
T Consensus       465 ~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~  544 (889)
T KOG4658|consen  465 RASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSEN  544 (889)
T ss_pred             HHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCC
Confidence            999999876  467889999999999999954     111  00            0                0111245


Q ss_pred             CCeeEEccCCcC---------CCCCCccccEEecCCC-CCcccChhhhccccccEEecccccccccccccccCCCcceEE
Q 046764          592 ENLQTFLPTTVS---------HGGDLKHLRHLDLSET-DIQILPESVNTLYNLRMLMLQKCNQLEKMCSDMGNLLKLHHL  661 (1113)
Q Consensus       592 ~~Lr~L~~~~~~---------~i~~L~~Lr~L~Ls~~-~i~~LP~~i~~L~~L~~LdL~~c~~l~~LP~~i~~L~~L~~L  661 (1113)
                      +++++|.+.++.         +|..|+.||+|||++| .+.+||++|+.|.+||||++++ +.+..+|.++++|++|.+|
T Consensus       545 ~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~-t~I~~LP~~l~~Lk~L~~L  623 (889)
T KOG4658|consen  545 PKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSD-TGISHLPSGLGNLKKLIYL  623 (889)
T ss_pred             CccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccC-CCccccchHHHHHHhhhee
Confidence            667777776653         3777888888888876 5678888888888888888887 6788888888888888888


Q ss_pred             EcCCceecccccccccccc-ccccc
Q 046764          662 DNFDFCCWKDIDSALQELK-LLHLH  685 (1113)
Q Consensus       662 ~L~~~~i~~~~~~~l~~L~-L~~L~  685 (1113)
                      ++..+......+..+..|. |++|.
T Consensus       624 nl~~~~~l~~~~~i~~~L~~Lr~L~  648 (889)
T KOG4658|consen  624 NLEVTGRLESIPGILLELQSLRVLR  648 (889)
T ss_pred             ccccccccccccchhhhcccccEEE
Confidence            8876643222233333344 44443

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1113
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 9e-43
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 9e-36
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-31
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-10
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  165 bits (418), Expect = 9e-43
 Identities = 47/283 (16%), Positives = 88/283 (31%), Gaps = 81/283 (28%)

Query: 341 LSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGK--KFLLVLGDVWNENYSDWDS 398
           L  +     R              +   +++L+  M  K  + LL+L DVW+        
Sbjct: 196 LMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSWV----- 250

Query: 399 LSLPFEAGAPGSQIIVTTRNRDVA-AIMGSVRDYPLKES-TKDDCLQVFTQHCLGMRDFS 456
                +A     QI++TTR++ V  ++MG     P++ S  K+  L++ +          
Sbjct: 251 ----LKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFV-----NM 301

Query: 457 MQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKND------------------------- 491
            +  L + +  I+  C G PL    +  LLR   +                         
Sbjct: 302 KKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDY 361

Query: 492 -------------------PRFSACSIARYGIYQKNYEFHEEEEVTLLWMAEGFPYHIDT 532
                                ++  S     I QK+ +    + + +LW  E        
Sbjct: 362 EALDEAMSISVEMLREDIKDYYTDLS-----ILQKDVKV-PTKVLCILWDMET------- 408

Query: 533 KEEIQDLGHKFFHELYSRSSFQQSSSDP-CRFLMHDLINDLAQ 574
                +       E  ++S      +    R+ +HDL  D   
Sbjct: 409 -----EEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLT 446
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1113
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.83
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.82
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.81
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.81
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.8
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.79
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.77
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.74
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.73
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.71
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.68
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.65
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.65
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.64
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.64
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.63
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.61
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.6
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.58
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.57
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.57
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.56
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.56
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.55
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.54
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.54
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.52
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.52
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.5
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.49
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.49
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.47
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.42
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.42
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.41
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.4
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.39
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.38
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.38
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.36
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.34
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.32
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.32
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.31
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.3
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.28
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.28
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.27
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.26
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.25
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.22
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.2
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.17
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.1
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.08
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.99
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 98.99
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 98.96
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.96
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.95
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 98.94
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.92
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.88
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.88
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.88
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.58
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.56
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.52
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.44
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.44
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.42
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.38
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.36
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.31
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.1
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.02
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.98
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.94
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.7
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.66
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.64
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.43
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.31
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.25
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.24
2fna_A357 Conserved hypothetical protein; structural genomic 97.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.09
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.83
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.76
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.66
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.57
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.48
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.46
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 96.36
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 96.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.46
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.89
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.62
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.46
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 93.59
2chq_A319 Replication factor C small subunit; DNA-binding pr 93.07
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 92.96
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 92.01
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 90.8
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 90.68
3bos_A242 Putative DNA replication factor; P-loop containing 86.91
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 86.6
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 85.12
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 84.85
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 84.2
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 84.09
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 82.49
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 82.44
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 81.97
3pvs_A447 Replication-associated recombination protein A; ma 81.85
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.96  E-value=4.3e-29  Score=317.06  Aligned_cols=284  Identities=16%  Similarity=0.116  Sum_probs=179.2

Q ss_pred             CCCcceeeccccCcCcccccCCCCcccccCCCccEEEEecCcCcccccCC---CCCCccEEEEeccc---CccccCCCCC
Q 046764          789 FPSLETLRFENMQEREDWIPYSSSQEVEVFPNLRDLFLLRCSKLLGTLPK---HLPSLQKLVIQRCE---KLLVDLPSLP  862 (1113)
Q Consensus       789 ~~~L~~L~L~~~~~l~~~~~~~~~~~~~~~~~L~~L~L~~c~~L~~~lp~---~l~~L~~L~L~~c~---~L~~~l~~l~  862 (1113)
                      +++|+.|+++++.-...     .+..+..+++|+.|++++| .+.+.+|.   .+++|+.|++++|.   .++..+..++
T Consensus       393 ~~~L~~L~L~~n~l~~~-----~p~~l~~l~~L~~L~Ls~N-~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~  466 (768)
T 3rgz_A          393 KNTLQELYLQNNGFTGK-----IPPTLSNCSELVSLHLSFN-YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK  466 (768)
T ss_dssp             TCCCCEEECCSSEEEEE-----CCGGGGGCTTCCEEECCSS-EEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT
T ss_pred             cCCccEEECCCCccccc-----cCHHHhcCCCCCEEECcCC-cccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCC
Confidence            55666666665532211     1234456666777777766 45545553   45666777776663   2233344566


Q ss_pred             cccEEEEeccCCCCcccCCCccccccccccCCCCCCcccccccCCCCC--cCcccCCCCCCceEEEcccCCCcccccccC
Q 046764          863 SLNELKLGGCKKGGLQKGQPIIGRRIHYGCADTSSSLRVCLQCCNSLT--NNARVQLPLSLKDLSIAFCDNLRTLVEEEG  940 (1113)
Q Consensus       863 ~L~~L~L~~~~~~~~~~~~~l~~l~l~~~~~~~l~~L~~L~~~~N~L~--~~~~l~~l~~L~~L~Ls~c~~L~~l~~~~~  940 (1113)
                      +|++|++++|......+           ..+..+++|+.|++.+|.+.  .+..+..+++|+.|++++|. +.     +.
T Consensus       467 ~L~~L~L~~N~l~~~~p-----------~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~-l~-----~~  529 (768)
T 3rgz_A          467 TLETLILDFNDLTGEIP-----------SGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNS-FS-----GN  529 (768)
T ss_dssp             TCCEEECCSSCCCSCCC-----------GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC-CE-----EE
T ss_pred             CceEEEecCCcccCcCC-----------HHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCc-cc-----Cc
Confidence            77777777776654332           45667777777777777776  55667777777777777776 22     22


Q ss_pred             CCCCcccCCCCccEEEeecCCCCcccCCCCCcC-CccC---------eEEEcc--------------------------c
Q 046764          941 IPKGSRKYSSHLECLHILSCPSPTSIFSENELP-ATLQ---------RLEVNS--------------------------C  984 (1113)
Q Consensus       941 lp~~l~~~l~~L~~L~L~~c~~L~~ll~~~~l~-~sL~---------~L~i~~--------------------------c  984 (1113)
                      +|..+. .+++|+.|++++|+.... +|..-.. ..+.         ...+.+                          +
T Consensus       530 ~p~~l~-~l~~L~~L~Ls~N~l~g~-ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  607 (768)
T 3rgz_A          530 IPAELG-DCRSLIWLDLNTNLFNGT-IPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRL  607 (768)
T ss_dssp             CCGGGG-GCTTCCEEECCSSEEESB-CCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGG
T ss_pred             CCHHHc-CCCCCCEEECCCCccCCc-CChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhcc
Confidence            444444 677788887777654333 2221000 0000         000000                          0


Q ss_pred             ccccccccc------------CCCCCCCeEEEEecCCCccccCCC---CCCccEEEEeecCCCCcccccCCCCCCcCeee
Q 046764          985 SKLALLTLS------------GNLPQGPKYLELTSCSKWESIADN---NTSLQVITVFRCKNLKTLPDGLHKLNNLQAFT 1049 (1113)
Q Consensus       985 ~~L~~l~l~------------~~lp~~L~~L~L~~c~~L~~lp~~---l~sL~~L~Ls~c~~l~~lP~~l~~L~sL~~L~ 1049 (1113)
                      ..+..+.+.            ++++. |+.|+++++.-...+|..   +++|+.|++++|...+.+|..++.+++|+.|+
T Consensus       608 ~~~~~~~l~~~~~~g~~~~~~~~l~~-L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~Ld  686 (768)
T 3rgz_A          608 STRNPCNITSRVYGGHTSPTFDNNGS-MMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILD  686 (768)
T ss_dssp             GGTCCSCTTSCEEEEECCCSCSSSBC-CCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEE
T ss_pred             ccccccccccceecccCchhhhcccc-ccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEE
Confidence            001101111            12334 999999998666678876   89999999999988889999999999999999


Q ss_pred             e-ccccc-cccCCCCCCCCcCcEEEeCCCCCccCCCCCCCCCcCccccccc
Q 046764         1050 I-CKNLV-SFPKGGLPSTQLRDPDITGCQKLEALPDGDLSSTFKTGKSSKC 1098 (1113)
Q Consensus      1050 L-cn~L~-slp~~~~~~~sL~~L~l~~C~~L~~l~~~~l~~sL~~L~~~~c 1098 (1113)
                      | .|++. .+|.....+++|+.|++++|+--..+|.++...++....+.++
T Consensus       687 Ls~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN  737 (768)
T 3rgz_A          687 LSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNN  737 (768)
T ss_dssp             CCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSC
T ss_pred             CCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCC
Confidence            9 88887 7787777778999999999877778888666556666555553
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1113
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-17
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 82.2 bits (202), Expect = 1e-17
 Identities = 23/171 (13%), Positives = 47/171 (27%), Gaps = 12/171 (7%)

Query: 326 VHLQWAVWARLHLLSLSIMMPNIIRFIATADQPVNGTDELGLLQEKLKNQMSGKKFLLVL 385
           +            L   I++             V     + L +      +     L V 
Sbjct: 82  LKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVF 141

Query: 386 GDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVA-AIMGSVRDYPLKESTKDDCLQV 444
            DV  E    W              + +VTTR+ +++ A   +     +     D+C   
Sbjct: 142 DDVVQEETIRWAQ--------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDF 193

Query: 445 FTQHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKNDPRFS 495
              + + M     ++   D+  K +   +G P            K   + +
Sbjct: 194 LEAYGMPMPVGEKEE---DVLNKTIELSSGNPATLMMFFKSCEPKTFEKMA 241
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1113
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.7
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.65
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.48
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.46
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.45
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.43
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.39
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.26
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.22
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.21
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.13
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.1
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.05
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.03
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.02
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.95
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.95
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.94
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.91
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.91
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.81
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.7
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.68
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.62
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.19
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.17
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.04
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.01
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.96
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.85
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.7
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.32
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.52
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.46
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.36
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 91.3
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.1
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 89.19
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 88.98
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 85.56
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 84.13
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 83.12
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 80.14
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.85  E-value=2.1e-21  Score=211.48  Aligned_cols=112  Identities=15%  Similarity=0.147  Sum_probs=94.8

Q ss_pred             HHHHHHHHhcCcEEEEEEecCCCCChhhhhhhcccccCCCCCcEEEEecCChhhHhhhCCC-ceEecCCCCHHHHHHHHH
Q 046764          368 LQEKLKNQMSGKKFLLVLGDVWNENYSDWDSLSLPFEAGAPGSQIIVTTRNRDVAAIMGSV-RDYPLKESTKDDCLQVFT  446 (1113)
Q Consensus       368 l~~~l~~~L~~kr~LiVLDDv~~~~~~~w~~l~~~l~~~~~gSrIivTTR~~~va~~~~~~-~~~~l~~L~~~~s~~LF~  446 (1113)
                      ....+.+.+.+||+|+||||||+.  ++|+.+.      ..|||||||||+++||..+... ++|++++|+.+|||+||+
T Consensus       124 ~~~~~~~~L~~kr~LlVLDDv~~~--~~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~  195 (277)
T d2a5yb3         124 KRMICNALIDRPNTLFVFDDVVQE--ETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLE  195 (277)
T ss_dssp             HHHHHHHHTTSTTEEEEEEEECCH--HHHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHH
T ss_pred             HHHHHHHHhccCCeeEecchhhHH--hhhhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHH
Confidence            344577888999999999999998  7776543      2489999999999999987655 689999999999999999


Q ss_pred             hcccCCCCCCCchhHHHHHHHHHHHhCCChHHHHHHHhhhcCCC
Q 046764          447 QHCLGMRDFSMQQSLKDISKKIVIRCNGLPLAAKTLAGLLRGKN  490 (1113)
Q Consensus       447 ~~af~~~~~~~~~~l~~i~~~I~~~c~GlPLAi~~ig~~L~~~~  490 (1113)
                      +++|....   .+..++++++|+++|+|+||||+++|+.|+.+.
T Consensus       196 ~~~~~~~~---~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~  236 (277)
T d2a5yb3         196 AYGMPMPV---GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT  236 (277)
T ss_dssp             HTSCCCC-----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSS
T ss_pred             HHhCCccC---chhhHHHHHHHHHHhCCCHHHHHHHHHHhccCC
Confidence            99986543   345688999999999999999999999998665
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure