Citrus Sinensis ID: 046832


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MKKETAIKAFIFLVKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELLLGHGTYSSGRLELIALHQQRQLDSRHDFVEYFKFKKGRDSPGETRSALLVVAALVATTSFQFGVNPPGGNAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIPALIPLTARW
cccHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccc
ccHHHHHHHccccEcccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccEcccccccccHHHHHHHccccEEEEEEccccccccccccHHHHHHHHcHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEEHHHHHHHHHHcc
MKKETAIKAFIFLVKLKAlrkgnplhvasayghvDFVKEIINVrpdlahevnqdgfspmhiassIGHTGVVRELLKVEQKLChqqgpekntplhcAAIKGKVHVLSEMLSacpeciedvTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELLlghgtyssGRLELIALHQQRQLDSRHDFVEYfkfkkgrdspgetRSALLVVAALVATtsfqfgvnppggnAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIpalipltarw
MKKETAIKAFIFLVKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHqqgpekntplHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELLLGHGTYSSGRLELIALHQQRQLDSRHDFVEYFKFkkgrdspgetRSALLVVAALVATTSFQFGVNPPGGNAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIPALIPLTARW
MKKETAIKAFIFLVKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELLLGHGTYSSGRLELIALHQQRQLDSRHDFVEYFKFKKGRDSPGETRSallvvaalvaTTSFQFGVNPPGGNAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIPALIPLTARW
*****AIKAFIFLVKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELLLGHGTYSSGRLELIALHQQRQLDSRHDFVEYFKFKK********RSALLVVAALVATTSFQFGVNPPGGNAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIPALIPLT***
****TAIKAFIFLVKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELLLGHGTYSSGRLELIALHQQRQLDSRHDF******************ALLVVAALVATTSFQFGVNPPGGNAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIPALIPLTARW
MKKETAIKAFIFLVKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELLLGHGTYSSGRLELIALHQQRQLDSRHDFVEYFKFKKGRDSPGETRSALLVVAALVATTSFQFGVNPPGGNAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIPALIPLTARW
*KKETAIKAFIFLVKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELLLGHGTYSSGRLELIALHQQRQLDSRHDFVEYFKFKKGRDSPGETRSALLVVAALVATTSFQFGVNPPGGNAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIPALIPLTARW
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKETAIKAFIFLVKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELLLGHGTYSSGRLELIALHQQRQLDSRHDFVEYFKFKKGRDSPGETRSALLVVAALVATTSFQFGVNPPGGNAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQLCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIPALIPLTARW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query328 2.2.26 [Sep-21-2011]
Q9C7A2 590 Ankyrin repeat-containing no no 0.451 0.250 0.331 4e-14
Q9ZU96 532 Ankyrin repeat-containing no no 0.539 0.332 0.275 2e-12
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus yes no 0.472 0.039 0.327 2e-10
Q01484 3957 Ankyrin-2 OS=Homo sapiens yes no 0.478 0.039 0.319 3e-10
Q7Z020 1296 Transient receptor potent yes no 0.393 0.099 0.323 1e-09
Q6AWW5 524 Ankyrin repeat-containing no no 0.490 0.307 0.275 4e-09
B2RXR6993 Serine/threonine-protein yes no 0.472 0.156 0.301 2e-08
A5PMU4 1280 Ankyrin repeat and steril no no 0.411 0.105 0.32 3e-08
Q6RI86 1125 Transient receptor potent no no 0.478 0.139 0.278 3e-08
Q8BLA8 1125 Transient receptor potent no no 0.469 0.136 0.277 4e-08
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 83/157 (52%), Gaps = 9/157 (5%)

Query: 25  LHVASAYGHVDFVKEII--NVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLC 82
           L  A+  GH+D VKE++  + R  +A + N+ G+ P+HIA+  GH  +V  LL  +  L 
Sbjct: 133 LFTAADKGHLDVVKELLKYSSRESIAKK-NRSGYDPLHIAAIQGHHAIVEVLLDHDATLS 191

Query: 83  HQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVL 142
              GP   TPL  AA++G   V++++LS     +E     +  ALHLA +    E I  L
Sbjct: 192 QTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLEISRSNNKNALHLAARQGHVEVIKAL 251

Query: 143 VNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRKELL 179
           ++     K  ++    D++G T LH+A  K Q  E++
Sbjct: 252 LS-----KDPQLARRIDKKGQTALHMAV-KGQSSEVV 282





Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=3 Back     alignment and function description
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1 Back     alignment and function description
>sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 Back     alignment and function description
>sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
224114660 448 predicted protein [Populus trichocarpa] 0.963 0.705 0.437 1e-87
147791225394 hypothetical protein VITISV_030400 [Viti 0.881 0.733 0.432 8e-78
359490025 450 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.926 0.675 0.384 5e-70
255539939320 ankyrin repeat-containing protein, putat 0.524 0.537 0.606 5e-57
387169523411 hypothetical protein 11M19.23, partial [ 0.832 0.664 0.344 8e-56
15241393 442 ankyrin repeat-containing protein [Arabi 0.835 0.619 0.343 2e-54
387169570 435 hypothetical protein 34G24.15 [Capsella 0.929 0.701 0.324 3e-54
224134294218 predicted protein [Populus trichocarpa] 0.503 0.756 0.581 4e-51
224114656169 predicted protein [Populus trichocarpa] 0.439 0.852 0.576 6e-41
224136414 459 predicted protein [Populus trichocarpa] 0.506 0.361 0.470 3e-39
>gi|224114660|ref|XP_002332335.1| predicted protein [Populus trichocarpa] gi|222832582|gb|EEE71059.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  329 bits (843), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 176/402 (43%), Positives = 232/402 (57%), Gaps = 86/402 (21%)

Query: 12  FLVKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVV 71
           F++    L   NPL++A+A GHVDFVKEII ++P  A EVNQ+GFSPMHIA+  G   + 
Sbjct: 26  FILNNTQLSAENPLNIAAAMGHVDFVKEIIRLKPVFAIEVNQEGFSPMHIAADNGQVEIA 85

Query: 72  RELLKVEQKLCHQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAI 131
           +EL++V+ KLC  +G +K TP H AAI+G+  V+S MLS CP+CIED T + ++ALHLA+
Sbjct: 86  KELMEVDIKLCRLEGRQKMTPFHHAAIRGRAEVISLMLSGCPDCIEDETERRESALHLAV 145

Query: 132 KNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRK--ELLLGHGTYSSGR 189
           +NN+FEAI  LV+WIR M +E + NMKDEQGNTVLHLA+ KKQR+  E+ LG G+ S+G 
Sbjct: 146 RNNRFEAIKKLVDWIREMNKEYLLNMKDEQGNTVLHLASWKKQRRVIEIFLGSGSASTGS 205

Query: 190 LELIALHQ------------------------------QRQLDS---------------- 203
           LE+ A++                                R  DS                
Sbjct: 206 LEVNAINHTGITALDVILLFPSEAGDREIVEILRSAGAMRARDSVPSTVTNSQTSTDNPS 265

Query: 204 --------RHDFVEYFKFKKGRDSPGETRSALLVVAALVATTSFQFGVNPPGG------- 248
                   R + VEYFKFKK RDSP E R  LLV+A LVAT +FQ GV PPGG       
Sbjct: 266 TPERCWSNRDNLVEYFKFKKDRDSPSEARGTLLVIAVLVATATFQVGVGPPGGVWQDTSI 325

Query: 249 -----------------------NAVAFALFMFFNSLGFKLSIYMIIILTTKFPLQLGLQ 285
                                  N V F LF+FFNS+GF +S+YM+ +LT+KFPLQ  LQ
Sbjct: 326 PDQKNITSNNTAHFAGQSIMATTNTVGFMLFVFFNSVGFSMSLYMLYVLTSKFPLQFELQ 385

Query: 286 LCFLAMYFTYDTAVIATTPVGIRIFIIVTEAIIPALIPLTAR 327
           +C LAMY TY TA+    P  + +F+ +T  I+ + +   AR
Sbjct: 386 ICLLAMYCTYGTALSCIVPSNLYLFVQLTTTILSSTMSALAR 427




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147791225|emb|CAN70132.1| hypothetical protein VITISV_030400 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490025|ref|XP_003634016.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255539939|ref|XP_002511034.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223550149|gb|EEF51636.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|387169523|gb|AFJ66184.1| hypothetical protein 11M19.23, partial [Arabidopsis halleri] Back     alignment and taxonomy information
>gi|15241393|ref|NP_199929.1| ankyrin repeat-containing protein [Arabidopsis thaliana] gi|8843852|dbj|BAA97378.1| unnamed protein product [Arabidopsis thaliana] gi|45825143|gb|AAS77479.1| At5g51160 [Arabidopsis thaliana] gi|51968476|dbj|BAD42930.1| putative protein [Arabidopsis thaliana] gi|62319991|dbj|BAD94109.1| putative protein [Arabidopsis thaliana] gi|332008662|gb|AED96045.1| ankyrin repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|387169570|gb|AFJ66229.1| hypothetical protein 34G24.15 [Capsella rubella] Back     alignment and taxonomy information
>gi|224134294|ref|XP_002321784.1| predicted protein [Populus trichocarpa] gi|222868780|gb|EEF05911.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114656|ref|XP_002332334.1| predicted protein [Populus trichocarpa] gi|222832581|gb|EEE71058.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224136414|ref|XP_002326854.1| predicted protein [Populus trichocarpa] gi|222835169|gb|EEE73604.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
TAIR|locus:2176252 442 AT5G51160 "AT5G51160" [Arabido 0.451 0.334 0.406 6.7e-45
TAIR|locus:2132711445 AT4G10720 "AT4G10720" [Arabido 0.466 0.343 0.368 7.1e-29
TAIR|locus:2012557436 AT1G14500 "AT1G14500" [Arabido 0.478 0.360 0.385 1.5e-26
TAIR|locus:2172099431 AT5G54620 [Arabidopsis thalian 0.475 0.361 0.379 1.9e-26
TAIR|locus:2172089426 ANK "ankyrin" [Arabidopsis tha 0.466 0.359 0.386 2.5e-26
TAIR|locus:2180882457 AT5G15500 [Arabidopsis thalian 0.478 0.343 0.358 3.4e-26
TAIR|locus:2012532441 AT1G14480 "AT1G14480" [Arabido 0.478 0.356 0.359 3.7e-26
TAIR|locus:2170081 535 AT5G50140 "AT5G50140" [Arabido 0.472 0.289 0.301 1.4e-15
TAIR|locus:2026489 543 AT1G07710 "AT1G07710" [Arabido 0.503 0.303 0.319 1.8e-14
TAIR|locus:2092522 590 ITN1 "INCREASED TOLERANCE TO N 0.451 0.250 0.331 9e-14
TAIR|locus:2176252 AT5G51160 "AT5G51160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 308 (113.5 bits), Expect = 6.7e-45, Sum P(2) = 6.7e-45
 Identities = 61/150 (40%), Positives = 98/150 (65%)

Query:    50 EVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHQQGPEKNTPLHCAAIKGKVHVLSEML 109
             +++++GFSP+H A++ G    VR  L VE+KLC  +  +  TPLH A ++GK+ V+ E++
Sbjct:    42 DLDKNGFSPLHAAAAAGQVETVRATLGVEKKLCRLKDRDGKTPLHVATMRGKIDVIREIV 101

Query:   110 SACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLA 169
             ++C +C+ED T+Q  TALHLA+ + + EA+  +V  I    R ++ N KDEQGNT LHLA
Sbjct:   102 ASCVDCLEDETVQGQTALHLAVLHLEIEAVIAIVELITETNRFDVLNKKDEQGNTALHLA 161

Query:   170 TRKKQRK--ELLLGHGTYSSGRLELIALHQ 197
             T +K R+  E+L+      S   E+ A+++
Sbjct:   162 TWRKNRQVIEVLVQAIPEESRSFEVNAMNK 191


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0006826 "iron ion transport" evidence=RCA
GO:0010043 "response to zinc ion" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2132711 AT4G10720 "AT4G10720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012557 AT1G14500 "AT1G14500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172099 AT5G54620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172089 ANK "ankyrin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180882 AT5G15500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012532 AT1G14480 "AT1G14480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170081 AT5G50140 "AT5G50140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-12
pfam13962114 pfam13962, PGG, Domain of unknown function 2e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 85.1 bits (211), Expect = 2e-20
 Identities = 38/121 (31%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 23  NPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLC 82
            PLH+A++ GH++ VK ++    D+ +  + DG +P+H+A+  GH  +V+ LL+ +    
Sbjct: 9   TPLHLAASNGHLEVVKLLLENGADV-NAKDNDGRTPLHLAAKNGHLEIVKLLLE-KGADV 66

Query: 83  HQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVL 142
           + +  + NTPLH AA  G + V+ ++L      +        T LHLA KN   E + +L
Sbjct: 67  NARDKDGNTPLHLAARNGNLDVV-KLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKLL 125

Query: 143 V 143
           +
Sbjct: 126 L 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 328
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 99.98
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.98
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02791284 ankyrin-like protein; Provisional 99.97
KOG0510 929 consensus Ankyrin repeat protein [General function 99.96
PHA02875413 ankyrin repeat protein; Provisional 99.96
PHA02874434 ankyrin repeat protein; Provisional 99.96
PHA02875413 ankyrin repeat protein; Provisional 99.96
PHA02946446 ankyin-like protein; Provisional 99.96
PHA02878477 ankyrin repeat protein; Provisional 99.96
PHA02874434 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02878477 ankyrin repeat protein; Provisional 99.95
PHA03100480 ankyrin repeat protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.95
PHA03100480 ankyrin repeat protein; Provisional 99.95
PHA02798489 ankyrin-like protein; Provisional 99.95
PHA02798489 ankyrin-like protein; Provisional 99.94
PHA02989494 ankyrin repeat protein; Provisional 99.94
PHA02946 446 ankyin-like protein; Provisional 99.94
PHA03095471 ankyrin-like protein; Provisional 99.94
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
PHA02876682 ankyrin repeat protein; Provisional 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.94
PHA03095 471 ankyrin-like protein; Provisional 99.93
PHA02989494 ankyrin repeat protein; Provisional 99.93
KOG0508 615 consensus Ankyrin repeat protein [General function 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
PHA02917 661 ankyrin-like protein; Provisional 99.93
KOG0508 615 consensus Ankyrin repeat protein [General function 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.93
PHA02876 682 ankyrin repeat protein; Provisional 99.92
PHA02741169 hypothetical protein; Provisional 99.92
PHA02743166 Viral ankyrin protein; Provisional 99.91
KOG0514452 consensus Ankyrin repeat protein [General function 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.89
PHA02884300 ankyrin repeat protein; Provisional 99.89
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.89
PHA02795437 ankyrin-like protein; Provisional 99.89
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.88
PHA02741169 hypothetical protein; Provisional 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.88
PHA02743166 Viral ankyrin protein; Provisional 99.88
PHA02730 672 ankyrin-like protein; Provisional 99.87
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.87
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.87
PHA02917 661 ankyrin-like protein; Provisional 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.86
PHA02730672 ankyrin-like protein; Provisional 99.86
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.85
PHA02792631 ankyrin-like protein; Provisional 99.84
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.84
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.84
PF13962113 PGG: Domain of unknown function 99.84
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.83
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.83
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.82
PHA02884300 ankyrin repeat protein; Provisional 99.82
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.82
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.81
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.8
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.8
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.79
KOG0514452 consensus Ankyrin repeat protein [General function 99.77
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.77
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.75
PHA02792631 ankyrin-like protein; Provisional 99.75
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.66
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.64
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.63
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.61
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.58
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.54
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.53
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.53
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.52
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.5
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.5
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.49
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.47
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.45
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.43
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.35
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.96
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.94
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.92
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.9
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.9
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.89
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.82
PF1360630 Ank_3: Ankyrin repeat 98.8
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.79
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.75
KOG0522 560 consensus Ankyrin repeat protein [General function 98.69
PF1360630 Ank_3: Ankyrin repeat 98.62
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.56
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.54
KOG0522 560 consensus Ankyrin repeat protein [General function 98.52
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.4
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.37
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.26
KOG0511 516 consensus Ankyrin repeat protein [General function 98.21
KOG0520975 consensus Uncharacterized conserved protein, conta 98.21
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.21
KOG2384223 consensus Major histocompatibility complex protein 98.2
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.2
KOG2384223 consensus Major histocompatibility complex protein 98.06
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.03
KOG0511 516 consensus Ankyrin repeat protein [General function 97.78
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.1
KOG2505591 consensus Ankyrin repeat protein [General function 96.91
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.86
KOG2505591 consensus Ankyrin repeat protein [General function 95.99
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.04
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.33
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.32
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 89.03
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.46
COG429895 Uncharacterized protein conserved in bacteria [Fun 84.71
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=3e-38  Score=245.08  Aligned_cols=173  Identities=27%  Similarity=0.345  Sum_probs=156.9

Q ss_pred             hhhHHHHHHHhhccC-CCChHHHHHHHcCCHHHHHHHHhcCCCcccccCCCCCcHHHHHHHCCCHHHHHHHHHc-Ccccc
Q 046832            5 TAIKAFIFLVKLKAL-RKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKV-EQKLC   82 (328)
Q Consensus         5 ~~~~~~~~~~~~~~~-~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~Aa~~g~~~iv~~Ll~~-~~~~~   82 (328)
                      -+++..++.++.+++ +|+||||+||..|+.+++++|+++-.-..+.+|..||||||.||+.|+.++|+.|+.+ |+++ 
T Consensus        21 el~~s~~kSL~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~adv-   99 (226)
T KOG4412|consen   21 ELIQSDPKSLNARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADV-   99 (226)
T ss_pred             HHHhcChhhhhccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCc-
Confidence            344555667777777 9999999999999999999999754444577899999999999999999999999998 8888 


Q ss_pred             ccCCCCCCCHHHHHHHcCcHHHHHHHHHhCCcccccccCCCCCHHHHHHHcCChhhHHHHHHhhhcCccccccccccCCC
Q 046832           83 HQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQG  162 (328)
Q Consensus        83 ~~~~~~g~tpLh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~d~~G  162 (328)
                      +..++.|.||||+|+.+|+.|+.++|+++++. ++.+|..|.||||-|+.-|..+++++|+.      .++.+|.+|+.|
T Consensus       100 na~tn~G~T~LHyAagK~r~eIaqlLle~ga~-i~~kD~~~qtplHRAAavGklkvie~Li~------~~a~~n~qDk~G  172 (226)
T KOG4412|consen  100 NATTNGGQTCLHYAAGKGRLEIAQLLLEKGAL-IRIKDKQGQTPLHRAAAVGKLKVIEYLIS------QGAPLNTQDKYG  172 (226)
T ss_pred             ceecCCCcceehhhhcCChhhHHHHHHhcCCC-CcccccccCchhHHHHhccchhhHHHHHh------cCCCCCcccccC
Confidence            99999999999999999999999999999976 99999999999999999999999999998      678899999999


Q ss_pred             CchhhHHhhccchh--HHhhcCCCC
Q 046832          163 NTVLHLATRKKQRK--ELLLGHGTY  185 (328)
Q Consensus       163 ~T~Lh~A~~~~~~~--~~Ll~~ga~  185 (328)
                      +||||+|.-.++.+  .+|+++|++
T Consensus       173 ~TpL~~al~e~~~d~a~lLV~~gAd  197 (226)
T KOG4412|consen  173 FTPLHHALAEGHPDVAVLLVRAGAD  197 (226)
T ss_pred             ccHHHHHHhccCchHHHHHHHhccc
Confidence            99999997777777  899999983



>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG4298 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-09
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 6e-09
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-08
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-07
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-07
1uoh_A226 Human Gankyrin Length = 226 2e-07
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 9e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-04
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-04
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-06
2xee_A157 Structural Determinants For Improved Thermal Stabil 5e-06
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 9e-06
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-05
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-05
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-05
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-05
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-05
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 6e-05
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 6e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 7e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 7e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 8e-05
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 8e-05
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 9e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-04
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-04
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 8e-04
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-04
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-04
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-04
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 2e-04
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-04
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-04
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 4e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-04
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 6e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 59.3 bits (142), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 55/181 (30%), Positives = 92/181 (50%), Gaps = 21/181 (11%) Query: 24 PLHVASAYGHVDFVKEII--NVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKL 81 PLHVAS GH+ VK ++ P+++ N +P+H+A+ GHT V + LL+ + K+ Sbjct: 17 PLHVASFMGHLPIVKNLLQRGASPNVS---NVKVETPLHMAARAGHTEVAKYLLQNKAKV 73 Query: 82 CHQQGPEKNTPLHCAAIKGKVHVLSEML--SACPECIEDVTIQHDTALHLAIKNNQFEAI 139 + + + TPLHCAA G +++ +L +A P T T LH+A + E + Sbjct: 74 -NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNL---ATTAGHTPLHIAAREGHVETV 129 Query: 140 TVLVNWIRGMKREEIFNMKDEQGNTVLHLATR--KKQRKELLLGHGTY--SSGRLELIAL 195 L +++E ++G T LH+A + K + ELLL + ++G+ L L Sbjct: 130 LAL------LEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPL 183 Query: 196 H 196 H Sbjct: 184 H 184
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-25
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-24
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-20
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-13
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-23
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-22
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-22
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-22
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-22
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-22
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-21
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-21
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-18
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-18
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-20
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-20
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-20
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-20
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-20
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-20
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-20
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-19
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-19
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-09
2rfa_A232 Transient receptor potential cation channel subfa 1e-18
2rfa_A232 Transient receptor potential cation channel subfa 2e-18
2rfa_A232 Transient receptor potential cation channel subfa 2e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-18
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-17
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-17
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-17
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-16
2etb_A256 Transient receptor potential cation channel subfam 2e-16
2etb_A256 Transient receptor potential cation channel subfam 3e-14
2etb_A256 Transient receptor potential cation channel subfam 6e-09
2etb_A256 Transient receptor potential cation channel subfam 4e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-09
2pnn_A273 Transient receptor potential cation channel subfa 4e-16
2pnn_A273 Transient receptor potential cation channel subfa 2e-15
2pnn_A273 Transient receptor potential cation channel subfa 3e-15
2pnn_A273 Transient receptor potential cation channel subfa 3e-12
2pnn_A273 Transient receptor potential cation channel subfa 1e-08
2pnn_A273 Transient receptor potential cation channel subfa 1e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-12
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-04
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
 Score = 97.5 bits (244), Expect = 9e-25
 Identities = 37/175 (21%), Positives = 74/175 (42%), Gaps = 36/175 (20%)

Query: 24  PLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCH 83
            +H  +A G +D +KE +    +L ++ ++ GF+P+  AS+ G    VR LL+       
Sbjct: 5   SIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLE------- 57

Query: 84  QQGPEKN-------TPLHCAAIKGKVHVLSEMLSACPECIE---DVTIQHD---TALHLA 130
             G + +       + L  A+  G   ++  +L      +E   D+ I      T L  A
Sbjct: 58  -WGADPHILAKERESALSLASTGGYTDIV-GLL------LERDVDINIYDWNGGTPLLYA 109

Query: 131 IKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRK--ELLLGHG 183
           ++ N  + +  L+      +  ++   + + G T + LA     RK  +++  H 
Sbjct: 110 VRGNHVKCVEALLA-----RGADL-TTEADSGYTPMDLAVALGYRKVQQVIENHI 158


>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.98
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.98
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.98
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.98
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.98
2rfa_A232 Transient receptor potential cation channel subfa 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.97
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.96
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.96
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.86
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.85
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.85
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.81
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.79
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=3.4e-35  Score=238.75  Aligned_cols=154  Identities=29%  Similarity=0.437  Sum_probs=146.3

Q ss_pred             hHHHHHHHcCCHHHHHHHHhcCCCcccccCCCCCcHHHHHHHCCCHHHHHHHHHcCccccccCCCCCCCHHHHHHHcCcH
Q 046832           23 NPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCHQQGPEKNTPLHCAAIKGKV  102 (328)
Q Consensus        23 t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~Aa~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpLh~Aa~~g~~  102 (328)
                      ++|+.||+.|+.++|+.|++.|.++ +.+|.+|+||||+|+..|+.+++++|++.|+++ +.+|.+|.||||+|+..|+.
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~Gadv-n~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~-~~~d~~g~TpLh~A~~~g~~   83 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIENGADV-NASDSDGRTPLHHAAENGHKEVVKLLISKGADV-NAKDSDGRTPLHHAAENGHK   83 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTCH
T ss_pred             HHHHHHHHcCCHHHHHHHHHCCCCC-CCcCCCCCCHHHHHHHcCCHHHHHHHHhcccch-hhhccCCCCHHHHHHHcCCH
Confidence            4799999999999999999999998 899999999999999999999999999999998 99999999999999999999


Q ss_pred             HHHHHHHHhCCcccccccCCCCCHHHHHHHcCChhhHHHHHHhhhcCccccccccccCCCCchhhHHhhccchh--HHhh
Q 046832          103 HVLSEMLSACPECIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRK--ELLL  180 (328)
Q Consensus       103 ~~v~~Ll~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~d~~G~T~Lh~A~~~~~~~--~~Ll  180 (328)
                      +++++|++.+++ ++.+|.+|+||||+|+++|+.+++++|++      .|++++.+|.+|+||||+|+..++.+  ++|+
T Consensus        84 ~~v~~Ll~~gad-vn~~d~~G~TpLh~A~~~g~~~~v~~Ll~------~gad~~~~d~~G~TpL~~A~~~g~~~iv~~Ll  156 (169)
T 4gpm_A           84 EVVKLLISKGAD-VNAKDSDGRTPLHHAAENGHKEVVKLLIS------KGADVNTSDSDGRTPLDLAREHGNEEVVKLLE  156 (169)
T ss_dssp             HHHHHHHHTTCC-TTCCCTTSCCHHHHHHHTTCHHHHHHHHH------TTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHHHHCcCC-CCCCCCCCCCHHHHHHHcCCHHHHHHHHH------cCCCccccCCCCCCHHHHHHHcCCHHHHHHHH
Confidence            999999999998 89999999999999999999999999998      68889999999999999999999999  9999


Q ss_pred             cCCCC
Q 046832          181 GHGTY  185 (328)
Q Consensus       181 ~~ga~  185 (328)
                      ++|+.
T Consensus       157 ~~GA~  161 (169)
T 4gpm_A          157 KQGGW  161 (169)
T ss_dssp             TC---
T ss_pred             HCCCC
Confidence            99994



>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 328
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.004
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 6e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 80.8 bits (198), Expect = 1e-17
 Identities = 55/239 (23%), Positives = 91/239 (38%), Gaps = 47/239 (19%)

Query: 24  PLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKLCH 83
           PLHVAS  GH+  VK ++       +  N    +P+H+A+  GHT V + LL+ + K+ +
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGASP-NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV-N 60

Query: 84  QQGPEKNTPLHCAAIKGKVHVLSEMLSACPE----------------------------- 114
            +  +  TPLHCAA  G  +++  +L                                  
Sbjct: 61  AKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLE 120

Query: 115 ---CIEDVTIQHDTALHLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATR 171
                  +T +  T LH+A K  +     +L+      +R+   N   + G T LH+A  
Sbjct: 121 KEASQACMTKKGFTPLHVAAKYGKVRVAELLL------ERDAHPNAAGKNGLTPLHVAVH 174

Query: 172 KKQRK--ELLLGHG-----TYSSGRLELIALHQQRQLDSRHDFVEYFKFKKGRDSPGET 223
                  +LLL  G        +G   L    +Q Q++     ++Y          G T
Sbjct: 175 HNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVT 233


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.9
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.89
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.87
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.87
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.85
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=2.5e-32  Score=233.94  Aligned_cols=165  Identities=19%  Similarity=0.238  Sum_probs=126.0

Q ss_pred             HhhccCCCChHHHHHHHcCCHHHHHHHHhcCCCcccccCCCCCcHHHHHHHCCCHHHHHHHHHcCccc------------
Q 046832           14 VKLKALRKGNPLHVASAYGHVDFVKEIINVRPDLAHEVNQDGFSPMHIASSIGHTGVVRELLKVEQKL------------   81 (328)
Q Consensus        14 ~~~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~Aa~~g~~~iv~~Ll~~~~~~------------   81 (328)
                      ++.+|..|+||||+|+..|+.++++.|++.|.++ +..|.+|.||||+|+..|+.+++++|++.+...            
T Consensus        38 i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i-~~~d~~g~tpL~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~  116 (255)
T d1oy3d_          38 LDLQNDLGQTALHLAAILGEASTVEKLYAAGAGV-LVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQS  116 (255)
T ss_dssp             GGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCS-SCCCTTSCCHHHHHTTTTCHHHHHHHSSSCCSSCCCC--------
T ss_pred             ccCcCCCCCCccchHHhhcccccccccccccccc-cccccccchhhhhhhccCchHHHHHHHhhccchhcccchhhhhHH
Confidence            5566677777777777777777777777777776 667777777777777777777777776543211            


Q ss_pred             ----------------------------------cccCCCCCCCHHHHHHHcCcHHHHHHHHHhCCcccccccCCCCCHH
Q 046832           82 ----------------------------------CHQQGPEKNTPLHCAAIKGKVHVLSEMLSACPECIEDVTIQHDTAL  127 (328)
Q Consensus        82 ----------------------------------~~~~~~~g~tpLh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~L  127 (328)
                                                        .+.+|.+|.||||+|++.|+.+++++|++.+.+.....+..|+|||
T Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL  196 (255)
T d1oy3d_         117 QDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPL  196 (255)
T ss_dssp             ---------------------------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHH
T ss_pred             hhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCcccccccccccccccccchhcccccccccccccccccc
Confidence                                              1345667888888888888888888888888775555667788888


Q ss_pred             HHHHHcCChhhHHHHHHhhhcCccccccccccCCCCchhhHHhhccchh--HHhhcCCCC
Q 046832          128 HLAIKNNQFEAITVLVNWIRGMKREEIFNMKDEQGNTVLHLATRKKQRK--ELLLGHGTY  185 (328)
Q Consensus       128 h~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~d~~G~T~Lh~A~~~~~~~--~~Ll~~ga~  185 (328)
                      |+|++.|+.+++++|++      .|+++|.+|.+|+||||+|+..++.+  ++|+++||+
T Consensus       197 ~~A~~~~~~~~v~~Ll~------~gadin~~d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga~  250 (255)
T d1oy3d_         197 HLAVEAQAASVLELLLK------AGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAP  250 (255)
T ss_dssp             HHHHHTTCHHHHHHHHH------TTCCTTCCCTTSCCHHHHHHTSSCHHHHHHHHHTTCC
T ss_pred             cccccccHHHHHHHHHH------CCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHcCCC
Confidence            88888888888888887      56778888888888888888888888  888888884



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure