Citrus Sinensis ID: 046870


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDPVTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLREKAKAMGSISKKGTSKL
ccccccEEEEEEccccccccccccccccccccccHHHHHHHHHcccccccccEEEEEEccccccccccccccEEEEEEEcccccHHcccccHHHHHHHcccccccccEEEEcccccEEEEcccccEEEEccccccHHHHHHHHHccccEEEEEEEEccccccccEEEEEEEEcccccccHHHHHHHHHccccccccccEEEEccccccccccccHHHHHHHHHHcccccccccccc
cccccEEEEEEccccccccccEEccccHcHccccHHHHHHHHHHcccccccccccEEccccccccccccccEEEEEEEEcccEEccccccHHHHHHHHccccEEEEEEEEEcccccEEEEEEHHHcEEEccEEEcHHHHHHHHcccccEEEEEEEEEEEcccEEEEEEEEEEcccccccHHHHHHHHHHHccccccccEEEEcccccccccHHHHHHHHHHHHHHccccccccccc
MEELGFTLTHaygltetygpgtvcvwkpdwnslprEEQAKIKarqgvphlgldeidikdpvtmksvpsdaktIGEVMFRGNTVMNGYLKNLKAtqdafdggwfrsgdlgvrhpdgyielkdRSKDIIisggenistIEVESVLfshpsvleaavvgrpddhwgetpcaFVKLKDGCVANGEEIINYCRdrlphymaprtvvfedlpktstgktqKYVLREKAKAmgsiskkgtskl
MEELGFTLTHAygltetygpgTVCVWKPDWNSLPREEQAKIkarqgvphlgldeidikdpvtmksvpsdaktigevMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTvvfedlpktstgktqkyvlrekakamgsiskkgtskl
MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDPVTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLREKAKAMGSISKKGTSKL
****GFTLTHAYGLTETYGPGTVCVWKPDWNSL************GVPHLGLDEIDIKDPVT*******AKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFEDL*******************************
MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDPVTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLREKAK*************
MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDPVTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLREKAK*************
**ELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDPVTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLREKAKAMG**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDPVTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLREKAKAMGSISKKGTSKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query236 2.2.26 [Sep-21-2011]
F4HUK6556 Probable acyl-activating yes no 1.0 0.424 0.783 1e-112
Q9SEY5603 Probable acyl-activating no no 0.966 0.378 0.694 6e-95
Q8VZF1569 Acetate/butyrate--CoA lig no no 0.974 0.404 0.574 4e-81
Q9LQS1544 Probable acyl-activating no no 0.949 0.411 0.581 1e-74
Q9FFE6552 Probable acyl-activating no no 0.957 0.409 0.558 4e-73
Q9FFE9550 Probable acyl-activating no no 0.953 0.409 0.557 2e-71
Q9C8D4572 Butyrate--CoA ligase AAE1 no no 0.953 0.393 0.550 4e-71
Q9SS00578 Probable acyl-activating no no 0.953 0.389 0.529 8e-70
Q9C9G2535 Probable acyl-activating no no 0.953 0.420 0.525 1e-68
Q9LPK7549 Probable acyl-activating no no 0.953 0.409 0.549 2e-68
>sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 Back     alignment and function desciption
 Score =  405 bits (1040), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/236 (78%), Positives = 216/236 (91%)

Query: 1   MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDP 60
           MEELGF++ H+YGLTETYGPGT+C WKP+W+SLPREEQAK+KARQGV HLGL+EI +KDP
Sbjct: 321 MEELGFSMFHSYGLTETYGPGTICTWKPEWDSLPREEQAKMKARQGVNHLGLEEIQVKDP 380

Query: 61  VTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELK 120
           VTM+++P+D  T+GEV+FRGNTVMNGYLKN +AT++AF GGWF SGDLGV+HPDGYIELK
Sbjct: 381 VTMRTLPADGVTMGEVVFRGNTVMNGYLKNPEATKEAFKGGWFWSGDLGVKHPDGYIELK 440

Query: 121 DRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANG 180
           DRSKDIIISGGENIS+IEVES LF+HP VLEAAVV RPD++WGET CAFVKLKDG  A+ 
Sbjct: 441 DRSKDIIISGGENISSIEVESTLFTHPCVLEAAVVARPDEYWGETACAFVKLKDGSKASA 500

Query: 181 EEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLREKAKAMGSISKKGTSKL 236
           EE+I+YCRDRLPHYMAPR++VFEDLPKTSTGK QK+VLR KAKA+ S+SKKG SKL
Sbjct: 501 EELISYCRDRLPHYMAPRSIVFEDLPKTSTGKVQKFVLRTKAKALVSLSKKGRSKL 556




May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: -
>sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 Back     alignment and function description
>sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 Back     alignment and function description
>sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 Back     alignment and function description
>sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
255539206 551 AMP dependent ligase, putative [Ricinus 1.0 0.428 0.847 1e-118
224086034 552 predicted protein [Populus trichocarpa] 1.0 0.427 0.835 1e-116
225457528 566 PREDICTED: putative acyl-CoA synthetase 1.0 0.416 0.805 1e-114
297850474 555 adenosine monophosphate binding protein 1.0 0.425 0.783 1e-111
356497397 553 PREDICTED: medium-chain-fatty-acid--CoA 1.0 0.426 0.775 1e-111
356538992 553 PREDICTED: medium-chain-fatty-acid--CoA 1.0 0.426 0.775 1e-111
18394877 556 acyl activating enzyme 1 [Arabidopsis th 1.0 0.424 0.783 1e-111
13937177 556 At1g20560/F2D10_4 [Arabidopsis thaliana] 1.0 0.424 0.783 1e-110
8886956 581 F2D10.4 [Arabidopsis thaliana] 1.0 0.406 0.783 1e-110
8778599 579 F5M15.12 [Arabidopsis thaliana] 1.0 0.407 0.783 1e-110
>gi|255539206|ref|XP_002510668.1| AMP dependent ligase, putative [Ricinus communis] gi|223551369|gb|EEF52855.1| AMP dependent ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/236 (84%), Positives = 219/236 (92%)

Query: 1   MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDP 60
           MEELGF +TH+YGLTETYGPGTVC WKP+W SLPR+ QAKIKARQG+ HLG++E+DIKDP
Sbjct: 316 MEELGFNVTHSYGLTETYGPGTVCTWKPEWTSLPRDVQAKIKARQGLQHLGIEEVDIKDP 375

Query: 61  VTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELK 120
           VTMKSVP DAKTIGEVMFRGNTVMNGYLKNL+AT++AF GGWFRSGDLGV+HPDGYIELK
Sbjct: 376 VTMKSVPPDAKTIGEVMFRGNTVMNGYLKNLRATEEAFKGGWFRSGDLGVKHPDGYIELK 435

Query: 121 DRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANG 180
           DRSKDIIISGGENISTIEVESVLFSHP+VLEAAVVG PDDHWGETPCAFVKLKDGC A+ 
Sbjct: 436 DRSKDIIISGGENISTIEVESVLFSHPAVLEAAVVGSPDDHWGETPCAFVKLKDGCNASA 495

Query: 181 EEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLREKAKAMGSISKKGTSKL 236
           +E+I YCRD LPHYMAPRTV+FEDLPKTSTGK QKYVLR+KA A GS+SK  TSKL
Sbjct: 496 QELIKYCRDHLPHYMAPRTVLFEDLPKTSTGKVQKYVLRKKASATGSLSKHKTSKL 551




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224086034|ref|XP_002307787.1| predicted protein [Populus trichocarpa] gi|222857236|gb|EEE94783.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225457528|ref|XP_002270022.1| PREDICTED: putative acyl-CoA synthetase YngI-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297850474|ref|XP_002893118.1| adenosine monophosphate binding protein 1 AMPBP1 [Arabidopsis lyrata subsp. lyrata] gi|297338960|gb|EFH69377.1| adenosine monophosphate binding protein 1 AMPBP1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356497397|ref|XP_003517547.1| PREDICTED: medium-chain-fatty-acid--CoA ligase-like [Glycine max] Back     alignment and taxonomy information
>gi|356538992|ref|XP_003537984.1| PREDICTED: medium-chain-fatty-acid--CoA ligase-like [Glycine max] Back     alignment and taxonomy information
>gi|18394877|ref|NP_564116.1| acyl activating enzyme 1 [Arabidopsis thaliana] gi|378548264|sp|F4HUK6.1|AAE1_ARATH RecName: Full=Probable acyl-activating enzyme 1, peroxisomal; AltName: Full=AMP-binding protein 1; Short=AtAMPBP1 gi|332191865|gb|AEE29986.1| acyl activating enzyme 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|13937177|gb|AAK50082.1|AF372942_1 At1g20560/F2D10_4 [Arabidopsis thaliana] gi|18700260|gb|AAL77740.1| At1g20560/F2D10_4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8886956|gb|AAF80642.1|AC069251_35 F2D10.4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8778599|gb|AAF79607.1|AC027665_8 F5M15.12 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
TAIR|locus:2030407556 AAE1 "acyl activating enzyme 1 1.0 0.424 0.783 3.7e-103
TAIR|locus:2057249603 AT2G17650 [Arabidopsis thalian 0.966 0.378 0.694 3.6e-89
TAIR|locus:2086122569 AAE7 "acyl-activating enzyme 7 0.974 0.404 0.574 8.1e-76
TIGR_CMR|SPO_0677542 SPO_0677 "AMP-binding protein" 0.953 0.415 0.604 2.1e-75
UNIPROTKB|Q47WB3541 CPS_4259 "AMP-binding protein" 0.940 0.410 0.567 4.8e-71
TIGR_CMR|CPS_4259541 CPS_4259 "AMP-binding protein" 0.940 0.410 0.567 4.8e-71
TAIR|locus:2204360544 AT1G75960 [Arabidopsis thalian 0.949 0.411 0.581 5.5e-70
TAIR|locus:2171402552 AAE5 "acyl activating enzyme 5 0.957 0.409 0.558 8e-69
TAIR|locus:2171357550 AT5G16340 [Arabidopsis thalian 0.953 0.409 0.557 2.4e-67
TAIR|locus:2013860572 AAE11 "acyl-activating enzyme 0.953 0.393 0.550 3.1e-67
TAIR|locus:2030407 AAE1 "acyl activating enzyme 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1022 (364.8 bits), Expect = 3.7e-103, P = 3.7e-103
 Identities = 185/236 (78%), Positives = 216/236 (91%)

Query:     1 MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDP 60
             MEELGF++ H+YGLTETYGPGT+C WKP+W+SLPREEQAK+KARQGV HLGL+EI +KDP
Sbjct:   321 MEELGFSMFHSYGLTETYGPGTICTWKPEWDSLPREEQAKMKARQGVNHLGLEEIQVKDP 380

Query:    61 VTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELK 120
             VTM+++P+D  T+GEV+FRGNTVMNGYLKN +AT++AF GGWF SGDLGV+HPDGYIELK
Sbjct:   381 VTMRTLPADGVTMGEVVFRGNTVMNGYLKNPEATKEAFKGGWFWSGDLGVKHPDGYIELK 440

Query:   121 DRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANG 180
             DRSKDIIISGGENIS+IEVES LF+HP VLEAAVV RPD++WGET CAFVKLKDG  A+ 
Sbjct:   441 DRSKDIIISGGENISSIEVESTLFTHPCVLEAAVVARPDEYWGETACAFVKLKDGSKASA 500

Query:   181 EEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLREKAKAMGSISKKGTSKL 236
             EE+I+YCRDRLPHYMAPR++VFEDLPKTSTGK QK+VLR KAKA+ S+SKKG SKL
Sbjct:   501 EELISYCRDRLPHYMAPRSIVFEDLPKTSTGKVQKFVLRTKAKALVSLSKKGRSKL 556




GO:0003824 "catalytic activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016208 "AMP binding" evidence=ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
TAIR|locus:2057249 AT2G17650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086122 AAE7 "acyl-activating enzyme 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0677 SPO_0677 "AMP-binding protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q47WB3 CPS_4259 "AMP-binding protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4259 CPS_4259 "AMP-binding protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TAIR|locus:2204360 AT1G75960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171402 AAE5 "acyl activating enzyme 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171357 AT5G16340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013860 AAE11 "acyl-activating enzyme 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
F4HUK6AAE1_ARATH6, ., 2, ., 1, ., -0.78381.00.4244yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
cd12118520 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt 1e-152
PRK08162545 PRK08162, PRK08162, acyl-CoA synthetase; Validated 1e-143
PLN02479567 PLN02479, PLN02479, acetate-CoA ligase 1e-126
PLN03102579 PLN03102, PLN03102, acyl-activating enzyme; Provis 5e-96
PRK06187521 PRK06187, PRK06187, long-chain-fatty-acid--CoA lig 1e-79
cd12119517 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth 1e-75
cd05929342 cd05929, BACL_like, Bacterial Bile acid CoA ligase 9e-75
cd05915509 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetase 3e-73
cd05917347 cd05917, FACL_like_2, Uncharacterized subfamily of 4e-73
COG0318534 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ 5e-71
cd05936468 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain 6e-61
cd05903437 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li 1e-57
PRK08316523 PRK08316, PRK08316, acyl-CoA synthetase; Validated 1e-55
cd04433338 cd04433, AFD_class_I, Adenylate forming domain, Cl 2e-55
cd05934421 cd05934, FACL_DitJ_like, Uncharacterized subfamily 3e-55
cd05912407 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase 9e-54
PRK08315559 PRK08315, PRK08315, AMP-binding domain protein; Va 1e-53
PRK07656513 PRK07656, PRK07656, long-chain-fatty-acid--CoA lig 7e-53
cd05926345 cd05926, FACL_fum10p_like, Subfamily of fatty acid 2e-52
PRK06018542 PRK06018, PRK06018, putative acyl-CoA synthetase; 3e-50
PRK12583558 PRK12583, PRK12583, acyl-CoA synthetase; Provision 1e-49
PRK07786542 PRK07786, PRK07786, long-chain-fatty-acid--CoA lig 9e-49
PRK03640483 PRK03640, PRK03640, O-succinylbenzoic acid--CoA li 3e-48
cd05941430 cd05941, MCS, Malonyl-CoA synthetase (MCS) 1e-46
PRK13295547 PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig 1e-46
PRK07008539 PRK07008, PRK07008, long-chain-fatty-acid--CoA lig 1e-45
cd05920483 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l 2e-45
PRK06839496 PRK06839, PRK06839, acyl-CoA synthetase; Validated 1e-44
PRK09088488 PRK09088, PRK09088, acyl-CoA synthetase; Validated 4e-44
cd05959506 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 5e-43
cd05944359 cd05944, FACL_like_4, Uncharacterized subfamily of 7e-43
cd05935430 cd05935, LC_FACS_like, Putative long-chain fatty a 4e-42
PRK08314546 PRK08314, PRK08314, long-chain-fatty-acid--CoA lig 8e-42
PRK07529632 PRK07529, PRK07529, AMP-binding domain protein; Va 1e-41
COG0365528 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat 1e-41
PRK06145497 PRK06145, PRK06145, acyl-CoA synthetase; Validated 2e-41
PRK05605573 PRK05605, PRK05605, long-chain-fatty-acid--CoA lig 9e-41
cd05911487 cd05911, Firefly_Luc_like, Firefly luciferase of l 8e-40
PRK06188524 PRK06188, PRK06188, acyl-CoA synthetase; Validated 9e-40
cd05922350 cd05922, FACL_like_6, Uncharacterized subfamily of 1e-39
TIGR01923436 TIGR01923, menE, O-succinylbenzoate-CoA ligase 1e-39
cd05919436 cd05919, BCL_like, Benzoate CoA ligase (BCL) and s 1e-39
TIGR03208538 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate 1e-38
cd05904504 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) 4e-38
PRK08276502 PRK08276, PRK08276, long-chain-fatty-acid--CoA lig 6e-38
PRK07470528 PRK07470, PRK07470, acyl-CoA synthetase; Validated 8e-38
cd05971439 cd05971, MACS_like_3, Uncharacterized subfamily of 1e-37
PRK06087547 PRK06087, PRK06087, short chain acyl-CoA synthetas 3e-37
PRK13391511 PRK13391, PRK13391, acyl-CoA synthetase; Provision 2e-35
PRK07787471 PRK07787, PRK07787, acyl-CoA synthetase; Validated 2e-35
cd05973440 cd05973, MACS_like_2, Uncharacterized subfamily of 3e-35
cd05972430 cd05972, MACS_like, Medium-chain acyl-CoA syntheta 3e-35
PRK05677562 PRK05677, PRK05677, long-chain-fatty-acid--CoA lig 4e-35
PRK07059557 PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig 4e-35
pfam00501412 pfam00501, AMP-binding, AMP-binding enzyme 2e-34
PRK06155542 PRK06155, PRK06155, crotonobetaine/carnitine-CoA l 2e-34
PRK07514504 PRK07514, PRK07514, malonyl-CoA synthase; Validate 2e-34
PRK05620576 PRK05620, PRK05620, long-chain-fatty-acid--CoA lig 5e-33
PRK08008517 PRK08008, caiC, putative crotonobetaine/carnitine- 5e-33
PRK06178567 PRK06178, PRK06178, acyl-CoA synthetase; Validated 5e-32
PRK05852534 PRK05852, PRK05852, acyl-CoA synthetase; Validated 9e-32
PRK12492562 PRK12492, PRK12492, long-chain-fatty-acid--CoA lig 1e-31
cd05974433 cd05974, MACS_like_1, Uncharacterized subfamily of 2e-31
PRK08974560 PRK08974, PRK08974, long-chain-fatty-acid--CoA lig 3e-31
PLN02330546 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 6e-31
cd05958487 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) 1e-30
TIGR02262508 TIGR02262, benz_CoA_lig, benzoate-CoA ligase famil 2e-30
PRK06710563 PRK06710, PRK06710, long-chain-fatty-acid--CoA lig 6e-30
cd05969443 cd05969, MACS_like_4, Uncharacterized subfamily of 6e-30
PRK04319570 PRK04319, PRK04319, acetyl-CoA synthetase; Provisi 2e-29
TIGR03205541 TIGR03205, pimA, dicarboxylate--CoA ligase PimA 3e-29
COG1021542 COG1021, EntE, Peptide arylation enzymes [Secondar 3e-28
PLN02574560 PLN02574, PLN02574, 4-coumarate--CoA ligase-like 4e-28
TIGR02275526 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP 8e-28
cd05923495 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) 2e-27
PRK13382537 PRK13382, PRK13382, acyl-CoA synthetase; Provision 3e-27
COG1022613 COG1022, FAA1, Long-chain acyl-CoA synthetases (AM 5e-27
cd05907456 cd05907, VL_LC_FACS_like, Long-chain fatty acid Co 5e-27
PRK08751560 PRK08751, PRK08751, putative long-chain fatty acyl 6e-27
PRK06164540 PRK06164, PRK06164, acyl-CoA synthetase; Validated 2e-26
PRK07788549 PRK07788, PRK07788, acyl-CoA synthetase; Validated 2e-26
cd05924365 cd05924, FACL_like_5, Uncharacterized subfamily of 4e-26
PRK07638487 PRK07638, PRK07638, acyl-CoA synthetase; Validated 5e-26
PLN02246537 PLN02246, PLN02246, 4-coumarate--CoA ligase 6e-26
cd05966602 cd05966, ACS, Acetyl-CoA synthetase (also known as 2e-25
PRK13390501 PRK13390, PRK13390, acyl-CoA synthetase; Provision 2e-25
PLN02860563 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase 6e-25
PRK07798533 PRK07798, PRK07798, acyl-CoA synthetase; Validated 2e-24
cd05945447 cd05945, DltA, D-alanine:D-alanyl carrier protein 2e-24
cd05970537 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s 3e-24
TIGR02188625 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase 4e-24
PRK10946536 PRK10946, entE, enterobactin synthase subunit E; P 4e-23
PRK13388540 PRK13388, PRK13388, acyl-CoA synthetase; Provision 9e-23
PRK00174637 PRK00174, PRK00174, acetyl-CoA synthetase; Provisi 2e-22
cd05930445 cd05930, A_NRPS, The adenylation domain of nonribo 3e-22
cd05940444 cd05940, FATP_FACS, Fatty acid transport proteins 1e-21
cd12116438 cd12116, A_NRPS_Ta1_like, The adenylation domain o 1e-21
cd12114476 cd12114, A_NRPS_TlmIV_like, The adenylation domain 2e-21
cd05928530 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co 2e-21
PRK12406509 PRK12406, PRK12406, long-chain-fatty-acid--CoA lig 2e-21
cd05967607 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) 3e-21
PRK07867529 PRK07867, PRK07867, acyl-CoA synthetase; Validated 5e-21
cd05937468 cd05937, FATP_chFAT1_like, Uncharacterized subfami 5e-21
cd05968474 cd05968, AACS_like, Uncharacterized acyl-CoA synth 9e-21
cd05927539 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty 2e-20
cd12117474 cd12117, A_NRPS_Srf_like, The adenylation domain o 4e-20
cd05906560 cd05906, A_NRPS_TubE_like, The adenylation domain 5e-20
cd05931547 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) 7e-20
PRK07445452 PRK07445, PRK07445, O-succinylbenzoic acid--CoA li 2e-18
TIGR03098517 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-form 3e-18
PRK05857540 PRK05857, PRK05857, acyl-CoA synthetase; Validated 7e-18
PRK13383516 PRK13383, PRK13383, acyl-CoA synthetase; Provision 7e-18
cd05918447 cd05918, A_NRPS_SidN3_like, The adenylation (A) do 8e-17
cd12115449 cd12115, A_NRPS_Sfm_like, The adenylation domain o 7e-16
PLN02430660 PLN02430, PLN02430, long-chain-fatty-acid-CoA liga 8e-16
cd05932504 cd05932, LC_FACS_bac, Bacterial long-chain fatty a 1e-15
cd05933594 cd05933, ACSBG_like, Bubblegum-like very long-chai 2e-15
PRK086331146 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanola 4e-15
PLN02654666 PLN02654, PLN02654, acetate-CoA ligase 7e-15
PRK07824358 PRK07824, PRK07824, O-succinylbenzoic acid--CoA li 9e-15
PRK09029458 PRK09029, PRK09029, O-succinylbenzoic acid--CoA li 1e-14
cd05909489 cd05909, AAS_C, C-terminal domain of the acyl-acyl 2e-14
cd05908499 cd05908, A_NRPS_MycA_like, The adenylation domain 3e-14
PRK08279600 PRK08279, PRK08279, long-chain-acyl-CoA synthetase 9e-14
PRK08308414 PRK08308, PRK08308, acyl-CoA synthetase; Validated 4e-13
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 4e-13
PLN02861660 PLN02861, PLN02861, long-chain-fatty-acid-CoA liga 4e-13
PRK09192579 PRK09192, PRK09192, acyl-CoA synthetase; Validated 5e-13
TIGR02316628 TIGR02316, propion_prpE, propionate--CoA ligase 6e-13
PRK10524629 PRK10524, prpE, propionyl-CoA synthetase; Provisio 6e-13
PRK123165163 PRK12316, PRK12316, peptide synthase; Provisional 6e-13
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 5e-12
PLN02387696 PLN02387, PLN02387, long-chain-fatty-acid-CoA liga 7e-12
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 2e-11
PRK05851525 PRK05851, PRK05851, long-chain-fatty-acid--[acyl-c 2e-11
cd05938535 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport 3e-11
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 1e-10
cd05914448 cd05914, FACL_like_3, Uncharacterized subfamily of 2e-10
cd05910455 cd05910, FACL_like_1, Uncharacterized subfamily of 3e-10
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 5e-10
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 7e-10
PRK07768545 PRK07768, PRK07768, long-chain-fatty-acid--CoA lig 1e-09
cd05921559 cd05921, FCS, Feruloyl-CoA synthetase (FCS) 4e-09
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 6e-09
PLN02614666 PLN02614, PLN02614, long-chain acyl-CoA synthetase 7e-09
PRK056914334 PRK05691, PRK05691, peptide synthase; Validated 3e-08
PRK10252 1296 PRK10252, entF, enterobactin synthase subunit F; P 3e-08
TIGR01734502 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phospho 4e-08
PRK06060 705 PRK06060, PRK06060, acyl-CoA synthetase; Validated 4e-08
PRK08180614 PRK08180, PRK08180, feruloyl-CoA synthase; Reviewe 5e-08
PTZ00237647 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisi 8e-08
PLN03052728 PLN03052, PLN03052, acetate--CoA ligase; Provision 9e-08
cd05943616 cd05943, AACS, Acetoacetyl-CoA synthetase (acetoac 1e-07
PLN02736651 PLN02736, PLN02736, long-chain acyl-CoA synthetase 2e-07
PRK068141140 PRK06814, PRK06814, acylglycerophosphoethanolamine 2e-07
cd05939474 cd05939, hsFATP4_like, Fatty acid transport protei 3e-07
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 6e-07
PRK12582624 PRK12582, PRK12582, acyl-CoA synthetase; Provision 6e-07
PRK09274552 PRK09274, PRK09274, peptide synthase; Provisional 6e-07
PRK04813503 PRK04813, PRK04813, D-alanine--poly(phosphoribitol 7e-07
PRK05850578 PRK05850, PRK05850, acyl-CoA synthetase; Validated 1e-06
TIGR01733409 TIGR01733, AA-adenyl-dom, amino acid adenylation d 4e-06
COG1020642 COG1020, EntF, Non-ribosomal peptide synthetase mo 5e-06
pfam1319343 pfam13193, DUF4009, Domain of unknown function (DU 5e-06
PRK06334539 PRK06334, PRK06334, long chain fatty acid--[acyl-c 8e-06
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 1e-05
PRK07769631 PRK07769, PRK07769, long-chain-fatty-acid--CoA lig 2e-05
PRK12476612 PRK12476, PRK12476, putative fatty-acid--CoA ligas 5e-05
PTZ00216700 PTZ00216, PTZ00216, acyl-CoA synthetase; Provision 9e-05
PTZ00342746 PTZ00342, PTZ00342, acyl-CoA synthetase; Provision 3e-04
TIGR01217652 TIGR01217, ac_ac_CoA_syn, acetoacetyl-CoA synthase 3e-04
TIGR03443 1389 TIGR03443, alpha_am_amid, L-aminoadipate-semialdeh 0.004
PLN03051499 PLN03051, PLN03051, acyl-activating enzyme; Provis 0.004
>gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis Back     alignment and domain information
 Score =  433 bits (1117), Expect = e-152
 Identities = 153/220 (69%), Positives = 183/220 (83%)

Query: 1   MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDP 60
           MEELGF +TH YGLTETYGP TVC WKP+W++LP EE+A++KARQGV ++GL+E+D+ DP
Sbjct: 301 MEELGFEVTHVYGLTETYGPITVCEWKPEWDALPAEERARLKARQGVRYVGLEEVDVVDP 360

Query: 61  VTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELK 120
            TMK VP D KTIGE++ RGNTVM GY KN +AT++AF GGWF SGDL V HPDGYIE+K
Sbjct: 361 ETMKDVPRDGKTIGEIVMRGNTVMKGYYKNPEATEEAFAGGWFHSGDLAVVHPDGYIEIK 420

Query: 121 DRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANG 180
           DRSKDIIISGGENIS+IEVE VL+ HP+VLEAAVV RPD+ WGETPCAFV LK G     
Sbjct: 421 DRSKDIIISGGENISSIEVEGVLYKHPAVLEAAVVARPDEKWGETPCAFVVLKPGASVTE 480

Query: 181 EEIINYCRDRLPHYMAPRTVVFEDLPKTSTGKTQKYVLRE 220
           EE+I YCR++L H+  P+TV F +LPKT+TGK QK+VLRE
Sbjct: 481 EELIEYCREKLAHFKVPKTVEFVELPKTATGKIQKFVLRE 520


This family includes fatty acyl-CoA synthetases that can activate medium to long-chain fatty acids. These enzymes catalyze the ATP-dependent acylation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. Fatty acyl-CoA synthetases are responsible for fatty acid degradation as well as physiological regulation of cellular functions via the production of fatty acyl-CoA esters. The fatty acyl-CoA synthetase from Thermus thermophiles in this family has been shown to catalyze the long-chain fatty acid, myristoyl acid. Also included in this family are acyl activating enzymes from Arabidopsis, which contains a large number of proteins from this family with up to 63 different genes, many of which are uncharacterized. Length = 520

>gnl|CDD|236169 PRK08162, PRK08162, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|178097 PLN02479, PLN02479, acetate-CoA ligase Back     alignment and domain information
>gnl|CDD|215576 PLN03102, PLN03102, acyl-activating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles Back     alignment and domain information
>gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins Back     alignment and domain information
>gnl|CDD|213283 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles Back     alignment and domain information
>gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD Back     alignment and domain information
>gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) Back     alignment and domain information
>gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I Back     alignment and domain information
>gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) Back     alignment and domain information
>gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis Back     alignment and domain information
>gnl|CDD|235673 PRK06018, PRK06018, putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) Back     alignment and domain information
>gnl|CDD|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>gnl|CDD|235908 PRK07008, PRK07008, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase) Back     alignment and domain information
>gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase Back     alignment and domain information
>gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes Back     alignment and domain information
>gnl|CDD|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236096 PRK07787, PRK07787, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|235719 PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated Back     alignment and domain information
>gnl|CDD|180167 PRK05620, PRK05620, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>gnl|CDD|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) Back     alignment and domain information
>gnl|CDD|233803 TIGR02262, benz_CoA_lig, benzoate-CoA ligase family Back     alignment and domain information
>gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) Back     alignment and domain information
>gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|132249 TIGR03205, pimA, dicarboxylate--CoA ligase PimA Back     alignment and domain information
>gnl|CDD|223952 COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like Back     alignment and domain information
>gnl|CDD|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|213290 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) Back     alignment and domain information
>gnl|CDD|172019 PRK13382, PRK13382, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases Back     alignment and domain information
>gnl|CDD|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213291 cd05924, FACL_like_5, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase Back     alignment and domain information
>gnl|CDD|213313 cd05966, ACS, Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme) Back     alignment and domain information
>gnl|CDD|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215464 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|236100 PRK07798, PRK07798, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) Back     alignment and domain information
>gnl|CDD|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like Back     alignment and domain information
>gnl|CDD|233770 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase Back     alignment and domain information
>gnl|CDD|236803 PRK10946, entE, enterobactin synthase subunit E; Provisional Back     alignment and domain information
>gnl|CDD|237374 PRK13388, PRK13388, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|234677 PRK00174, PRK00174, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes Back     alignment and domain information
>gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase Back     alignment and domain information
>gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes Back     alignment and domain information
>gnl|CDD|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213314 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) Back     alignment and domain information
>gnl|CDD|236120 PRK07867, PRK07867, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi Back     alignment and domain information
>gnl|CDD|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) Back     alignment and domain information
>gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) Back     alignment and domain information
>gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents Back     alignment and domain information
>gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) Back     alignment and domain information
>gnl|CDD|236019 PRK07445, PRK07445, O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>gnl|CDD|211788 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-forming), exosortase A-associated Back     alignment and domain information
>gnl|CDD|180293 PRK05857, PRK05857, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|139531 PRK13383, PRK13383, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae Back     alignment and domain information
>gnl|CDD|178049 PLN02430, PLN02430, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase Back     alignment and domain information
>gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) Back     alignment and domain information
>gnl|CDD|236315 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>gnl|CDD|215353 PLN02654, PLN02654, acetate-CoA ligase Back     alignment and domain information
>gnl|CDD|236108 PRK07824, PRK07824, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|236363 PRK09029, PRK09029, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) Back     alignment and domain information
>gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) Back     alignment and domain information
>gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236231 PRK08308, PRK08308, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|178452 PLN02861, PLN02861, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|131369 TIGR02316, propion_prpE, propionate--CoA ligase Back     alignment and domain information
>gnl|CDD|182517 PRK10524, prpE, propionyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|180289 PRK05851, PRK05851, long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>gnl|CDD|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213278 cd05910, FACL_like_1, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213288 cd05921, FCS, Feruloyl-CoA synthetase (FCS) Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|166255 PLN02614, PLN02614, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|236668 PRK10252, entF, enterobactin synthase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|233551 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>gnl|CDD|180374 PRK06060, PRK06060, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236175 PRK08180, PRK08180, feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>gnl|CDD|240325 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215553 PLN03052, PLN03052, acetate--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213308 cd05943, AACS, Acetoacetyl-CoA synthetase (acetoacetate-CoA ligase, AACS) Back     alignment and domain information
>gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|235865 PRK06814, PRK06814, acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|213305 cd05939, hsFATP4_like, Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|237144 PRK12582, PRK12582, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236443 PRK09274, PRK09274, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|235624 PRK05850, PRK05850, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain Back     alignment and domain information
>gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|221971 pfam13193, DUF4009, Domain of unknown function (DUF4009) Back     alignment and domain information
>gnl|CDD|180533 PRK06334, PRK06334, long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|181109 PRK07769, PRK07769, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|171527 PRK12476, PRK12476, putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|240316 PTZ00216, PTZ00216, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|240370 PTZ00342, PTZ00342, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|233316 TIGR01217, ac_ac_CoA_syn, acetoacetyl-CoA synthase Back     alignment and domain information
>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|215552 PLN03051, PLN03051, acyl-activating enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 236
KOG1176537 consensus Acyl-CoA synthetase [Lipid transport and 100.0
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 100.0
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 100.0
PTZ00237647 acetyl-CoA synthetase; Provisional 100.0
KOG1177596 consensus Long chain fatty acid acyl-CoA ligase [L 100.0
PLN02574560 4-coumarate--CoA ligase-like 100.0
PLN03051499 acyl-activating enzyme; Provisional 100.0
PLN03102579 acyl-activating enzyme; Provisional 100.0
PRK07788549 acyl-CoA synthetase; Validated 100.0
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 100.0
PLN02654666 acetate-CoA ligase 100.0
PRK04319570 acetyl-CoA synthetase; Provisional 100.0
PRK06839496 acyl-CoA synthetase; Validated 100.0
PRK07529632 AMP-binding domain protein; Validated 100.0
TIGR02316628 propion_prpE propionate--CoA ligase. This family c 100.0
PRK00174637 acetyl-CoA synthetase; Provisional 100.0
PRK09088488 acyl-CoA synthetase; Validated 100.0
TIGR02188625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 100.0
PRK05852534 acyl-CoA synthetase; Validated 100.0
PRK06155542 crotonobetaine/carnitine-CoA ligase; Provisional 100.0
PRK07470528 acyl-CoA synthetase; Validated 100.0
PRK07638487 acyl-CoA synthetase; Validated 100.0
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 100.0
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 100.0
KOG1175626 consensus Acyl-CoA synthetase [Lipid transport and 100.0
PRK10524629 prpE propionyl-CoA synthetase; Provisional 100.0
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK08315559 AMP-binding domain protein; Validated 100.0
PRK08162545 acyl-CoA synthetase; Validated 100.0
PLN02330546 4-coumarate--CoA ligase-like 1 100.0
PRK06334539 long chain fatty acid--[acyl-carrier-protein] liga 100.0
TIGR01217652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 100.0
PLN02246537 4-coumarate--CoA ligase 100.0
PRK06710563 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK06060 705 acyl-CoA synthetase; Validated 100.0
PRK07867529 acyl-CoA synthetase; Validated 100.0
PRK06145497 acyl-CoA synthetase; Validated 100.0
PRK13382537 acyl-CoA synthetase; Provisional 100.0
PRK08316523 acyl-CoA synthetase; Validated 100.0
PRK07514504 malonyl-CoA synthase; Validated 100.0
PLN02860563 o-succinylbenzoate-CoA ligase 100.0
PRK07786542 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK13388540 acyl-CoA synthetase; Provisional 100.0
PRK05857540 acyl-CoA synthetase; Validated 100.0
PRK03584655 acetoacetyl-CoA synthetase; Provisional 100.0
COG1021542 EntE Peptide arylation enzymes [Secondary metaboli 100.0
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 100.0
PLN02479567 acetate-CoA ligase 100.0
PRK06188524 acyl-CoA synthetase; Validated 100.0
PRK06178567 acyl-CoA synthetase; Validated 100.0
PRK12492562 long-chain-fatty-acid--CoA ligase; Provisional 100.0
PRK07769631 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK09274552 peptide synthase; Provisional 100.0
PRK086331146 2-acyl-glycerophospho-ethanolamine acyltransferase 100.0
PRK08008517 caiC putative crotonobetaine/carnitine-CoA ligase; 100.0
PRK07656513 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK06164540 acyl-CoA synthetase; Validated 100.0
PRK07787471 acyl-CoA synthetase; Validated 100.0
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 100.0
PRK12583558 acyl-CoA synthetase; Provisional 100.0
PRK10946536 entE enterobactin synthase subunit E; Provisional 100.0
PRK05851525 long-chain-fatty-acid--[acyl-carrier-protein] liga 100.0
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 100.0
TIGR03208538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 100.0
PRK07059557 Long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 100.0
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 100.0
PRK13390501 acyl-CoA synthetase; Provisional 100.0
PRK06018542 putative acyl-CoA synthetase; Provisional 100.0
TIGR02275527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 100.0
PRK08751560 putative long-chain fatty acyl CoA ligase; Provisi 100.0
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 100.0
PRK05620576 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 100.0
PRK06087547 short chain acyl-CoA synthetase; Reviewed 100.0
PLN02736651 long-chain acyl-CoA synthetase 100.0
PRK08974560 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 100.0
PRK12476612 putative fatty-acid--CoA ligase; Provisional 100.0
PRK13383516 acyl-CoA synthetase; Provisional 100.0
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 100.0
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 100.0
PLN02614666 long-chain acyl-CoA synthetase 100.0
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 100.0
TIGR03205541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 100.0
TIGR02262508 benz_CoA_lig benzoate-CoA ligase family. Character 100.0
PRK12316 5163 peptide synthase; Provisional 100.0
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 100.0
PLN02861660 long-chain-fatty-acid-CoA ligase 100.0
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
PRK12467 3956 peptide synthase; Provisional 100.0
PRK12316 5163 peptide synthase; Provisional 100.0
PLN03052728 acetate--CoA ligase; Provisional 100.0
PRK13391511 acyl-CoA synthetase; Provisional 100.0
PRK07868994 acyl-CoA synthetase; Validated 100.0
PRK12467 3956 peptide synthase; Provisional 99.98
TIGR01923436 menE O-succinylbenzoate-CoA ligase. This model rep 99.98
PRK08279600 long-chain-acyl-CoA synthetase; Validated 99.98
PRK07798533 acyl-CoA synthetase; Validated 99.98
PLN02387696 long-chain-fatty-acid-CoA ligase family protein 99.98
PRK068141140 acylglycerophosphoethanolamine acyltransferase; Pr 99.98
PRK056914334 peptide synthase; Validated 99.98
PRK05691 4334 peptide synthase; Validated 99.98
PRK09192579 acyl-CoA synthetase; Validated 99.97
PLN02430660 long-chain-fatty-acid-CoA ligase 99.97
PTZ00342746 acyl-CoA synthetase; Provisional 99.97
PRK05850578 acyl-CoA synthetase; Validated 99.97
PTZ00216700 acyl-CoA synthetase; Provisional 99.97
COG1022613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 99.97
PRK07768545 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK08180614 feruloyl-CoA synthase; Reviewed 99.97
KOG1256691 consensus Long-chain acyl-CoA synthetases (AMP-for 99.96
PRK08308414 acyl-CoA synthetase; Validated 99.96
PRK12582624 acyl-CoA synthetase; Provisional 99.96
KOG1180678 consensus Acyl-CoA synthetase [Lipid transport and 99.95
PRK09188365 serine/threonine protein kinase; Provisional 99.91
KOG1179649 consensus Very long-chain acyl-CoA synthetase/fatt 99.91
TIGR01733408 AA-adenyl-dom amino acid adenylation domain. This 99.9
TIGR02155422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 99.9
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 99.89
PF00501417 AMP-binding: AMP-binding enzyme; InterPro: IPR0008 99.86
TIGR03335445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 99.72
COG1541438 PaaK Coenzyme F390 synthetase [Coenzyme metabolism 99.71
KOG1178 1032 consensus Non-ribosomal peptide synthetase/alpha-a 99.67
PTZ00297 1452 pantothenate kinase; Provisional 99.6
COG1020642 EntF Non-ribosomal peptide synthetase modules and 99.57
PF1319373 AMP-binding_C: AMP-binding enzyme C-terminal domai 99.31
KOG36281363 consensus Predicted AMP-binding protein [General f 99.22
TIGR02304430 aden_form_hyp probable adenylate-forming enzyme. M 98.93
KOG3628 1363 consensus Predicted AMP-binding protein [General f 98.38
PF1453596 AMP-binding_C_2: AMP-binding enzyme C-terminal dom 97.82
PF03321528 GH3: GH3 auxin-responsive promoter; InterPro: IPR0 97.79
PF04443365 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR 97.68
PLN02247606 indole-3-acetic acid-amido synthetase 96.53
PLN02620612 indole-3-acetic acid-amido synthetase 95.88
PLN02249597 indole-3-acetic acid-amido synthetase 94.47
>KOG1176 consensus Acyl-CoA synthetase [Lipid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=2.4e-46  Score=325.92  Aligned_cols=212  Identities=49%  Similarity=0.805  Sum_probs=195.6

Q ss_pred             cccc-CeeeecccccccCCCcceeecCCCCCCCChhHHhhhhccCCCccCCcceEEEeCCCCCcccCCCCCceeEEEEec
Q 046870            2 EELG-FTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDPVTMKSVPSDAKTIGEVMFRG   80 (236)
Q Consensus         2 ~~~g-~~i~~~YG~TE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~v~i~d~~~~~~~~~~~~~~Gel~v~~   80 (236)
                      ++++ ..+.+.||+||+++.++.+...+.          ..+.++|.+++++ .+.|.+. +|..++++  +.||||++|
T Consensus       321 ~~l~~~~v~q~YGmTE~~~~~~~~~~~~e----------~k~~svG~~~~g~-~~~v~~e-~g~~l~~~--~~GEI~vrg  386 (537)
T KOG1176|consen  321 ERLPNVTVIQGYGMTEAGGLITSNDWGPE----------RKPGSVGRLLPGV-RVKVLDE-TGVSLGPN--QTGEICVRG  386 (537)
T ss_pred             HhCCCceEEEeeccccccCceeecCCCcc----------CcccccCccccce-EEEeeCC-CCCCCCCC--CceEEEEEC
Confidence            4567 899999999999977776654322          3457899999987 7777776 99999998  889999999


Q ss_pred             CCcchhhcCCchhhhcccCC-CeEeccceEEEecCCeEEEEccCCCeEEEcceeeCHHHHHHHHhcCCCcceEEEEeccC
Q 046870           81 NTVMNGYLKNLKATQDAFDG-GWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPD  159 (236)
Q Consensus        81 ~~~~~~y~~~~~~~~~~~~~-g~~~TGD~~~~~~~g~l~~~GR~~d~i~~~G~~v~~~~iE~~l~~~~~v~~~~v~~~~~  159 (236)
                      +.++.||++||++|.+.|.+ |||+|||+|++|+||+|+|++|.+|+||.+|+.|+|.+||++|..||.|.|++|++.++
T Consensus       387 ~~imkGY~~NpeaT~~~~~~~GW~~TGDiGy~D~DG~l~IvdR~KdlIk~~G~qv~P~EiE~vL~~hP~V~eaaVvgipD  466 (537)
T KOG1176|consen  387 PQVMKGYLKNPEATKEAFDDDGWFHTGDLGYFDEDGYLYIVDRSKDLIKYGGEQVSPAEIEAVLLTHPDVLEAAVVGIPD  466 (537)
T ss_pred             cccchhhcCChHHHHhhcccCCccccCceEEEcCCCeEEEecchhhheeeCCEEeCHHHHHHHHHhCCCccEEEEEcccc
Confidence            99999999999999999976 99999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEeCCCCCCCHHHHHHHHHhcCCCCCCccEEEEcc-cCCCCCCcccHHHHHHHHHhcCC
Q 046870          160 DHWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFED-LPKTSTGKTQKYVLREKAKAMGS  227 (236)
Q Consensus       160 ~~~~~~~~~~v~~~~~~~~~~~~l~~~l~~~l~~~~~p~~i~~~~-lP~t~~GKi~R~~l~~~~~~~~~  227 (236)
                      +.+|+.++|+|+.+++...+.+++.+++++++++|+.|..+.|++ ||+|++|||+|+.|++++.+..+
T Consensus       467 e~~Ge~p~A~VV~k~g~~lte~di~~~v~k~l~~y~~~~~V~Fvd~lPKs~~GKi~R~~lr~~~~~~~~  535 (537)
T KOG1176|consen  467 EVWGETPAAFVVLKKGSTLTEKDIIEYVRKKLPAYKLPGGVVFVDELPKTPNGKILRRKLRDIAKKLGS  535 (537)
T ss_pred             cccCCcceEEEEecCCCcCCHHHHHHHHHhhCChhhccCeEEEeccCCCCCcchHHHHHHHHHHHhccc
Confidence            999999999999999888999999999999999999999999887 99999999999999999988754



>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1177 consensus Long chain fatty acid acyl-CoA ligase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>KOG1175 consensus Acyl-CoA synthetase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>KOG1256 consensus Long-chain acyl-CoA synthetases (AMP-forming) [Lipid transport and metabolism] Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1180 consensus Acyl-CoA synthetase [Lipid transport and metabolism] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1179 consensus Very long-chain acyl-CoA synthetase/fatty acid transporter [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information
>KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B Back     alignment and domain information
>KOG3628 consensus Predicted AMP-binding protein [General function prediction only] Back     alignment and domain information
>TIGR02304 aden_form_hyp probable adenylate-forming enzyme Back     alignment and domain information
>KOG3628 consensus Predicted AMP-binding protein [General function prediction only] Back     alignment and domain information
>PF14535 AMP-binding_C_2: AMP-binding enzyme C-terminal domain; PDB: 2Y27_A 2Y4N_A 3QOV_B 3S89_D 3LAX_A 2Y4O_B Back     alignment and domain information
>PF03321 GH3: GH3 auxin-responsive promoter; InterPro: IPR004993 Transcription of the gene family, GH3, has been shown to be specifically induced by the plant hormone auxin Back     alignment and domain information
>PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria Back     alignment and domain information
>PLN02247 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PLN02620 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PLN02249 indole-3-acetic acid-amido synthetase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
3r44_A517 Mycobacterium Tuberculosis Fatty Acyl Coa Synthetas 4e-33
1ult_A541 Crystal Structure Of Tt0168 From Thermus Thermophil 1e-31
3ipl_A501 Crystal Structure Of O-Succinylbenzoic Acid-Coa Lig 8e-23
3ivr_A509 Crystal Structure Of Putative Long-Chain-Fatty-Acid 9e-23
3g7s_A549 Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Li 1e-22
4fuq_A503 Crystal Structure Of Apo Matb From Rhodopseudomonas 4e-22
2v7b_A529 Crystal Structures Of A Benzoate Coa Ligase From Bu 1e-21
3rg2_A617 Structure Of A Two-Domain Nrps Fusion Protein Conta 1e-20
4gxq_A506 Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimer 2e-20
1ba3_A550 Firefly Luciferase In Complex With Bromoform Length 7e-20
3iep_A551 Firefly Luciferase Apo Structure (P41 Form) Length 7e-20
4g36_A555 Photinus Pyralis Luciferase In The Adenylate-Formin 8e-20
4g37_A555 Structure Of Cross-Linked Firefly Luciferase In Sec 1e-19
3nyq_A505 Malonyl-Coa Ligase Ternary Product Complex With Met 1e-19
1mdb_A539 Crystal Structure Of Dhbe In Complex With Dhb-adeny 1e-19
4gxr_A503 Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Len 4e-19
1md9_A539 Crystal Structure Of Dhbe In Complex With Dhb And A 4e-19
4fut_A503 Crystal Structure Of Atp Bound Matb From Rhodopseud 9e-19
3a9u_A536 Crystal Structures And Enzymatic Mechanisms Of A Po 1e-18
3qya_A582 Crystal Structure Of A Red-Emitter Mutant Of Lampyr 2e-18
2d1q_A548 Crystal Structure Of The Thermostable Japanese Fire 2e-18
2d1s_A548 Crystal Structure Of The Thermostable Japanese Fire 2e-18
2d1t_A548 Crystal Structure Of The Thermostable Japanese Fire 2e-18
3dlp_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, 4e-18
1t5d_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chl 4e-18
2qvz_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATIO 4e-18
2qvx_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATIO 4e-18
3cw8_X504 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cb 5e-18
1t5h_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SE 8e-18
2wd9_A569 Crystal Structure Of Human Acyl-coa Synthetase Medi 3e-17
3b7w_A570 Crystal Structure Of Human Acyl-Coa Synthetase Medi 3e-17
3o82_A544 Structure Of Base N-Terminal Domain From Acinetobac 1e-16
3tsy_A 979 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr 7e-15
3etc_A580 2.1 A Structure Of Acyl-Adenylate Synthetase From M 4e-14
2p2f_A652 Acetyl-coa Synthetase, Wild-type With Acetate, Amp, 7e-13
2p2m_A652 Acetyl-Coa Synthetase, R194a Mutation Length = 652 7e-13
1pg3_A652 Acetyl Coa Synthetase, Acetylated On Lys609 Length 7e-13
2p2b_A652 Acetyl-coa Synthetase, V386a Mutation Length = 652 7e-13
1ry2_A663 Crystal Structure Of Yeast Acetyl-Coenzyme A Synthe 8e-13
2p2j_A652 Acetyl-Coa Synthetase, K609a Mutation Length = 652 3e-12
2p2q_A652 Acetyl-Coa Synthetase, R584e Mutation Length = 652 4e-12
2p20_A652 Acetyl-Coa Synthetase, R584a Mutation Length = 652 5e-12
2vsq_A 1304 Structure Of Surfactin A Synthetase C (Srfa-C), A N 2e-11
4gr5_A570 Crystal Structure Of Slgn1deltaasub In Complex With 3e-10
3kxw_A590 The Crystal Structure Of Fatty Acid Amp Ligase From 4e-07
3t5b_A396 Crystal Structure Of N-Terminal Domain Of Facl13 Fr 5e-07
3vnq_A544 Co-crystal Structure Of Nrps Adenylation Protein Cy 1e-06
1amu_A563 Phenylalanine Activating Domain Of Gramicidin Synth 2e-06
3pbk_A583 Structural And Functional Studies Of Fatty Acyl-Ade 1e-05
3l8c_A521 Structure Of Probable D-Alanine--Poly(Phosphoribito 2e-05
>pdb|3R44|A Chain A, Mycobacterium Tuberculosis Fatty Acyl Coa Synthetase Length = 517 Back     alignment and structure

Iteration: 1

Score = 137 bits (346), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 69/152 (45%), Positives = 97/152 (63%), Gaps = 2/152 (1%) Query: 74 GEVMFRGNTVMNGYLKNLKATQDAFDGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGEN 133 GEV+ + + ++ Y +AT+DAFD GWFR+GD+G +GY+ +KDR KD+IISGGEN Sbjct: 363 GEVVIKSDILLKEYWNRPEATRDAFDNGWFRTGDIGEIDDEGYLYIKDRLKDMIISGGEN 422 Query: 134 ISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVANGEEIINYCRDRLPH 193 + E+ESV+ P V E AV+G PD+ WGE A V + D + ++I+ YC RL Sbjct: 423 VYPAEIESVIIGVPGVSEVAVIGLPDEKWGEIAAAIV-VADQNEVSEQQIVEYCGTRLAR 481 Query: 194 YMAPRTVVF-EDLPKTSTGKTQKYVLREKAKA 224 Y P+ V+F E +P+ TGK K VLRE+ A Sbjct: 482 YKLPKKVIFAEAIPRNPTGKILKTVLREQYSA 513
>pdb|1ULT|A Chain A, Crystal Structure Of Tt0168 From Thermus Thermophilus Hb8 Length = 541 Back     alignment and structure
>pdb|3IPL|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid-Coa Ligase From Staphylococcus Aureus Subsp. Aureus Mu50 Length = 501 Back     alignment and structure
>pdb|3IVR|A Chain A, Crystal Structure Of Putative Long-Chain-Fatty-Acid Coa Ligase From Rhodopseudomonas Palustris Cga009 Length = 509 Back     alignment and structure
>pdb|3G7S|A Chain A, Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Ligase (Fadd1) From Archaeoglobus Fulgidus Length = 549 Back     alignment and structure
>pdb|4FUQ|A Chain A, Crystal Structure Of Apo Matb From Rhodopseudomonas Palustris Length = 503 Back     alignment and structure
>pdb|2V7B|A Chain A, Crystal Structures Of A Benzoate Coa Ligase From Burkholderia Xenovorans Lb400 Length = 529 Back     alignment and structure
>pdb|3RG2|A Chain A, Structure Of A Two-Domain Nrps Fusion Protein Containing The Ente Adenylation Domain And Entb Aryl-Carrier Protein From Enterobactin Biosynthesis Length = 617 Back     alignment and structure
>pdb|4GXQ|A Chain A, Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimera B1 Length = 506 Back     alignment and structure
>pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 Back     alignment and structure
>pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 Back     alignment and structure
>pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 Back     alignment and structure
>pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 Back     alignment and structure
>pdb|3NYQ|A Chain A, Malonyl-Coa Ligase Ternary Product Complex With Methylmalonyl-Coa And Amp Bound Length = 505 Back     alignment and structure
>pdb|1MDB|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb-adenylate Length = 539 Back     alignment and structure
>pdb|4GXR|A Chain A, Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Length = 503 Back     alignment and structure
>pdb|1MD9|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb And Amp Length = 539 Back     alignment and structure
>pdb|4FUT|A Chain A, Crystal Structure Of Atp Bound Matb From Rhodopseudomonas Palustris Length = 503 Back     alignment and structure
>pdb|3A9U|A Chain A, Crystal Structures And Enzymatic Mechanisms Of A Populus Tomentosa 4- Coumarate--Coa Ligase Length = 536 Back     alignment and structure
>pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 Back     alignment and structure
>pdb|2D1Q|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With Mgatp Length = 548 Back     alignment and structure
>pdb|2D1S|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|2D1T|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Red-Color Emission S286n Mutant Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|3DLP|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, BOUND To 4cb Length = 504 Back     alignment and structure
>pdb|1T5D|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chlorobenzoate Length = 504 Back     alignment and structure
>pdb|2QVZ|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 Back     alignment and structure
>pdb|2QVX|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 Back     alignment and structure
>pdb|3CW8|X Chain X, 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cba-adenylate Length = 504 Back     alignment and structure
>pdb|1T5H|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SELENOMETHIONINE Length = 504 Back     alignment and structure
>pdb|2WD9|A Chain A, Crystal Structure Of Human Acyl-coa Synthetase Medium-chain Family Member 2a (l64p Mutation) In Complex With Ibuprofen Length = 569 Back     alignment and structure
>pdb|3B7W|A Chain A, Crystal Structure Of Human Acyl-Coa Synthetase Medium-Chain Family Member 2a, With L64p Mutation Length = 570 Back     alignment and structure
>pdb|3O82|A Chain A, Structure Of Base N-Terminal Domain From Acinetobacter Baumannii Bound To 5'-O-[n-(2,3-Dihydroxybenzoyl)sulfamoyl] Adenosine Length = 544 Back     alignment and structure
>pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 Back     alignment and structure
>pdb|3ETC|A Chain A, 2.1 A Structure Of Acyl-Adenylate Synthetase From Methanosarcina Acetivorans Containing A Link Between Lys256 And Cys298 Length = 580 Back     alignment and structure
>pdb|2P2F|A Chain A, Acetyl-coa Synthetase, Wild-type With Acetate, Amp, And Coa Bound Length = 652 Back     alignment and structure
>pdb|2P2M|A Chain A, Acetyl-Coa Synthetase, R194a Mutation Length = 652 Back     alignment and structure
>pdb|1PG3|A Chain A, Acetyl Coa Synthetase, Acetylated On Lys609 Length = 652 Back     alignment and structure
>pdb|2P2B|A Chain A, Acetyl-coa Synthetase, V386a Mutation Length = 652 Back     alignment and structure
>pdb|1RY2|A Chain A, Crystal Structure Of Yeast Acetyl-Coenzyme A Synthetase In Complex With Amp Length = 663 Back     alignment and structure
>pdb|2P2J|A Chain A, Acetyl-Coa Synthetase, K609a Mutation Length = 652 Back     alignment and structure
>pdb|2P2Q|A Chain A, Acetyl-Coa Synthetase, R584e Mutation Length = 652 Back     alignment and structure
>pdb|2P20|A Chain A, Acetyl-Coa Synthetase, R584a Mutation Length = 652 Back     alignment and structure
>pdb|2VSQ|A Chain A, Structure Of Surfactin A Synthetase C (Srfa-C), A Nonribosomal Peptide Synthetase Termination Module Length = 1304 Back     alignment and structure
>pdb|4GR5|A Chain A, Crystal Structure Of Slgn1deltaasub In Complex With Ampcpp Length = 570 Back     alignment and structure
>pdb|3KXW|A Chain A, The Crystal Structure Of Fatty Acid Amp Ligase From Legionella Pneumophila Length = 590 Back     alignment and structure
>pdb|3T5B|A Chain A, Crystal Structure Of N-Terminal Domain Of Facl13 From Mycobacterium Tuberculosis Length = 396 Back     alignment and structure
>pdb|3VNQ|A Chain A, Co-crystal Structure Of Nrps Adenylation Protein Cytc1 With Atp From Streptomyces Length = 544 Back     alignment and structure
>pdb|1AMU|A Chain A, Phenylalanine Activating Domain Of Gramicidin Synthetase 1 In A Complex With Amp And Phenylalanine Length = 563 Back     alignment and structure
>pdb|3PBK|A Chain A, Structural And Functional Studies Of Fatty Acyl-Adenylate Ligases From E. Coli And L. Pneumophila Length = 583 Back     alignment and structure
>pdb|3L8C|A Chain A, Structure Of Probable D-Alanine--Poly(Phosphoribitol) Ligase Subunit-1 From Streptococcus Pyogenes Length = 521 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 1e-133
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 7e-86
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 7e-86
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 1e-82
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 5e-82
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 9e-77
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 1e-74
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 2e-74
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 4e-74
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 9e-72
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 1e-65
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 6e-65
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 1e-62
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 6e-61
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 2e-59
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 3e-52
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 1e-47
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 1e-43
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 4e-27
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 8e-26
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 6e-23
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 2e-22
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 3e-13
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 2e-12
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 5e-12
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 5e-12
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 1e-11
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 1e-11
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 3e-11
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 2e-10
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 Back     alignment and structure
 Score =  384 bits (988), Expect = e-133
 Identities = 84/227 (37%), Positives = 119/227 (52%), Gaps = 4/227 (1%)

Query: 1   MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDP 60
            E +G  +   YGLTET         K    SL  EE+  +KA+ G+P   +  + + D 
Sbjct: 313 FERMGVEVRQGYGLTETSPVVVQNFVKSHLESLSEEEKLTLKAKTGLPIPLV-RLRVADE 371

Query: 61  VTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFD-GGWFRSGDLGVRHPDGYIEL 119
              + VP D K +GEV  +G  +  GY  N +AT+ A    G+FR+GD+ V   +GY+E+
Sbjct: 372 -EGRPVPKDGKALGEVQLKGPWITGGYYGNEEATRSALTPDGFFRTGDIAVWDEEGYVEI 430

Query: 120 KDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVAN 179
           KDR KD+I SGGE IS++++E+ L  HP V EAAVV  P   W E P A V  +      
Sbjct: 431 KDRLKDLIKSGGEWISSVDLENALMGHPKVKEAAVVAIPHPKWQERPLAVVVPRGEKPTP 490

Query: 180 GEEIINYCRDRLPHYMAPRTVVF-EDLPKTSTGKTQKYVLREKAKAM 225
            E   +  +     +  P   VF E++P+TS GK  K  LRE+ K  
Sbjct: 491 EELNEHLLKAGFAKWQLPDAYVFAEEIPRTSAGKFLKRALREQYKNY 537


>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Length = 652 Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Length = 663 Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Length = 521 Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Length = 563 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Length = 512 Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Length = 620 Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 100.0
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 100.0
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 100.0
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 100.0
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 100.0
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 100.0
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 100.0
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 100.0
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 100.0
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 100.0
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 100.0
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 100.0
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 100.0
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 100.0
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 100.0
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 100.0
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 100.0
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 100.0
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 100.0
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 100.0
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 100.0
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 100.0
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 100.0
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 100.0
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 100.0
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 100.0
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 100.0
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 100.0
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 99.97
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.97
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.96
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 99.81
3lax_A109 Phenylacetate-coenzyme A ligase; structural genomi 99.59
3gxs_A109 Phenylacetate-coenzyme A ligase; APC62324.1, struc 99.59
3hgu_A369 EHPF; phenazine, antibiotic, biosynthetic protein; 99.17
4b2g_A609 GH3-1 auxin conjugating enzyme; signaling protein, 98.28
4epl_A581 Jasmonic acid-amido synthetase JAR1; ANL adenylati 98.2
4eql_A581 4-substituted benzoates-glutamate ligase GH3.12; f 98.19
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
Probab=100.00  E-value=8.7e-44  Score=312.40  Aligned_cols=209  Identities=32%  Similarity=0.562  Sum_probs=188.8

Q ss_pred             cccCeeeecccccccCCCcceeecCCCCCCCChhHHhhhhccCCCccCCcceEEEeCCCCCcccCCCCCceeEEEEecCC
Q 046870            3 ELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDPVTMKSVPSDAKTIGEVMFRGNT   82 (236)
Q Consensus         3 ~~g~~i~~~YG~TE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~v~i~d~~~~~~~~~~~~~~Gel~v~~~~   82 (236)
                      .+|.++++.||+||++...+... ..          .....++|+|++++ +++|+|++++++++.|  +.|||+|+|++
T Consensus       291 ~~~~~~~~~YG~TE~~~~~~~~~-~~----------~~~~~~~G~p~~~~-~~~i~d~~~g~~~~~g--~~GEl~v~g~~  356 (503)
T 4fuq_A          291 KTGHAVLERYGMTETNMNTSNPY-DG----------DRVPGAVGPALPGV-SARVTDPETGKELPRG--DIGMIEVKGPN  356 (503)
T ss_dssp             HHSCCEEECCEETTTEECBCCCS-SS----------CCCTTEEEEBCTTC-EEEEECTTTCCBCCTT--CCEEEEEESTT
T ss_pred             HhCCCccceEcccccCcccccCC-CC----------CCcCCccccCCCCe-EEEEEECCCCCCCcCC--CceEEEEECCc
Confidence            46889999999999976543221 10          12235799999999 9999997699999988  89999999999


Q ss_pred             cchhhcCCchhhhcccC-CCeEeccceEEEecCCeEEEEccCCCeEEEcceeeCHHHHHHHHhcCCCcceEEEEeccCCC
Q 046870           83 VMNGYLKNLKATQDAFD-GGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDH  161 (236)
Q Consensus        83 ~~~~y~~~~~~~~~~~~-~g~~~TGD~~~~~~~g~l~~~GR~~d~i~~~G~~v~~~~iE~~l~~~~~v~~~~v~~~~~~~  161 (236)
                      ++.|||++|+.|.+.|. +|||+|||+++++++|+|+|+||.||+||++|++|+|.+||+.|.++|.|.+++|++.+++.
T Consensus       357 v~~GY~~~~~~t~~~f~~~g~~~TGDl~~~~~dG~l~~~GR~dd~ik~~G~~v~p~eIE~~l~~~p~V~~a~vv~~~~~~  436 (503)
T 4fuq_A          357 VFKGYWRMPEKTKSEFRDDGFFITGDLGKIDERGYVHILGRGKDLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHAD  436 (503)
T ss_dssp             SCCCBTTCHHHHHHTBCTTSCEEEEEEEEECTTCEEEECCSSTTCEEETTEEECHHHHHHHHHTSTTEEEEEEEEEEETT
T ss_pred             hhhhhcCChhhhHhhhCCCCCeEcceeEEEcCCCcEEEEecCCCEEEECCEEECHHHHHHHHHhCCCeeEEEEEEeEchh
Confidence            99999999999999986 89999999999999999999999999999999999999999999999999999999999888


Q ss_pred             CCceeEEEEEeCCCCCCCHHHHHHHHHhcCCCCCCccEEEEcc-cCCCCCCcccHHHHHHHHHhc
Q 046870          162 WGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFED-LPKTSTGKTQKYVLREKAKAM  225 (236)
Q Consensus       162 ~~~~~~~~v~~~~~~~~~~~~l~~~l~~~l~~~~~p~~i~~~~-lP~t~~GKi~R~~l~~~~~~~  225 (236)
                      .++.++++|+..++...+..++.++++++|+.|++|..+++++ ||+|++||++|++|+++++++
T Consensus       437 ~~~~~~a~v~~~~~~~~~~~~l~~~l~~~L~~~~~P~~i~~v~~lP~t~~GKi~R~~L~~~~~~~  501 (503)
T 4fuq_A          437 FGEGVTAVVVRDKGATIDEAQVLHGLDGQLAKFKMPKKVIFVDDLPRNTMGKVQKNVLRETYKDI  501 (503)
T ss_dssp             TEEEEEEEEEECTTCCCCHHHHHHHHBTTBCGGGCCSEEEEESCCCBCTTSCBCHHHHHHHTTTT
T ss_pred             cCceeEEEEEeCCCCCCCHHHHHHHHHhhcccCCCCCEEEEECCCCCCcccceeHHHHHHHHHHh
Confidence            8889999999988877889999999999999999999998777 999999999999999998764



>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Back     alignment and structure
>3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Back     alignment and structure
>4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} Back     alignment and structure
>4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 236
d1v25a_534 e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 5e-71
d1pg4a_643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 2e-59
d1lcia_541 e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali 2e-59
d1ry2a_640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 6e-54
d1amua_514 e.23.1.1 (A:) Phenylalanine activating domain of g 7e-52
d3cw9a1503 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc 2e-51
d1mdba_536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 6e-49
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Long chain fatty acid-CoA ligase TT0168
species: Thermus thermophilus [TaxId: 274]
 Score =  223 bits (570), Expect = 5e-71
 Identities = 84/225 (37%), Positives = 119/225 (52%), Gaps = 4/225 (1%)

Query: 1   MEELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDP 60
            E +G  +   YGLTET         K    SL  EE+  +KA+ G+P   +  + + D 
Sbjct: 306 FERMGVEVRQGYGLTETSPVVVQNFVKSHLESLSEEEKLTLKAKTGLPIPLV-RLRVADE 364

Query: 61  VTMKSVPSDAKTIGEVMFRGNTVMNGYLKNLKATQDAFD-GGWFRSGDLGVRHPDGYIEL 119
              + VP D K +GEV  +G  +  GY  N +AT+ A    G+FR+GD+ V   +GY+E+
Sbjct: 365 -EGRPVPKDGKALGEVQLKGPWITGGYYGNEEATRSALTPDGFFRTGDIAVWDEEGYVEI 423

Query: 120 KDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDDHWGETPCAFVKLKDGCVAN 179
           KDR KD+I SGGE IS++++E+ L  HP V EAAVV  P   W E P A V  +      
Sbjct: 424 KDRLKDLIKSGGEWISSVDLENALMGHPKVKEAAVVAIPHPKWQERPLAVVVPRGEKPTP 483

Query: 180 GEEIINYCRDRLPHYMAPRTVVF-EDLPKTSTGKTQKYVLREKAK 223
            E   +  +     +  P   VF E++P+TS GK  K  LRE+ K
Sbjct: 484 EELNEHLLKAGFAKWQLPDAYVFAEEIPRTSAGKFLKRALREQYK 528


>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 100.0
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 100.0
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 100.0
d1ry2a_640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 100.0
d1amua_514 Phenylalanine activating domain of gramicidin synt 100.0
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 100.0
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 100.0
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Long chain fatty acid-CoA ligase TT0168
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=5.6e-43  Score=306.35  Aligned_cols=223  Identities=37%  Similarity=0.590  Sum_probs=160.9

Q ss_pred             ccccCeeeecccccccCCCcceeecCCCCCCCChhHHhhhhccCCCccCCcceEEEeCCCCCcccCCCCCceeEEEEecC
Q 046870            2 EELGFTLTHAYGLTETYGPGTVCVWKPDWNSLPREEQAKIKARQGVPHLGLDEIDIKDPVTMKSVPSDAKTIGEVMFRGN   81 (236)
Q Consensus         2 ~~~g~~i~~~YG~TE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~v~i~d~~~~~~~~~~~~~~Gel~v~~~   81 (236)
                      +.+|.++++.||+||++++++.....................++|.|++++ +++|+|+ ++++++.+.++.|||+|+|+
T Consensus       307 ~~~~~~i~~~yG~te~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~p~~g~-~~~i~d~-~~~~~~~~~~~~Gel~v~g~  384 (534)
T d1v25a_         307 ERMGVEVRQGYGLTETSPVVVQNFVKSHLESLSEEEKLTLKAKTGLPIPLV-RLRVADE-EGRPVPKDGKALGEVQLKGP  384 (534)
T ss_dssp             HHTTCEEEEEEECGGGSSEEEECCCCGGGTTSCHHHHHHHHTSCBEECTTC-EEEEECT-TSCBCCSSSCCCEEEEEEST
T ss_pred             HHhCCeeeeeccccccccceeecccCccccccCccccccccccceeccCCc-EEEEECC-CCCCCCCCCCeeEEEEEcCC
Confidence            356889999999999998777654444444445555566778999999999 9999998 89999987778999999999


Q ss_pred             CcchhhcCCchhhhccc-CCCeEeccceEEEecCCeEEEEccCCCeEEEcceeeCHHHHHHHHhcCCCcceEEEEeccCC
Q 046870           82 TVMNGYLKNLKATQDAF-DGGWFRSGDLGVRHPDGYIELKDRSKDIIISGGENISTIEVESVLFSHPSVLEAAVVGRPDD  160 (236)
Q Consensus        82 ~~~~~y~~~~~~~~~~~-~~g~~~TGD~~~~~~~g~l~~~GR~~d~i~~~G~~v~~~~iE~~l~~~~~v~~~~v~~~~~~  160 (236)
                      +++.||+++++.+...+ .+|||+|||+++++++|.|+++||.+|+||++|++|+|.+||+.|.++|.|.+++|++.+++
T Consensus       385 ~v~~gY~~~~~~t~~~~~~dg~~~TGDlg~~~~~G~l~~~GR~~~~i~~~G~~v~~~eIE~~l~~~~~V~~a~v~~~~~~  464 (534)
T d1v25a_         385 WITGGYYGNEEATRSALTPDGFFRTGDIAVWDEEGYVEIKDRLKDLIKSGGEWISSVDLENALMGHPKVKEAAVVAIPHP  464 (534)
T ss_dssp             TSBSSCBTCHHHHHTTBCTTSCEEEEEEEEECTTCCEEEEEESSCEEEETTEEEEHHHHHCC----------CEEEEECS
T ss_pred             cccceecCChhhhhhhcccCCCCccCceeEECCCccEEEecccccEEEECCEEECHHHHHHHHHhCCCcceEEEEEEECC
Confidence            99999999999998877 58999999999999999999999999999999999999999999999999999999999988


Q ss_pred             CCCceeEEEEEeCCCCCCCHHHHHHHHHhcCCCCCCccEEEEcc-cCCCCCCcccHHHHHHHHHhcC
Q 046870          161 HWGETPCAFVKLKDGCVANGEEIINYCRDRLPHYMAPRTVVFED-LPKTSTGKTQKYVLREKAKAMG  226 (236)
Q Consensus       161 ~~~~~~~~~v~~~~~~~~~~~~l~~~l~~~l~~~~~p~~i~~~~-lP~t~~GKi~R~~l~~~~~~~~  226 (236)
                      ..++.++++|+++.......+.+...+++.|++|++|..+++++ ||+|++|||+|++|+++++++-
T Consensus       465 ~~~~~l~a~vv~~~~~~~~~~~~~~~~~~~l~~~~~P~~i~~~~~lP~t~~GKi~R~~lr~~~~~~~  531 (534)
T d1v25a_         465 KWQERPLAVVVPRGEKPTPEELNEHLLKAGFAKWQLPDAYVFAEEIPRTSAGKFLKRALREQYKNYY  531 (534)
T ss_dssp             SSSEEEEECC-------------------CCCTTTSCSBC--------------CCTTHHHHSTTSS
T ss_pred             CCCeEEEEEEEeCCCCCCHHHHHHHHHHhcCCcCCCccEEEEECCCCCCCCccccHHHHHHHHHhhh
Confidence            88889999988876533333333445777899999999998777 9999999999999999997753



>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure