Citrus Sinensis ID: 046887

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MSFVLSKTSIALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIRTNGAGNSPNVPTRPMLQLSPYSSPGWNPWLESSAWQLPLATKL
cHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHccccEEEccEEEEEEccccccEEEEcHHHHccccccccccccccccEEEEccccccEEEEcccccccccccEEEEEEccccccccccccccccccccccccccccccccccccHHcccc
cHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccEEcccccccHHHHHcccEEEEccEEEEEEccccccEEEEcHHHHHHccccccccEccccccEEEEcccccEEEEcccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccHHccc
MSFVLSKTSIALLLVMAIVSRVSFGavykvgddagwsipnaqsvnyNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAyescntqspmksyttgkdsitlessdpryficgapghcqmgmkleirtngagnspnvptrpmlqlspysspgwnpwlessawqlplatkl
MSFVLSKTSIALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYEScntqspmksyttgkDSITLESSDPRYFICGAPGHCQMGMKLEIRTNGAGNSPNVPTRPMLQLSPYSSPGWNPWLEssawqlplatkl
MSFVLSKTSIALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIRTNGAGNSPNVPTRPMLQLSPYSSPGWNPWLESSAWQLPLATKL
***VLSKTSIALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYE************************PRYFICGAPGHCQMGMKLEI**************************WNPWLE***W********
********SIALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEI*************************************LPLATKL
MSFVLSKTSIALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIRTNGAGNSPNVPTRPMLQLSPYSSPGWNPWLESSAWQLPLATKL
*SFVLSKTSIALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIRTNGA***************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFVLSKTSIALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIRTNGAGNSPNVPTRPMLQLSPYSSPGWNPWLESSAWQLPLATKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.579 0.907 0.490 2e-24
P00302107 Stellacyanin OS=Toxicoden N/A no 0.591 0.934 0.445 2e-23
Q9SK27182 Early nodulin-like protei no no 0.662 0.615 0.427 6e-21
Q41001189 Blue copper protein OS=Pi N/A no 0.674 0.603 0.383 1e-17
Q8LC95186 Early nodulin-like protei no no 0.562 0.510 0.421 2e-17
P0030396 Basic blue protein OS=Cuc N/A no 0.550 0.968 0.42 3e-17
P60496126 Chemocyanin OS=Lilium lon N/A no 0.544 0.730 0.383 5e-15
Q07488196 Blue copper protein OS=Ar no no 0.721 0.622 0.349 8e-15
Q8LG89129 Basic blue protein OS=Ara no no 0.662 0.868 0.344 8e-15
P42849115 Umecyanin OS=Armoracia ru N/A no 0.573 0.843 0.367 1e-13
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function desciption
 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 71/104 (68%), Gaps = 6/104 (5%)

Query: 27  VYKVGDDAGWS--IPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCN 84
           V+KVGD  GW+  +P     +Y  WA +  FHVGD L F YN+ FH+VL+V ++ ++SCN
Sbjct: 3   VHKVGDSTGWTTLVP----YDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCN 58

Query: 85  TQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIRTN 128
           + SP  SYT+G DSI L+     YF+CG PGHCQ+G K+EI+ +
Sbjct: 59  SSSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVD 102

Cucurbita pepo (taxid: 3663)
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|Q8LC95|ENL3_ARATH Early nodulin-like protein 3 OS=Arabidopsis thaliana GN=At5g25090 PE=1 SV=2 Back     alignment and function description
>sp|P00303|BABL_CUCSA Basic blue protein OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|Q8LG89|BABL_ARATH Basic blue protein OS=Arabidopsis thaliana GN=ARPN PE=1 SV=2 Back     alignment and function description
>sp|P42849|UMEC_ARMRU Umecyanin OS=Armoracia rusticana PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
224108071185 predicted protein [Populus trichocarpa] 0.704 0.643 0.454 3e-28
356534224185 PREDICTED: mavicyanin-like [Glycine max] 0.698 0.637 0.462 7e-28
351722607183 uncharacterized protein LOC100306029 [Gl 0.704 0.650 0.450 8e-28
357480825182 Early nodulin-like protein [Medicago tru 0.721 0.670 0.452 9e-28
147822728190 hypothetical protein VITISV_025412 [Viti 0.739 0.657 0.465 2e-27
255552341200 Mavicyanin, putative [Ricinus communis] 0.710 0.6 0.455 3e-27
449444779185 PREDICTED: mavicyanin-like [Cucumis sati 0.662 0.605 0.456 4e-27
225432610190 PREDICTED: mavicyanin [Vitis vinifera] g 0.727 0.647 0.472 5e-27
449525966179 PREDICTED: mavicyanin-like [Cucumis sati 0.715 0.675 0.430 9e-27
297812849186 hypothetical protein ARALYDRAFT_489473 [ 0.674 0.612 0.474 2e-26
>gi|224108071|ref|XP_002314710.1| predicted protein [Populus trichocarpa] gi|118485573|gb|ABK94638.1| unknown [Populus trichocarpa] gi|222863750|gb|EEF00881.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 81/121 (66%), Gaps = 2/121 (1%)

Query: 5   LSKTSIALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFE 64
           L   ++ALL VM ++  +   AVYKVGD AGW+     +++Y  W+    F VGD++ FE
Sbjct: 3   LVMRAVALLTVMTLMLELIHAAVYKVGDSAGWTASG--NIDYKQWSATKTFQVGDVILFE 60

Query: 65  YNSLFHSVLEVSRDAYESCNTQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLE 124
           YN+ FH+V+ V+   Y++CNT +PM +YTTG DSIT+++    +F CG PGHCQ G K++
Sbjct: 61  YNAQFHNVMRVTHAMYKACNTSAPMATYTTGNDSITIKTRRHHFFFCGVPGHCQAGQKVD 120

Query: 125 I 125
           I
Sbjct: 121 I 121

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356534224|ref|XP_003535657.1| PREDICTED: mavicyanin-like [Glycine max] Back     alignment and taxonomy information
>gi|351722607|ref|NP_001236482.1| uncharacterized protein LOC100306029 [Glycine max] gi|255627325|gb|ACU14007.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357480825|ref|XP_003610698.1| Early nodulin-like protein [Medicago truncatula] gi|355512033|gb|AES93656.1| Early nodulin-like protein [Medicago truncatula] gi|388518523|gb|AFK47323.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|147822728|emb|CAN61765.1| hypothetical protein VITISV_025412 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552341|ref|XP_002517215.1| Mavicyanin, putative [Ricinus communis] gi|223543850|gb|EEF45378.1| Mavicyanin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449444779|ref|XP_004140151.1| PREDICTED: mavicyanin-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225432610|ref|XP_002281674.1| PREDICTED: mavicyanin [Vitis vinifera] gi|297737024|emb|CBI26225.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449525966|ref|XP_004169987.1| PREDICTED: mavicyanin-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297812849|ref|XP_002874308.1| hypothetical protein ARALYDRAFT_489473 [Arabidopsis lyrata subsp. lyrata] gi|297320145|gb|EFH50567.1| hypothetical protein ARALYDRAFT_489473 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.958 0.81 0.404 1e-27
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.875 0.791 0.405 1.3e-27
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.911 0.747 0.362 1.3e-22
TAIR|locus:2118691190 ENODL12 "early nodulin-like pr 0.822 0.731 0.387 4.3e-22
TAIR|locus:2040164182 ENODL14 "early nodulin-like pr 0.662 0.615 0.427 2.4e-21
TAIR|locus:2116767177 ENODL15 "early nodulin-like pr 0.692 0.661 0.410 2.4e-21
TAIR|locus:2085775203 ENODL9 "early nodulin-like pro 0.810 0.674 0.398 3e-21
TAIR|locus:2081957222 UCC3 "uclacyanin 3" [Arabidops 0.875 0.666 0.363 7.2e-20
TAIR|locus:2081952187 AT3G60270 [Arabidopsis thalian 0.828 0.748 0.353 5.1e-19
TAIR|locus:2061406226 ENODL11 "early nodulin-like pr 0.532 0.398 0.378 6.4e-19
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 310 (114.2 bits), Expect = 1.0e-27, P = 1.0e-27
 Identities = 68/168 (40%), Positives = 88/168 (52%)

Query:     1 MSFVLSKTSIALLLVMAIVSRVSFGA-VYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGD 59
             M+ + S      LL++  +  +S G  V+KVGD  GW+I    SVNY  WA  I F VGD
Sbjct:     1 MALIKSNAFFTSLLILVALFGISVGGTVHKVGDSDGWTI---MSVNYETWASTITFQVGD 57

Query:    60 ILSFEYNSLFHSVLEVSRDAYESCNTQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQM 119
              L F+YN  FH V EV+ + YE C    P+  Y TG D + L     ++FICG PGHC M
Sbjct:    58 SLVFKYNKDFHDVTEVTHNDYEMCEPSKPLARYETGSDIVILTKPGLQHFICGFPGHCDM 117

Query:   120 GMKLEIRTNGAGNSP-NVPTR-PMLQLSPYSSPGWNPWLESSAWQLPL 165
             G KL+I    A   P   P   P+   S +SSP  +P  ES     P+
Sbjct:   118 GQKLQIHVLPASLGPVAAPVPGPVRPPSSFSSPSQSPLAESPVNHAPV 165
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118691 ENODL12 "early nodulin-like protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040164 ENODL14 "early nodulin-like protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116767 ENODL15 "early nodulin-like protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085775 ENODL9 "early nodulin-like protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081957 UCC3 "uclacyanin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081952 AT3G60270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061406 ENODL11 "early nodulin-like protein 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_X0820
SubName- Full=Putative uncharacterized protein; (185 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 3e-37
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 2e-20
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score =  122 bits (309), Expect = 3e-37
 Identities = 41/86 (47%), Positives = 54/86 (62%), Gaps = 2/86 (2%)

Query: 36  WSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQSPMKSYTTG 95
           W++P   + +Y  WA    F VGD L F Y+  FH+V+EV++  YESCNT  P+++YTTG
Sbjct: 1   WTVP--LNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPIRTYTTG 58

Query: 96  KDSITLESSDPRYFICGAPGHCQMGM 121
            D I L      YFICG PGHC+ G 
Sbjct: 59  NDIIPLTKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 100.0
PRK02710119 plastocyanin; Provisional 98.54
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.33
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.19
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 98.0
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 97.92
COG3794128 PetE Plastocyanin [Energy production and conversio 97.83
TIGR0265783 amicyanin amicyanin. Members of this family are am 96.95
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 96.81
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.61
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 95.79
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 94.99
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 94.96
COG4454158 Uncharacterized copper-binding protein [Inorganic 92.45
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 92.32
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 89.35
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 86.31
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 84.52
PRK10378 375 inactive ferrous ion transporter periplasmic prote 81.23
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.5e-44  Score=285.16  Aligned_cols=115  Identities=33%  Similarity=0.659  Sum_probs=104.0

Q ss_pred             HHHHHHHHHhhhccceEEEecCCCCCCCCCCCCCCchhhccCCeeeeccEeEEEEcCCcceEEEEccccCccccCCCCCc
Q 046887           11 ALLLVMAIVSRVSFGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQSPMK   90 (169)
Q Consensus        11 ~~l~~~~ll~~~a~a~~~~VGg~~GW~~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~hsV~~V~~~~Y~~C~~s~~~~   90 (169)
                      +++++++++...+.|++|+|||+.||+..    .||++|+++++|++||+|+|+|++++|||+||++++|++|+.++++.
T Consensus         6 l~~~~~~~~~~~~~a~~~~VGd~~GW~~~----~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~   81 (167)
T PLN03148          6 LFCFFALFSASATTATDHIVGANKGWNPG----INYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAG   81 (167)
T ss_pred             HHHHHHHHhhhhccceEEEeCCCCCcCCC----CChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCcc
Confidence            33334444555778999999999999954    78999999999999999999999999999999999999999999999


Q ss_pred             ccccCCcEEEecCCCceEEEcCCCCcCCCCCEEEEEecCC
Q 046887           91 SYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIRTNGA  130 (169)
Q Consensus        91 ~~~~G~~~v~L~~~G~~YFicg~~~HC~~GmKl~I~V~~~  130 (169)
                      .+++|++.|+|+++|+|||||+ .+||++||||+|+|.+.
T Consensus        82 ~~tsG~d~v~L~~~G~~YFIcg-~ghC~~GmKl~I~V~~~  120 (167)
T PLN03148         82 NWTSGKDFIPLNKAKRYYFICG-NGQCFNGMKVTILVHPL  120 (167)
T ss_pred             eecCCCcEEEecCCccEEEEcC-CCccccCCEEEEEEcCC
Confidence            9999999999999999999999 69999999999999653

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 2e-25
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 5e-18
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 1e-14
1f56_A91 Spinach Plantacyanin Length = 91 8e-12
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 3e-09
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure 
Iteration: 1

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 71/104 (68%), Gaps = 6/104 (5%)
Query: 27  VYKVGDDAGWS--IPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCN 84
           V+KVGD  GW+  +P     +Y  WA +  FHVGD L F YN+ FH+VL+V ++ ++SCN
Sbjct: 4   VHKVGDSTGWTTLVP----YDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCN 59
Query: 85  TQSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIRTN 128
           + SP  SYT+G DSI L+     YF+CG PGHCQ+G K+EI+ +
Sbjct: 60  SSSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVD 103
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 2e-42
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 2e-41
2cbp_A96 Cucumber basic protein; electron transport, phytoc 1e-40
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 6e-36
1jer_A138 Cucumber stellacyanin; electron transport, copper, 2e-35
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
 Score =  136 bits (344), Expect = 2e-42
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 28  YKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQS 87
           Y VG D  W  P +    Y  WA    F VGD L F++ +  H V  V++DA+++C  ++
Sbjct: 4   YDVGGDMEWKRP-SDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKEN 62

Query: 88  PMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIRTNGAGNSPNVPT 138
           P+   TT    I L ++ P+Y+IC    HC++G KL I   GAG +    T
Sbjct: 63  PISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGAGGAGGGAT 113
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 100.0
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.28
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.12
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.11
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.87
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.86
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.8
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.78
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.78
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.76
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.72
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.68
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.66
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.66
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.65
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.61
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.6
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.51
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.14
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.03
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.95
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 97.94
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.92
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.82
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.79
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.69
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 97.64
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.62
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.56
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.53
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 97.33
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 97.18
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 96.83
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 96.82
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 96.74
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 96.27
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 96.1
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 94.42
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 94.14
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 93.81
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 92.54
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 91.9
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 91.71
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 91.21
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 80.44
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=5.9e-45  Score=281.10  Aligned_cols=112  Identities=29%  Similarity=0.596  Sum_probs=101.7

Q ss_pred             cceEEEecCCCCCCCCCCCCCCchhhccCCeeeeccEeEEEEcCCcceEEEE-ccccCccccCCCCCcccccCCcEEEe-
Q 046887           24 FGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEV-SRDAYESCNTQSPMKSYTTGKDSITL-  101 (169)
Q Consensus        24 ~a~~~~VGg~~GW~~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~hsV~~V-~~~~Y~~C~~s~~~~~~~~G~~~v~L-  101 (169)
                      +|++|+|||+.||++++. ..||++||++++|+|||+|+|+|.+++|+|+|| ++++|+.|+.++++..+++|+++|+| 
T Consensus         2 ~a~~~~VGg~~GW~~~~~-~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~p~~~~~~G~~~v~L~   80 (138)
T 1jer_A            2 QSTVHIVGDNTGWSVPSS-PNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERL   80 (138)
T ss_dssp             CCCEEETTGGGCSSCCSS-TTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTTSCCCCCCCSCEEEEC
T ss_pred             CceEEEECCcCcCcCCCC-ccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCCccccccCCCeEEEec
Confidence            578999999999999742 478999999999999999999999999999999 99999999999999999999999999 


Q ss_pred             cCCCceEEEcCCCCcCCCCCEEEEEecCCCCCCCC
Q 046887          102 ESSDPRYFICGAPGHCQMGMKLEIRTNGAGNSPNV  136 (169)
Q Consensus       102 ~~~G~~YFicg~~~HC~~GmKl~I~V~~~~~~~~~  136 (169)
                      +++|++||||++++||++||||+|+|....+++++
T Consensus        81 ~~~G~~YFicg~~gHC~~GmKl~I~V~~~~~~~~~  115 (138)
T 1jer_A           81 DELGMHYFVCTVGTHCSNGQKLSINVVAANATVSM  115 (138)
T ss_dssp             CSSEEEEEECCSTTTGGGTCEEEEEEECCC-----
T ss_pred             cCCcCEEEEcCCCCccccCCEEEEEEcCCCCCCCC
Confidence            99999999999999999999999999988665333
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 2e-41
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 2e-40
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 6e-36
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 3e-35
d2plta_98 b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomon 0.003
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

 Score =  132 bits (333), Expect = 2e-41
 Identities = 42/101 (41%), Positives = 56/101 (55%), Gaps = 7/101 (6%)

Query: 26  AVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNT 85
           AVY VG   GW+       N  +W +   F  GDIL F YN   H+V+ V++  + +CNT
Sbjct: 1   AVYVVGGSGGWT------FNTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNT 54

Query: 86  QSPMKSYTTGKDSITLESSDPRYFICGAPGHCQMGMKLEIR 126
            +  K YT+G+D I L      YFIC  PGHCQ GMK+ + 
Sbjct: 55  PAGAKVYTSGRDQIKLPKG-QSYFICNFPGHCQSGMKIAVN 94
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 100.0
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.97
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.88
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.82
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.8
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.72
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.71
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.69
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.66
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.64
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.63
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.53
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.52
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.4
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.39
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.32
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.07
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.66
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.56
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.42
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.19
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 96.97
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 96.52
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 96.31
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 95.92
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 95.5
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 95.06
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 94.71
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 94.41
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 94.16
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 93.85
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 93.14
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 89.48
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 88.39
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 87.9
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 87.57
d1yela1102 At1g16640 {Thale cress (Arabidopsis thaliana) [Tax 82.37
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 81.49
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

Probab=100.00  E-value=1e-40  Score=244.28  Aligned_cols=104  Identities=48%  Similarity=0.972  Sum_probs=98.7

Q ss_pred             cceEEEecCCCCCCCCCCCCCCchhhccCCeeeeccEeEEEEcCCcceEEEEccccCccccCCCCCcccccCCcEEEecC
Q 046887           24 FGAVYKVGDDAGWSIPNAQSVNYNAWAEAIDFHVGDILSFEYNSLFHSVLEVSRDAYESCNTQSPMKSYTTGKDSITLES  103 (169)
Q Consensus        24 ~a~~~~VGg~~GW~~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~hsV~~V~~~~Y~~C~~s~~~~~~~~G~~~v~L~~  103 (169)
                      .|++|+|||+.||+++  .+.||++|+++++|++||+|+|+|+++.|+|+||++++|+.|+..+++..+++|++.|+|++
T Consensus         1 ~at~~~VGg~~gW~~~--~~~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~~~y~~C~~~~~~~~~~~G~~~v~l~~   78 (104)
T d1ws8a_           1 MATVHKVGDSTGWTTL--VPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKR   78 (104)
T ss_dssp             CCCEEETTGGGCSCSS--SCCCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSSCSEEECSSEEEEECCS
T ss_pred             CCcEEEeCCcCccCcC--CCcCHHHHhhCCcCCCCCEEEEEECCCCceEEEECHHHhcCCcCCCccccccCCCeEEEEec
Confidence            3789999999999986  35789999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceEEEcCCCCcCCCCCEEEEEecC
Q 046887          104 SDPRYFICGAPGHCQMGMKLEIRTNG  129 (169)
Q Consensus       104 ~G~~YFicg~~~HC~~GmKl~I~V~~  129 (169)
                      +|++||||++++||++||||+|+|..
T Consensus        79 ~g~~yF~C~~~~HC~~Gmkl~I~V~P  104 (104)
T d1ws8a_          79 PGTFYFLCGIPGHCQLGQKVEIKVDP  104 (104)
T ss_dssp             SEEEEEECCSTTTTTTTCEEEEEECC
T ss_pred             CccEEEECCCcchhhCCCEEEEEECC
Confidence            99999999999999999999999963
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1yela1 b.142.1.2 (A:1-102) At1g16640 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure