Citrus Sinensis ID: 046779
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| 76559894 | 306 | TPA: isoflavone reductase-like protein 5 | 0.978 | 0.584 | 0.694 | 8e-76 | |
| 225428436 | 306 | PREDICTED: isoflavone reductase homolog | 0.978 | 0.584 | 0.684 | 6e-75 | |
| 3243234 | 308 | isoflavone reductase related protein [Py | 0.978 | 0.581 | 0.679 | 3e-73 | |
| 118486357 | 306 | unknown [Populus trichocarpa] | 0.978 | 0.584 | 0.665 | 2e-72 | |
| 224105373 | 306 | phenylcoumaran benzylic ether reductase | 0.978 | 0.584 | 0.665 | 2e-72 | |
| 225428432 | 306 | PREDICTED: isoflavone reductase homolog | 0.972 | 0.581 | 0.653 | 1e-71 | |
| 76559896 | 308 | TPA: isoflavone reductase-like protein 6 | 0.978 | 0.581 | 0.650 | 2e-71 | |
| 449438299 | 308 | PREDICTED: isoflavone reductase homolog | 0.978 | 0.581 | 0.660 | 4e-71 | |
| 225428442 | 308 | PREDICTED: isoflavone reductase homolog | 0.978 | 0.581 | 0.640 | 1e-70 | |
| 225428438 | 308 | PREDICTED: isoflavone reductase homolog | 0.978 | 0.581 | 0.650 | 2e-70 |
| >gi|76559894|tpe|CAI56334.1| TPA: isoflavone reductase-like protein 5 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 288 bits (736), Expect = 8e-76, Method: Compositional matrix adjust.
Identities = 141/203 (69%), Positives = 159/203 (78%), Gaps = 24/203 (11%)
Query: 5 QRFFPSEFGNDVDRVHAVELARTSFATKAKIRRAVEAERIPYTYVASNFFAGLYL----- 59
+RFFPSEFGNDVDRVHAVE A+T+FATKA+IRR +EAE IPYTYV+SNFFAG +L
Sbjct: 104 KRFFPSEFGNDVDRVHAVEPAKTAFATKAQIRRTIEAEGIPYTYVSSNFFAGYFLPSLSQ 163
Query: 60 -------------------SIIFNKEDDIGINSIKAVDDPRTLNKILYIRPRCNIYSFND 100
+FNKEDDIG +IKAVDDPRTLNKILYIRP N YSFND
Sbjct: 164 PGATTPPRDKVIILGDGNPKAVFNKEDDIGTYTIKAVDDPRTLNKILYIRPPQNTYSFND 223
Query: 101 LVSLWEEKIGKALDRVYVTEEQLLKNIQEASYPLNMILPIGHSAYVLGDQTNFEIEPSFG 160
LVSLWE+KIGK L+++YV EEQ+LKNIQEAS PLN+IL I HS ++ GD TNFEIEPSFG
Sbjct: 224 LVSLWEKKIGKTLEKIYVPEEQVLKNIQEASVPLNVILSISHSVFIKGDHTNFEIEPSFG 283
Query: 161 VEATELYPDVNYTTVDEYLNQFI 183
VEATELYPDV YTTVDEYLNQF+
Sbjct: 284 VEATELYPDVKYTTVDEYLNQFV 306
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225428436|ref|XP_002283953.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera] gi|297744403|emb|CBI37665.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|3243234|gb|AAC24001.1| isoflavone reductase related protein [Pyrus communis] | Back alignment and taxonomy information |
|---|
| >gi|118486357|gb|ABK95019.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224105373|ref|XP_002313788.1| phenylcoumaran benzylic ether reductase 3 [Populus trichocarpa] gi|222850196|gb|EEE87743.1| phenylcoumaran benzylic ether reductase 3 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225428432|ref|XP_002283921.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera] gi|297744407|emb|CBI37669.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|76559896|tpe|CAI56335.1| TPA: isoflavone reductase-like protein 6 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449438299|ref|XP_004136926.1| PREDICTED: isoflavone reductase homolog [Cucumis sativus] gi|449478781|ref|XP_004155417.1| PREDICTED: isoflavone reductase homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225428442|ref|XP_002283978.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera] gi|297744400|emb|CBI37662.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225428438|ref|XP_002284006.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera] gi|297744402|emb|CBI37664.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| TAIR|locus:2136383 | 308 | AT4G39230 [Arabidopsis thalian | 0.666 | 0.396 | 0.713 | 6.1e-64 | |
| TAIR|locus:2025197 | 318 | AT1G75290 [Arabidopsis thalian | 0.661 | 0.380 | 0.595 | 8.8e-55 | |
| TAIR|locus:2025192 | 310 | AT1G75280 [Arabidopsis thalian | 0.655 | 0.387 | 0.628 | 3.7e-54 | |
| TAIR|locus:2016482 | 310 | AT1G19540 [Arabidopsis thalian | 0.666 | 0.393 | 0.598 | 1.8e-52 | |
| TAIR|locus:2025167 | 322 | AT1G75300 [Arabidopsis thalian | 0.650 | 0.369 | 0.557 | 2.9e-50 | |
| TAIR|locus:2139494 | 306 | AT4G34540 [Arabidopsis thalian | 0.666 | 0.398 | 0.508 | 4.5e-38 | |
| TAIR|locus:2031730 | 317 | PRR1 "pinoresinol reductase 1" | 0.710 | 0.410 | 0.340 | 5.9e-29 | |
| TAIR|locus:2119455 | 317 | PRR2 "pinoresinol reductase 2" | 0.661 | 0.381 | 0.370 | 2.5e-17 | |
| UNIPROTKB|G4MWE1 | 332 | MGG_08352 "Isoflavone reductas | 0.628 | 0.346 | 0.305 | 4.7e-05 |
| TAIR|locus:2136383 AT4G39230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 457 (165.9 bits), Expect = 6.1e-64, Sum P(2) = 6.1e-64
Identities = 87/122 (71%), Positives = 101/122 (82%)
Query: 62 IFNKEDDIGINSIKAVDDPRTLNKILYIRPRCNIYSFNDLVSLWEEKIGKALDRVYVTEE 121
+FNKE+DIG +I AVDDPRTLNKILYIRP N YSFNDLVSLWE KIGK L+R+YV EE
Sbjct: 187 VFNKEEDIGTYTINAVDDPRTLNKILYIRPPMNTYSFNDLVSLWENKIGKTLERIYVPEE 246
Query: 122 QLLKNIQEASYPLNMILPIGHSAYVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLNQ 181
QLLK I E+S PLN++L + H +V G T+FEIEPSFGVEA+ELYPDV YTTVDE LNQ
Sbjct: 247 QLLKQIIESSPPLNVMLSLCHCVFVKGGHTSFEIEPSFGVEASELYPDVKYTTVDEILNQ 306
Query: 182 FI 183
++
Sbjct: 307 YV 308
|
|
| TAIR|locus:2025197 AT1G75290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025192 AT1G75280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2016482 AT1G19540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025167 AT1G75300 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139494 AT4G34540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031730 PRR1 "pinoresinol reductase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2119455 PRR2 "pinoresinol reductase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MWE1 MGG_08352 "Isoflavone reductase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| pfam05368 | 232 | pfam05368, NmrA, NmrA-like family | 9e-36 | |
| cd05259 | 282 | cd05259, PCBER_SDR_a, phenylcoumaran benzylic ethe | 3e-29 | |
| cd05226 | 176 | cd05226, SDR_e_a, Extended (e) and atypical (a) SD | 0.001 |
| >gnl|CDD|191263 pfam05368, NmrA, NmrA-like family | Back alignment and domain information |
|---|
Score = 124 bits (313), Expect = 9e-36
Identities = 55/132 (41%), Positives = 71/132 (53%), Gaps = 26/132 (19%)
Query: 5 QRFFPSEFGNDVDRVHAVELARTSFATKAKIRRAVEAERIPYTYVASNFFAGLYLS---- 60
+ F PSEFGNDVDR + VE A F +KA++ R + A IPYT+V + FF G +LS
Sbjct: 96 KHFIPSEFGNDVDRSNGVEPAVPHFDSKAEVERYIRALGIPYTFVYAGFFMGNFLSNLAP 155
Query: 61 ---------------------IIFNKEDDIGINSIKAVDDPRTLNKILYIRPRCNIYSFN 99
+ + E+DIG IK +DDPR L K YIRP NI S N
Sbjct: 156 PGDLAPPRDKVTLLGPGNPKAVPLDDEEDIGTYVIKILDDPRKL-KGKYIRPPGNILSGN 214
Query: 100 DLVSLWEEKIGK 111
++ LW +KIGK
Sbjct: 215 EIAELWSKKIGK 226
|
NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families. Length = 232 |
| >gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase (PCBER) like, atypical (a) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 99.89 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 99.85 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 99.59 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 99.16 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 99.0 | |
| COG0702 | 275 | Predicted nucleoside-diphosphate-sugar epimerases | 98.71 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 98.16 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 98.03 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 97.99 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 97.78 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 97.66 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 97.6 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 97.6 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 97.54 | |
| KOG1203 | 411 | consensus Predicted dehydrogenase [Carbohydrate tr | 97.53 | |
| PRK05865 | 854 | hypothetical protein; Provisional | 97.36 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 97.35 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 97.32 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 97.26 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 97.25 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 97.23 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 97.21 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 97.18 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 97.09 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 97.06 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 97.05 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 97.04 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 96.88 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 96.85 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 96.85 | |
| KOG2865 | 391 | consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 | 96.83 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 96.8 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 96.77 | |
| TIGR02197 | 314 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epime | 96.64 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 96.61 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 96.54 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo | 96.47 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 96.46 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 96.42 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 96.4 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 96.37 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 96.37 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 96.18 | |
| PLN02725 | 306 | GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas | 96.09 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 95.92 | |
| KOG3019 | 315 | consensus Predicted nucleoside-diphosphate sugar e | 95.65 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 95.55 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 94.9 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 94.84 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 94.76 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 94.68 | |
| KOG4288 | 283 | consensus Predicted oxidoreductase [General functi | 94.6 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 94.48 | |
| COG1090 | 297 | Predicted nucleoside-diphosphate sugar epimerase [ | 94.13 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 93.99 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 93.95 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 93.56 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 93.5 | |
| KOG1431 | 315 | consensus GDP-L-fucose synthetase [Carbohydrate tr | 93.4 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 93.35 | |
| PF01073 | 280 | 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso | 93.26 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 92.99 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 92.85 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 92.41 | |
| COG1088 | 340 | RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope | 91.9 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 91.36 | |
| PLN02996 | 491 | fatty acyl-CoA reductase | 91.3 | |
| PRK12320 | 699 | hypothetical protein; Provisional | 90.23 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 90.2 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 89.93 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 89.67 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 89.38 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 89.09 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 88.84 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 88.08 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 86.78 | |
| KOG0747 | 331 | consensus Putative NAD+-dependent epimerases [Carb | 86.14 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 84.91 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 82.89 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 81.95 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 80.03 |
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
Probab=99.89 E-value=2.5e-23 Score=164.52 Aligned_cols=114 Identities=25% Similarity=0.433 Sum_probs=96.0
Q ss_pred CCceEeccCCCCCCCCcchhhhhchhhHHHHHHHHHHHHHCCCCeEEEecchHHHhhhc---------------------
Q 046779 2 FISQRFFPSEFGNDVDRVHAVELARTSFATKAKIRRAVEAERIPYTYVASNFFAGLYLS--------------------- 60 (183)
Q Consensus 2 ~~VkrFiPSefg~~~~~~~~~~~~~~~~~~k~~i~~~l~~~gi~~T~i~~g~F~~~~~~--------------------- 60 (183)
.||||||||+|+.+........|..++++.|..++++|++++++||+|+||+||||++.
T Consensus 93 agVk~~v~ss~~~~~~~~~~~~p~~~~~~~k~~ie~~l~~~~i~~t~i~~g~f~e~~~~~~~~~~~~~~~~~~~~~~~~~ 172 (233)
T PF05368_consen 93 AGVKHFVPSSFGADYDESSGSEPEIPHFDQKAEIEEYLRESGIPYTIIRPGFFMENLLPPFAPVVDIKKSKDVVTLPGPG 172 (233)
T ss_dssp HT-SEEEESEESSGTTTTTTSTTHHHHHHHHHHHHHHHHHCTSEBEEEEE-EEHHHHHTTTHHTTCSCCTSSEEEEETTS
T ss_pred cccceEEEEEecccccccccccccchhhhhhhhhhhhhhhccccceeccccchhhhhhhhhcccccccccceEEEEccCC
Confidence 47999999999998754322224556789999999999999999999999999999864
Q ss_pred ---ccc-cChhHHHHHHHHhhcCCccC--CeEEEEecCCCccCHHHHHHHHHHHhCCceeEEe
Q 046779 61 ---IIF-NKEDDIGINSIKAVDDPRTL--NKILYIRPRCNIYSFNDLVSLWEEKIGKALDRVY 117 (183)
Q Consensus 61 ---~~~-t~~~Dia~~va~~l~~p~~~--~~~~~v~~~~~~~T~~ev~~~~~~~~G~~~~~~~ 117 (183)
..+ ++.+|||+++|++|.+|+.. |+.+.+. ++.+|++|+++++++++|++++|++
T Consensus 173 ~~~~~~~~~~~Dvg~~va~il~~p~~~~~~~~~~~~--~~~~t~~eia~~~s~~~G~~v~y~~ 233 (233)
T PF05368_consen 173 NQKAVPVTDTRDVGRAVAAILLDPEKHNNGKTIFLA--GETLTYNEIAAILSKVLGKKVKYVQ 233 (233)
T ss_dssp TSEEEEEEHHHHHHHHHHHHHHSGGGTTEEEEEEEG--GGEEEHHHHHHHHHHHHTSEEEEEE
T ss_pred CccccccccHHHHHHHHHHHHcChHHhcCCEEEEeC--CCCCCHHHHHHHHHHHHCCccEEeC
Confidence 334 59999999999999999854 6888887 7999999999999999999999874
|
NmrA is part of a system controlling nitrogen metabolite repression in fungi []. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.; PDB: 2ZCV_A 2ZCU_A 2R6J_B 3C3X_A 2QZZ_B 2QYS_A 2QX7_A 2QW8_A 2R2G_B 3E5M_B .... |
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05865 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4288 consensus Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02996 fatty acyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK12320 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 183 | ||||
| 1qyc_A | 308 | Crystal Structures Of Pinoresinol-Lariciresinol And | 2e-59 | ||
| 2gas_A | 307 | Crystal Structure Of Isoflavone Reductase Length = | 1e-45 | ||
| 1qyd_A | 313 | Crystal Structures Of Pinoresinol-Lariciresinol And | 1e-36 | ||
| 3i52_A | 346 | Ternary Complex Structure Of Leucoanthocyanidin Red | 6e-32 | ||
| 3c1o_A | 321 | The Multiple Phenylpropene Synthases In Both Clarki | 1e-30 | ||
| 2qw8_A | 314 | Structure Of Eugenol Synthase From Ocimum Basilicum | 2e-26 | ||
| 2qx7_A | 318 | Structure Of Eugenol Synthase From Ocimum Basilicum | 3e-26 | ||
| 3c3x_A | 318 | The Multiple Phenylpropene Synthases In Both Clarki | 3e-26 | ||
| 2r2g_A | 318 | Structure Of Eugenol Synthase From Ocimum Basilicum | 7e-26 |
| >pdb|1QYC|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And Phenylcoumaran Benzylic Ether Reductases, And Their Relationship To Isoflavone Reductases Length = 308 | Back alignment and structure |
|
| >pdb|2GAS|A Chain A, Crystal Structure Of Isoflavone Reductase Length = 307 | Back alignment and structure |
| >pdb|1QYD|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And Phenylcoumaran Benzylic Ether Reductases, And Their Relationship To Isoflavone Reductases Length = 313 | Back alignment and structure |
| >pdb|3I52|A Chain A, Ternary Complex Structure Of Leucoanthocyanidin Reductase From Vitis Vinifera Length = 346 | Back alignment and structure |
| >pdb|3C1O|A Chain A, The Multiple Phenylpropene Synthases In Both Clarkia Breweri And Petunia Hybrida Represent Two Distinct Lineages Length = 321 | Back alignment and structure |
| >pdb|2QW8|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Length = 314 | Back alignment and structure |
| >pdb|2QX7|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Length = 318 | Back alignment and structure |
| >pdb|3C3X|A Chain A, The Multiple Phenylpropene Synthases In Both Clarkia Breweri And Petunia Hybrida Represent Two Distinct Lineages Length = 318 | Back alignment and structure |
| >pdb|2R2G|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Complexed With Emdf Length = 318 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 2e-60 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 5e-60 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 7e-60 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 5e-56 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 6e-56 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 1e-54 |
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 | Back alignment and structure |
|---|
Score = 189 bits (481), Expect = 2e-60
Identities = 92/203 (45%), Positives = 128/203 (63%), Gaps = 25/203 (12%)
Query: 5 QRFFPSEFGNDVDRVHAVELARTSFATKAKIRRAVEAERIPYTYVASNFFAGLYLS---- 60
++FFPSEFG DVDR AVE R F KA IRR +EAE +PYTY+ + F G +L
Sbjct: 106 KKFFPSEFGLDVDRHDAVEPVRQVFEEKASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQ 165
Query: 61 --------------------IIFNKEDDIGINSIKAVDDPRTLNKILYIRPRCNIYSFND 100
+ E D+G +I+A +DP TLNK ++IR N + N+
Sbjct: 166 LDATDPPRDKVVILGDGNVKGAYVTEADVGTFTIRAANDPNTLNKAVHIRLPKNYLTQNE 225
Query: 101 LVSLWEEKIGKALDRVYVTEEQLLKNIQEASYPLNMILPIGHSAYVLGDQTNFEIEPSFG 160
+++LWE+KIGK L++ YV+EEQ+LK+IQE+S+P N +L + HS + GD +EI+P+
Sbjct: 226 VIALWEKKIGKTLEKTYVSEEQVLKDIQESSFPHNYLLALYHSQQIKGDAV-YEIDPAKD 284
Query: 161 VEATELYPDVNYTTVDEYLNQFI 183
+EA+E YPDV YTT DEYLNQF+
Sbjct: 285 IEASEAYPDVTYTTADEYLNQFV 307
|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 99.94 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 99.94 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 99.94 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 99.94 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 99.93 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 99.92 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 99.65 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 99.65 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 99.5 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 99.48 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 99.04 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 98.8 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 98.74 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 98.73 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 98.72 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 98.69 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 98.52 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 98.49 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 98.44 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 98.42 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 98.39 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 98.38 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 98.36 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 98.3 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 98.3 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 98.29 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 98.25 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 98.24 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 98.22 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 98.19 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 98.18 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 98.11 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 98.1 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 98.09 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 98.09 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 98.08 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 98.07 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 98.04 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.02 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 98.01 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 98.0 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 97.98 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 97.97 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 97.93 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 97.92 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 97.89 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 97.89 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 97.88 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 97.87 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 97.86 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 97.85 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 97.83 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 97.82 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 97.81 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 97.79 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 97.79 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 97.76 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 97.71 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 97.71 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 97.64 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 97.61 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 97.57 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 97.56 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 97.54 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 97.53 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 97.52 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 97.5 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 97.48 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 97.47 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 97.45 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 97.44 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 97.44 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 97.38 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 97.34 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 97.33 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 97.29 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 97.18 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 97.16 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 97.13 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 97.02 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 96.94 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 96.88 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 96.85 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 96.62 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 96.4 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 96.32 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 95.83 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 95.46 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 95.24 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 95.14 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 93.34 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 92.35 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 90.97 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 90.52 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 90.2 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 89.78 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 89.36 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 89.25 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 89.25 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 87.83 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 86.97 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 86.27 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 85.38 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 83.81 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 83.66 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 82.57 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 82.48 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 81.69 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 81.16 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 80.85 |
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
Probab=99.94 E-value=3.6e-27 Score=190.89 Aligned_cols=179 Identities=50% Similarity=0.829 Sum_probs=143.7
Q ss_pred C-ceEeccCCCCCCCCcchhhhhchhhHHHHHHHHHHHHHCCCCeEEEecchHHHhhhc---------------------
Q 046779 3 I-SQRFFPSEFGNDVDRVHAVELARTSFATKAKIRRAVEAERIPYTYVASNFFAGLYLS--------------------- 60 (183)
Q Consensus 3 ~-VkrFiPSefg~~~~~~~~~~~~~~~~~~k~~i~~~l~~~gi~~T~i~~g~F~~~~~~--------------------- 60 (183)
| |||||+|.||.+.+......|....|..|..+++++++.+++||+|+||+|++++.+
T Consensus 103 g~v~~~v~S~~g~~~~~~~~~~p~~~~y~sK~~~e~~~~~~~i~~~~lrp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 182 (307)
T 2gas_A 103 GNVKKFFPSEFGLDVDRHDAVEPVRQVFEEKASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQLDATDPPRDKVVILGDG 182 (307)
T ss_dssp CCCSEEECSCCSSCTTSCCCCTTHHHHHHHHHHHHHHHHHHTCCBEEEECCEETTTTGGGTTCTTCSSCCSSEEEEETTS
T ss_pred CCceEEeecccccCcccccCCCcchhHHHHHHHHHHHHHHcCCCeEEEEcceeeccccccccccccccCCCCeEEEecCC
Confidence 5 999999999976543211123334569999999999999999999999999986532
Q ss_pred ---ccccChhHHHHHHHHhhcCCccCCeEEEEecCCCccCHHHHHHHHHHHhCCceeEEeCCHHHHHHHHHHcCCCccch
Q 046779 61 ---IIFNKEDDIGINSIKAVDDPRTLNKILYIRPRCNIYSFNDLVSLWEEKIGKALDRVYVTEEQLLKNIQEASYPLNMI 137 (183)
Q Consensus 61 ---~~~t~~~Dia~~va~~l~~p~~~~~~~~v~~~~~~~T~~ev~~~~~~~~G~~~~~~~~s~~~~~~~~~~~~~p~~~~ 137 (183)
.++++.+|+|++++.++.+++..|+.+++.|+++.+|++|+++++++++|+++++.+++.+++.+.+...+.|.+..
T Consensus 183 ~~~~~~i~~~Dva~~~~~~l~~~~~~~~~~~~~~~~~~~s~~e~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~ 262 (307)
T 2gas_A 183 NVKGAYVTEADVGTFTIRAANDPNTLNKAVHIRLPKNYLTQNEVIALWEKKIGKTLEKTYVSEEQVLKDIQESSFPHNYL 262 (307)
T ss_dssp CSEEEEECHHHHHHHHHHHHTCGGGTTEEEECCCGGGEEEHHHHHHHHHHHHTSCCEEEEECHHHHHHHHHHBCTTHHHH
T ss_pred CcceEEeeHHHHHHHHHHHHcCccccCceEEEeCCCCcCCHHHHHHHHHHHhCCCCceeecCHHHHHHHHhcCCCchhHH
Confidence 57899999999999999988877899999865679999999999999999999999999999999988877787655
Q ss_pred hhhheeeEEcCCCc-CcccCCCCcccccccCCCCcccCHHHHHHhhC
Q 046779 138 LPIGHSAYVLGDQT-NFEIEPSFGVEATELYPDVNYTTVDEYLNQFI 183 (183)
Q Consensus 138 ~~~~~~~~~~G~~~-~~~~~~~~~~~~~~~~p~~~~~t~~e~l~~~~ 183 (183)
+.+++.++..|... .++.++ +...+++|||++++|++|||++++
T Consensus 263 ~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~p~~~~~t~~~~l~~~~ 307 (307)
T 2gas_A 263 LALYHSQQIKGDAVYEIDPAK--DIEASEAYPDVTYTTADEYLNQFV 307 (307)
T ss_dssp HHHHHHHHTSCTTCCCCCTTT--EEEHHHHCTTCCCCCHHHHHGGGC
T ss_pred HHHHHHHeecCcccCCCCcCC--CcchHhhCCCCccccHHHHHHHhC
Confidence 55555555445432 234332 245688999999999999999985
|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 183 | ||||
| d1qyca_ | 307 | c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta | 1e-31 | |
| d1qyda_ | 312 | c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { | 4e-30 |
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Phenylcoumaran benzylic ether reductase species: Loblolly pine (Pinus taeda) [TaxId: 3352]
Score = 114 bits (284), Expect = 1e-31
Identities = 70/117 (59%), Positives = 90/117 (76%), Gaps = 1/117 (0%)
Query: 67 DDIGINSIKAVDDPRTLNKILYIRPRCNIYSFNDLVSLWEEKIGKALDRVYVTEEQLLKN 126
+DIG +IKAVDDPRTLNK LY+R N S N+LV+LWE+KI K L++ YV EE++LK
Sbjct: 192 EDIGTFTIKAVDDPRTLNKTLYLRLPANTLSLNELVALWEKKIDKTLEKAYVPEEEVLKL 251
Query: 127 IQEASYPLNMILPIGHSAYVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLNQFI 183
I + +P N+ + I HS +V GDQTNFEI P+ GVEA++LYPDV YTTVDEYL+ F+
Sbjct: 252 IADTPFPANISIAISHSIFVKGDQTNFEIGPA-GVEASQLYPDVKYTTVDEYLSNFV 307
|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 99.9 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 99.89 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 99.38 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 99.05 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 98.53 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 97.89 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 97.52 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 97.44 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 97.4 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 97.39 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 96.99 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 96.88 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 96.76 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 96.23 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 96.2 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 96.1 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 95.69 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 95.68 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 95.41 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 95.2 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 95.09 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 94.9 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 94.71 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 94.7 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 92.7 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 92.0 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 91.31 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 89.12 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 88.25 |
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Pinoresinol-lariciresinol reductase species: Giant arborvitae (Thuja plicata) [TaxId: 3316]
Probab=99.90 E-value=3.6e-24 Score=170.25 Aligned_cols=181 Identities=42% Similarity=0.773 Sum_probs=146.6
Q ss_pred CCceEeccCCCCCCCCcchh-hhhchhhHHHHHHHHHHHHHCCCCeEEEecchHHHhhhc--------------------
Q 046779 2 FISQRFFPSEFGNDVDRVHA-VELARTSFATKAKIRRAVEAERIPYTYVASNFFAGLYLS-------------------- 60 (183)
Q Consensus 2 ~~VkrFiPSefg~~~~~~~~-~~~~~~~~~~k~~i~~~l~~~gi~~T~i~~g~F~~~~~~-------------------- 60 (183)
.++++|++|.+|.+...... ..+.......|..+++++++.+++|++++++.|+.++.+
T Consensus 106 ~~~~~v~~Ss~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~r~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~ 185 (312)
T d1qyda_ 106 GNIKRFLPSEFGMDPDIMEHALQPGSITFIDKRKVRRAIEAASIPYTYVSSNMFAGYFAGSLAQLDGHMMPPRDKVLIYG 185 (312)
T ss_dssp CCCSEEECSCCSSCTTSCCCCCSSTTHHHHHHHHHHHHHHHTTCCBCEEECCEEHHHHTTTSSCTTCCSSCCSSEECCBT
T ss_pred cCCcEEEEeeccccCCCcccccchhhhhhHHHHHHHHhhcccccceEEeccceeecCCccchhhHHHHhhhccccccccc
Confidence 46899999999987644311 123344578899999999999999999999999986532
Q ss_pred -----ccccChhHHHHHHHHhhcCCccCCeEEEEecCCCccCHHHHHHHHHHHhCCceeEEeCCHHHHHHHHHHcCCCcc
Q 046779 61 -----IIFNKEDDIGINSIKAVDDPRTLNKILYIRPRCNIYSFNDLVSLWEEKIGKALDRVYVTEEQLLKNIQEASYPLN 135 (183)
Q Consensus 61 -----~~~t~~~Dia~~va~~l~~p~~~~~~~~v~~~~~~~T~~ev~~~~~~~~G~~~~~~~~s~~~~~~~~~~~~~p~~ 135 (183)
.++++++|+|++++++|.+|+..++.+++.++++.+|++|+++.+++++|+++++.+++.+++.+.+...+.|..
T Consensus 186 ~g~~~~~~i~v~Dva~a~~~~l~~~~~~~~~~~~~~~~~~~s~~e~~~~~~~~~g~~~~~~~i~~~~~~~~~~~~~~~~~ 265 (312)
T d1qyda_ 186 DGNVKGIWVDEDDVGTYTIKSIDDPQTLNKTMYIRPPMNILSQKEVIQIWERLSEQNLDKIYISSQDFLADMKDKSYEEK 265 (312)
T ss_dssp TSCSEEEEECHHHHHHHHHHHTTCGGGSSSEEECCCGGGEEEHHHHHHHHHHHHTCCCEECCBCSHHHHHHHTTSCTTHH
T ss_pred ccccccceeeHHHHHHHHHHHhcCccccCceEEEeCCCcCCCHHHHHHHHHHHHCCCCeEEECCHHHHHHHHHhcCCcHh
Confidence 779999999999999999999888888877667899999999999999999999999999999888877777766
Q ss_pred chhhhheeeEEcCCCcCcccCCCCcccccccCCCCcccCHHHHHHhhC
Q 046779 136 MILPIGHSAYVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLNQFI 183 (183)
Q Consensus 136 ~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~p~~~~~t~~e~l~~~~ 183 (183)
....+.+.++..|....+++.+. ....+++|||+++||++|||++|+
T Consensus 266 ~~~~~~~~~~~~~~~~~~~~~~~-~~ea~~l~Pd~~~tt~~e~l~~~v 312 (312)
T d1qyda_ 266 IVRCHLYQIFFRGDLYNFEIGPN-AIEATKLYPEVKYVTMDSYLERYV 312 (312)
T ss_dssp HHTTTHHHHTTSCTTTSSCCCSS-EEEHHHHCTTSCCCCHHHHHTTTC
T ss_pred HHHHHHHHHHhcCcccccccCcc-hhhHHHhCCCCCcCcHHHHHHhhC
Confidence 55555555555565544444332 345678899999999999999986
|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|