Citrus Sinensis ID: 046932

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MEQMNELEIAISKAELLLRLGNWSTHCSAFDCGDQEQLEFVRLETMTKNLAMSRAQTQQKDFKTALMEVELQVSIHLAKLLEPTIDPALACTTALSVDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRATCKPKKLHFQEIKI
ccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHcccEEEEEccccccccccccccccccccEEcccccccccccccHHHHHHccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEHHHHHHHHHHHHHHHccccccHcccccccccHEEHcccccccccccEEEEEEEEcccccccEEEEEHHHccccccEEEcccccccccHHHHHHHHHccccccccccccccccccEEEEcc
MEQMNELEIAISKAELLLRLGnwsthcsafdcgdqEQLEFVRLETMTKNLAMSRAQTQQKDFKTALMEVELQVSIHLAKLleptidpalACTTAlsvdgedgivcGVCQEEMEKEHEARAIMECMHMFHDSCILKWLkinntcplcratckpkklhfqeiki
MEQMNELEIAISKAELLLRLGNWSTHCSAFDCGDQEQLEFVRLETMTKNLAMSRAQTQQKDFKTALMEVELQVSIHLAKLLEPTIDPALACTTALSVDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLcratckpkklhfqeiki
MEQMNELEIAISKAELLLRLGNWSTHCSAFDCGDQEQLEFVRLETMTKNLAMSRAQTQQKDFKTALMEVELQVSIHLAKLLEPTIDPALACTTALSVDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRATCKPKKLHFQEIKI
*******EIAISKAELLLRLGNWSTHCSAFDCGDQEQLEFVRLETMTKNLA*********DFKTALMEVELQVSIHLAKLLEPTIDPALACTTALSVDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRATCKPKKLH******
*************************************************************************************DPALACTTALSVDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRA**************
MEQMNELEIAISKAELLLRLGNWSTHCSAFDCGDQEQLEFVRLETMTKNLAMSRAQTQQKDFKTALMEVELQVSIHLAKLLEPTIDPALACTTALSVDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRATCKPKKLHFQEIKI
**QMNELEIAISKAELLLRLGNWSTHC*******QEQLEFVRLETMTKNLAMSRAQTQQKDFKTALMEVELQVSIHLAKLLEPTIDPALACTTALSVDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRATCKPKKLHFQEIKI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQMNELEIAISKAELLLRLGNWSTHCSAFDCGDQEQLEFVRLETMTKNLAMSRAQTQQKDFKTALMEVELQVSIHLAKLLEPTIDPALACTTALSVDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRATCKPKKLHFQEIKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
P0CH03366 Putative RING-H2 finger p yes no 0.333 0.147 0.481 1e-09
Q9C7I1 327 RING-H2 finger protein AT no no 0.339 0.168 0.454 3e-09
P0CH01372 Putative RING-H2 finger p no no 0.345 0.150 0.446 1e-08
P0CH02362 Putative RING-H2 finger p no no 0.308 0.138 0.5 1e-08
Q9SK92 381 E3 ubiquitin-protein liga no no 0.481 0.204 0.337 2e-08
O22255227 RING-H2 finger protein AT no no 0.333 0.237 0.456 4e-08
P0C035 310 RING-H2 finger protein AT no no 0.506 0.264 0.322 5e-08
Q9C7E9299 RING-H2 finger protein AT no no 0.314 0.170 0.431 5e-08
Q84W40 404 RING-H2 finger protein AT no no 0.333 0.133 0.444 7e-08
Q9LZJ6257 RING-H2 finger protein AT no no 0.308 0.194 0.42 7e-08
>sp|P0CH03|AT21C_ARATH Putative RING-H2 finger protein ATL21C OS=Arabidopsis thaliana GN=ATL21C PE=3 SV=1 Back     alignment and function desciption
 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%)

Query: 97  VDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRATC 150
           + G +GIVC +C  E   +   R I EC H FH  CI  WLKI+ +CPLCR +C
Sbjct: 312 LSGTNGIVCPICLSEYASKETVRFIPECDHCFHVECIDVWLKIHGSCPLCRNSC 365

Arabidopsis thaliana (taxid: 3702)
>sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 Back     alignment and function description
>sp|P0CH01|AT21A_ARATH Putative RING-H2 finger protein ATL21A OS=Arabidopsis thaliana GN=ATL21A PE=3 SV=1 Back     alignment and function description
>sp|P0CH02|AT21B_ARATH Putative RING-H2 finger protein ATL21B OS=Arabidopsis thaliana GN=ATL21B PE=3 SV=1 Back     alignment and function description
>sp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana GN=ATL15 PE=1 SV=1 Back     alignment and function description
>sp|O22255|ATL64_ARATH RING-H2 finger protein ATL64 OS=Arabidopsis thaliana GN=ATL64 PE=2 SV=1 Back     alignment and function description
>sp|P0C035|ATL60_ARATH RING-H2 finger protein ATL60 OS=Arabidopsis thaliana GN=ATL60 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7E9|ATL20_ARATH RING-H2 finger protein ATL20 OS=Arabidopsis thaliana GN=ATL20 PE=2 SV=2 Back     alignment and function description
>sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 Back     alignment and function description
>sp|Q9LZJ6|ATL5_ARATH RING-H2 finger protein ATL5 OS=Arabidopsis thaliana GN=ATL5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
359479248162 PREDICTED: E3 ubiquitin-protein ligase R 0.913 0.913 0.403 2e-21
255572221158 zinc finger protein, putative [Ricinus c 0.802 0.822 0.370 2e-13
242069551245 hypothetical protein SORBIDRAFT_05g02755 0.425 0.281 0.4 5e-09
449432054 382 PREDICTED: putative RING-H2 finger prote 0.753 0.319 0.298 6e-09
297806851 384 zinc finger family protein [Arabidopsis 0.395 0.166 0.415 1e-08
449477933 382 PREDICTED: putative RING-H2 finger prote 0.753 0.319 0.298 1e-08
413954126248 putative RING zinc finger domain superfa 0.320 0.209 0.519 1e-08
226505256 279 uncharacterized LOC100274803 [Zea mays] 0.456 0.265 0.405 2e-08
212722078223 uncharacterized protein LOC100192713 [Ze 0.320 0.233 0.519 2e-08
194691390135 unknown [Zea mays] 0.320 0.385 0.519 3e-08
>gi|359479248|ref|XP_003632240.1| PREDICTED: E3 ubiquitin-protein ligase RNF181-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 84/156 (53%), Gaps = 8/156 (5%)

Query: 4   MNELEIAISKAELLLRLGNWST-----HCSAFDCG--DQEQLEFVRLETMTKNLAMSRAQ 56
           M+EL+IA + A++L RL +W         S    G  + E+L+  +L+ MT  LA SRA 
Sbjct: 1   MDELQIARATAQILHRLEHWGKIVADHRPSEAGTGRFEGEELQLRKLKRMTYELAQSRAA 60

Query: 57  TQQKDFKTALMEVELQVSIHLAKLLEPTIDPALACTTALSVDGEDGIVCGVCQEEMEKEH 116
              +DF   L E EL V + + ++L  T+DP L      +V  E+G VCGVCQEEME   
Sbjct: 61  ADCRDFGAVLRETELGVMVEMGRILAETVDPVLEGLRRETV-AEEGEVCGVCQEEMESGD 119

Query: 117 EARAIMECMHMFHDSCILKWLKINNTCPLCRATCKP 152
           E    M C H FH  CI +WL    +CPLCR    P
Sbjct: 120 EDVKSMGCAHRFHGFCIWRWLTERKSCPLCRNPLDP 155

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255572221|ref|XP_002527050.1| zinc finger protein, putative [Ricinus communis] gi|223533612|gb|EEF35350.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|242069551|ref|XP_002450052.1| hypothetical protein SORBIDRAFT_05g027550 [Sorghum bicolor] gi|241935895|gb|EES09040.1| hypothetical protein SORBIDRAFT_05g027550 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|449432054|ref|XP_004133815.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297806851|ref|XP_002871309.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297317146|gb|EFH47568.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449477933|ref|XP_004155166.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|413954126|gb|AFW86775.1| putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information
>gi|226505256|ref|NP_001142551.1| uncharacterized LOC100274803 [Zea mays] gi|195606334|gb|ACG24997.1| hypothetical protein [Zea mays] gi|413916096|gb|AFW56028.1| putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information
>gi|212722078|ref|NP_001131387.1| uncharacterized protein LOC100192713 [Zea mays] Back     alignment and taxonomy information
>gi|194691390|gb|ACF79779.1| unknown [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2199272248 AT1G68180 [Arabidopsis thalian 0.395 0.258 0.382 3.1e-11
TAIR|locus:2177866161 AT5G41430 [Arabidopsis thalian 0.308 0.310 0.52 1.5e-10
ZFIN|ZDB-GENE-060503-608301 si:ch211-81a5.1 "si:ch211-81a5 0.462 0.249 0.316 3e-10
TAIR|locus:2169105208 AT5G37230 "AT5G37230" [Arabido 0.296 0.230 0.44 4.1e-10
TAIR|locus:2061057198 AT2G24480 [Arabidopsis thalian 0.685 0.560 0.284 4.1e-10
TAIR|locus:2206722 327 AT1G35330 [Arabidopsis thalian 0.339 0.168 0.454 4.5e-10
ZFIN|ZDB-GENE-040426-1024156 rnf181 "ring finger protein 18 0.376 0.391 0.403 6.6e-10
UNIPROTKB|E2QUN1153 RNF181 "Uncharacterized protei 0.709 0.751 0.333 8.4e-10
TAIR|locus:2169145208 AT5G37270 "AT5G37270" [Arabido 0.654 0.509 0.307 8.4e-10
UNIPROTKB|C9J1C6139 RNF181 "E3 ubiquitin-protein l 0.703 0.820 0.355 1.1e-09
TAIR|locus:2199272 AT1G68180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 155 (59.6 bits), Expect = 3.1e-11, P = 3.1e-11
 Identities = 26/68 (38%), Positives = 41/68 (60%)

Query:    83 PTIDPALACTTALSVDGEDGI---VCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKI 139
             P    A+     + +  ED +   VC +C+EE E   E + + +C+H++H SCI+ WL I
Sbjct:   113 PASQSAIEAVRTVIITDEDLVKEKVCAICKEEFEVGEEGKEL-KCLHLYHSSCIVSWLNI 171

Query:   140 NNTCPLCR 147
             +NTCP+CR
Sbjct:   172 HNTCPICR 179
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2177866 AT5G41430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-608 si:ch211-81a5.1 "si:ch211-81a5.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2169105 AT5G37230 "AT5G37230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061057 AT2G24480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206722 AT1G35330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1024 rnf181 "ring finger protein 181" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUN1 RNF181 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2169145 AT5G37270 "AT5G37270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|C9J1C6 RNF181 "E3 ubiquitin-protein ligase RNF181" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Sb05g027550.1
hypothetical protein (245 aa)
(Sorghum bicolor)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-12
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 5e-09
cd0016245 cd00162, RING, RING-finger (Really Interesting New 7e-09
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-06
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-06
smart0018440 smart00184, RING, Ring finger 2e-06
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 9e-06
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 4e-05
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 9e-05
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-04
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 0.001
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 0.001
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 57.0 bits (138), Expect = 5e-12
 Identities = 21/45 (46%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 104 VCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRA 148
            C +C +E E   E   ++ C H+FH  C+ KWL+ +NTCPLCRA
Sbjct: 2   ECPICLDEFEPGEEVV-VLPCGHVFHKECLDKWLRSSNTCPLCRA 45

Length = 46
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.51
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.4
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.31
PHA02929238 N1R/p28-like protein; Provisional 99.3
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.24
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.17
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.14
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.12
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.07
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.05
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.04
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.03
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.03
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.01
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.0
PHA02926242 zinc finger-like protein; Provisional 98.96
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.94
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.9
PF1463444 zf-RING_5: zinc-RING finger domain 98.89
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.88
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.85
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.76
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.72
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.7
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.65
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.64
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.62
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.6
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.55
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.53
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.51
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.46
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.29
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.26
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.25
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.25
COG52191525 Uncharacterized conserved protein, contains RING Z 98.19
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.18
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.18
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.15
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.14
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 98.12
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.1
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.98
KOG2660 331 consensus Locus-specific chromosome binding protei 97.82
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.81
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.74
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.72
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.63
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.58
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.54
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.54
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.52
COG5152259 Uncharacterized conserved protein, contains RING a 97.47
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.47
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.15
KOG1941518 consensus Acetylcholine receptor-associated protei 97.04
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.93
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.9
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.87
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.83
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.79
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.72
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.65
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 96.43
PF04641260 Rtf2: Rtf2 RING-finger 96.32
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.11
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.11
COG5222427 Uncharacterized conserved protein, contains RING Z 96.06
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.03
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.01
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.92
PHA02825162 LAP/PHD finger-like protein; Provisional 95.89
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.88
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.84
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 95.81
PHA03096284 p28-like protein; Provisional 95.75
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.73
KOG4739 233 consensus Uncharacterized protein involved in syna 95.71
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.67
PHA02862156 5L protein; Provisional 95.67
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.66
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 95.61
KOG1940276 consensus Zn-finger protein [General function pred 95.43
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 94.88
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.85
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 94.75
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 94.71
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 94.7
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.57
PF10272358 Tmpp129: Putative transmembrane protein precursor; 94.54
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.37
KOG0298 1394 consensus DEAD box-containing helicase-like transc 93.62
KOG3899381 consensus Uncharacterized conserved protein [Funct 93.39
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 92.96
KOG3002 299 consensus Zn finger protein [General function pred 92.82
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 92.67
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 92.13
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.81
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 91.46
KOG4718235 consensus Non-SMC (structural maintenance of chrom 91.41
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 90.97
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 89.51
KOG03091081 consensus Conserved WD40 repeat-containing protein 89.4
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 89.32
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 88.8
KOG0825 1134 consensus PHD Zn-finger protein [General function 88.71
PF0690657 DUF1272: Protein of unknown function (DUF1272); In 88.49
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 87.53
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 87.27
KOG4367 699 consensus Predicted Zn-finger protein [Function un 86.34
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 86.11
KOG3053 293 consensus Uncharacterized conserved protein [Funct 84.64
KOG1609 323 consensus Protein involved in mRNA turnover and st 83.83
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 83.72
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 80.93
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 80.42
KOG1829580 consensus Uncharacterized conserved protein, conta 80.11
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information 
Probab=99.51  E-value=4e-15  Score=86.43  Aligned_cols=43  Identities=49%  Similarity=1.123  Sum_probs=38.8

Q ss_pred             cccccccccccccceeEecCCCCccCHhhHHHHhcCCccccccc
Q 046932          104 VCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCR  147 (162)
Q Consensus       104 ~C~IC~~~~~~~~~~~~l~~C~H~f~~~Ci~~wl~~~~~CP~Cr  147 (162)
                      +|+||++.+..+..+..+ +|||.||..||..|++.+.+||+||
T Consensus         2 ~C~IC~~~~~~~~~~~~l-~C~H~fh~~Ci~~~~~~~~~CP~CR   44 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKL-PCGHVFHRSCIKEWLKRNNSCPVCR   44 (44)
T ss_dssp             CETTTTCBHHTTSCEEEE-TTSEEEEHHHHHHHHHHSSB-TTTH
T ss_pred             CCcCCChhhcCCCeEEEc-cCCCeeCHHHHHHHHHhCCcCCccC
Confidence            599999999887788777 7999999999999999999999997

...
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 2e-08
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 7e-07
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 3e-06
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 4e-05
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 1e-04
2ecl_A81 Solution Structure Of The Ring Domain Of The Human 6e-04
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure 
Iteration: 1

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%)
Query: 100 EDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRAT 149
           +DG+ C VC  E+E   EAR +  C H FH  C+  WL  ++TCPLCR T
Sbjct: 3   DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2ECL|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring-Box Protein 2 Length = 81 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 6e-17
2ect_A78 Ring finger protein 126; metal binding protein, st 4e-16
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-15
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-14
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-14
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 3e-14
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-14
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 7e-14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-13
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-13
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-12
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 3e-11
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 3e-10
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 9e-10
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 4e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 4e-08
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 6e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-06
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 7e-07
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 4e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 5e-06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 6e-06
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 2e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 5e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 7e-05
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 2e-04
3nw0_A238 Non-structural maintenance of chromosomes element 4e-04
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 6e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 6e-04
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
 Score = 70.4 bits (173), Expect = 6e-17
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 93  TALSVDGEDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRA 148
           T         + C +C  E  K   A   + C H FH  C+  WL+ + TCP+CR 
Sbjct: 31  TEDHGAVGQEMCCPICCSEYVKGDVAT-ELPCHHYFHKPCVSIWLQKSGTCPVCRC 85
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.57
2ect_A78 Ring finger protein 126; metal binding protein, st 99.55
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.54
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.53
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.53
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.52
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.52
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.5
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.49
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.47
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.46
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.45
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.43
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.42
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.42
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.41
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.41
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.41
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.4
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.39
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.38
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.38
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.37
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.36
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.35
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.33
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.33
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.33
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.33
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.32
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.32
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.32
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.3
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.29
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.27
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.24
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.24
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.23
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.23
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.23
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.23
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.22
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.21
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.2
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.2
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.18
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.17
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.15
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.14
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.14
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.1
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.09
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.01
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.01
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.0
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.0
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.97
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.95
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.9
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.89
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.86
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.78
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.78
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.77
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.59
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.59
2ea5_A68 Cell growth regulator with ring finger domain prot 98.58
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.55
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.51
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.25
3nw0_A238 Non-structural maintenance of chromosomes element 98.15
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.88
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.59
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.34
1we9_A64 PHD finger family protein; structural genomics, PH 89.43
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 89.21
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.52
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 87.24
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 85.09
1wil_A89 KIAA1045 protein; ring finger domain, structural g 84.79
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 84.33
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 83.74
2k16_A75 Transcription initiation factor TFIID subunit 3; p 83.68
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 83.51
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 82.75
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 82.73
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 82.58
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 82.31
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 82.28
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 81.63
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 81.3
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 81.1
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 80.97
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.57  E-value=1.8e-15  Score=90.69  Aligned_cols=51  Identities=47%  Similarity=0.998  Sum_probs=44.6

Q ss_pred             CCCccccccccccccccceeEecCCCCccCHhhHHHHhcCCcccccccccc
Q 046932          100 EDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRATC  150 (162)
Q Consensus       100 ~~~~~C~IC~~~~~~~~~~~~l~~C~H~f~~~Ci~~wl~~~~~CP~Cr~~~  150 (162)
                      ++...|+||++.+..+..+..++.|||.||..|+.+|++.+.+||+||..+
T Consensus         3 ~~~~~C~IC~~~~~~~~~~~~~~~C~H~f~~~Ci~~w~~~~~~CP~Cr~~~   53 (55)
T 1iym_A            3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCcCccCCccccCCCceEECCCCCCcccHHHHHHHHHcCCcCcCCCCEe
Confidence            345689999999988777766645999999999999999999999999876
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 7e-15
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 2e-11
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 7e-10
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-08
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 6e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 3e-07
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 6e-07
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 3e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 3e-05
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 63.0 bits (153), Expect = 7e-15
 Identities = 24/50 (48%), Positives = 31/50 (62%)

Query: 100 EDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRAT 149
           +DG+ C VC  E+E   EAR +  C H FH  C+  WL  ++TCPLCR T
Sbjct: 3   DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.71
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.56
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.53
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.48
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.46
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.39
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.37
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.36
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.36
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.32
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.26
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.22
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.22
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.15
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.0
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.5
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 91.13
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 90.96
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 90.13
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 89.39
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 87.46
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 87.02
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 85.71
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 85.71
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 84.86
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 81.49
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.71  E-value=2.3e-18  Score=102.49  Aligned_cols=51  Identities=47%  Similarity=0.998  Sum_probs=46.3

Q ss_pred             CCCccccccccccccccceeEecCCCCccCHhhHHHHhcCCcccccccccc
Q 046932          100 EDGIVCGVCQEEMEKEHEARAIMECMHMFHDSCILKWLKINNTCPLCRATC  150 (162)
Q Consensus       100 ~~~~~C~IC~~~~~~~~~~~~l~~C~H~f~~~Ci~~wl~~~~~CP~Cr~~~  150 (162)
                      +++.+|+||++.|..+..+..+++|+|.||..||.+|++.+++||+||.++
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i   53 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEe
Confidence            455679999999999888877778999999999999999999999999977
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure