Citrus Sinensis ID: 046985

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
ICGEYTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFLAYVLLGYNFKFAVKQPSVLIEHFSFEFVPCLHSVHSI
cccccccccccccHHHHHHHHHccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccccc
cccccccccccccHHHHHHHHcccEEEEEEEEEcccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccccHEEEEEcc
icgeytcdgipndyLGVLAKKFGAAVVSLEhhyygksspfkslsTENLKYLSSKQALFDLAIRFIFFLAYVLLGYNfkfavkqpsvliehfsfefvpclhsvhsi
icgeytcdgipnDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFLAYVLLGYNFKFAVKQPSVLIEHFSFEFVPCLHSVHSI
ICGEYTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFLAYVLLGYNFKFAVKQPSVLIEHFSFEFVPCLHSVHSI
**GEYTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFLAYVLLGYNFKFAVKQPSVLIEHFSFEFVPCLHS****
ICGEYTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFLAYVLLGYNFKFAVKQPSVLIEHFSFEFVPCLHSVHSI
ICGEYTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFLAYVLLGYNFKFAVKQPSVLIEHFSFEFVPCLHSVHSI
ICG*YTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFLAYVLLGYNFKFAVKQPSVLIEHFSFEFVPCLHSVHSI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ICGEYTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFLAYVLLGYNFKFAVKQPSVLIEHFSFEFVPCLHSVHSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query105 2.2.26 [Sep-21-2011]
Q1PF50 489 Probable serine protease no no 0.580 0.124 0.803 8e-22
P90893 540 Putative serine protease yes no 0.533 0.103 0.45 7e-08
P34676 507 Prolyl carboxy peptidase no no 0.514 0.106 0.473 6e-06
P34528 510 Putative serine protease no no 0.419 0.086 0.522 1e-05
Q9QXE5 509 Thymus-specific serine pr yes no 0.419 0.086 0.522 4e-05
Q9NQE7 514 Thymus-specific serine pr yes no 0.409 0.083 0.488 0.0003
>sp|Q1PF50|EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana GN=EDA2 PE=2 SV=2 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%)

Query: 1   ICGEYTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDL 60
           ICGE  C GI NDY+ VLAKKF A VVSLEH YYGKSSPF SL+TENLKYLSSKQAL+DL
Sbjct: 87  ICGEGPCSGIANDYINVLAKKFQAGVVSLEHRYYGKSSPFNSLATENLKYLSSKQALYDL 146

Query: 61  A 61
           A
Sbjct: 147 A 147
May be involved in a proteolytic pathway controlling the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: -EC: .EC: -
>sp|P90893|YM9I_CAEEL Putative serine protease F56F10.1 OS=Caenorhabditis elegans GN=F56F10.1 PE=1 SV=2 Back     alignment and function description
>sp|P34676|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1 Back     alignment and function description
>sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 Back     alignment and function description
>sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 Back     alignment and function description
>sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
297735044 487 unnamed protein product [Vitis vinifera] 0.885 0.190 0.648 2e-25
357483671 478 Thymus-specific serine protease [Medicag 0.590 0.129 0.870 1e-24
359476844 477 PREDICTED: probable serine protease EDA2 0.590 0.129 0.870 1e-24
224108896 490 predicted protein [Populus trichocarpa] 0.790 0.169 0.678 4e-24
449499944 486 PREDICTED: probable serine protease EDA2 0.904 0.195 0.598 8e-24
449457546 489 PREDICTED: probable serine protease EDA2 0.904 0.194 0.598 8e-24
388499696 390 unknown [Lotus japonicus] 0.590 0.158 0.838 9e-24
226502825 478 uncharacterized protein LOC100279875 pre 0.590 0.129 0.822 6e-23
413933853 478 putative serine peptidase S28 family pro 0.590 0.129 0.822 6e-23
357146992 489 PREDICTED: probable serine protease EDA2 0.714 0.153 0.670 7e-23
>gi|297735044|emb|CBI17406.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/94 (64%), Positives = 72/94 (76%), Gaps = 1/94 (1%)

Query: 1   ICGEYTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDL 60
           ICGE +CDGIPNDY+ VLAKKFGAAVVSLEH YYGKSSPF+SL TENLKYLSSKQALFDL
Sbjct: 80  ICGEASCDGIPNDYISVLAKKFGAAVVSLEHRYYGKSSPFRSLRTENLKYLSSKQALFDL 139

Query: 61  AIRFIFFLAYVL-LGYNFKFAVKQPSVLIEHFSF 93
           A+   ++ A V+ +G +    V + +V    F F
Sbjct: 140 AVFRQYYQAKVVPIGESLNVKVNRSNVENPWFVF 173

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357483671|ref|XP_003612122.1| Thymus-specific serine protease [Medicago truncatula] gi|355513457|gb|AES95080.1| Thymus-specific serine protease [Medicago truncatula] Back     alignment and taxonomy information
>gi|359476844|ref|XP_003631898.1| PREDICTED: probable serine protease EDA2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224108896|ref|XP_002333330.1| predicted protein [Populus trichocarpa] gi|222836225|gb|EEE74646.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449499944|ref|XP_004160961.1| PREDICTED: probable serine protease EDA2-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449457546|ref|XP_004146509.1| PREDICTED: probable serine protease EDA2-like [Cucumis sativus] gi|449499940|ref|XP_004160960.1| PREDICTED: probable serine protease EDA2-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|388499696|gb|AFK37914.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|226502825|ref|NP_001146300.1| uncharacterized protein LOC100279875 precursor [Zea mays] gi|219886553|gb|ACL53651.1| unknown [Zea mays] Back     alignment and taxonomy information
>gi|413933853|gb|AFW68404.1| putative serine peptidase S28 family protein [Zea mays] Back     alignment and taxonomy information
>gi|357146992|ref|XP_003574183.1| PREDICTED: probable serine protease EDA2-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
TAIR|locus:505006564 488 AT4G36195 [Arabidopsis thalian 0.714 0.153 0.708 8.5e-23
TAIR|locus:2060959 489 EDA2 "embryo sac development a 0.580 0.124 0.803 6.4e-21
TAIR|locus:2122249 482 AT4G36190 [Arabidopsis thalian 0.714 0.155 0.658 2.8e-20
ZFIN|ZDB-GENE-070112-732 488 zgc:158605 "zgc:158605" [Danio 0.790 0.170 0.443 2.8e-09
UNIPROTKB|G4MQ38 529 MGG_02275 "Endoprotease" [Magn 0.552 0.109 0.468 5.2e-09
FB|FBgn0035726 508 CG9953 [Drosophila melanogaste 0.409 0.084 0.651 4.6e-08
DICTYBASE|DDB_G0274663 487 DDB_G0274663 "peptidase S28 fa 0.466 0.100 0.56 7e-08
DICTYBASE|DDB_G0290139 476 DDB_G0290139 "peptidase S28 fa 0.533 0.117 0.464 1.1e-07
WB|WBGene00018984 540 F56F10.1 [Caenorhabditis elega 0.6 0.116 0.449 1.3e-07
DICTYBASE|DDB_G0290409 469 DDB_G0290409 "peptidase S28 fa 0.409 0.091 0.604 1.4e-07
TAIR|locus:505006564 AT4G36195 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 269 (99.8 bits), Expect = 8.5e-23, P = 8.5e-23
 Identities = 56/79 (70%), Positives = 60/79 (75%)

Query:     1 ICGEYTCDGIPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDL 60
             ICGE  C+GIPNDY+ VLAKKF A +VSLEH YYGKSSPFKSL+TENLKYLSSKQALFDL
Sbjct:    87 ICGEGPCNGIPNDYITVLAKKFDAGIVSLEHRYYGKSSPFKSLATENLKYLSSKQALFDL 146

Query:    61 AIRFIFFLAYVLLGYNFKF 79
             A     F  Y     N KF
Sbjct:   147 AA----FRQYYQDSLNVKF 161
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008236 "serine-type peptidase activity" evidence=IEA;ISS
GO:0005773 "vacuole" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
TAIR|locus:2060959 EDA2 "embryo sac development arrest 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122249 AT4G36190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-732 zgc:158605 "zgc:158605" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G4MQ38 MGG_02275 "Endoprotease" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
FB|FBgn0035726 CG9953 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274663 DDB_G0274663 "peptidase S28 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290139 DDB_G0290139 "peptidase S28 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00018984 F56F10.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290409 DDB_G0290409 "peptidase S28 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036824001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (160 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
pfam05577 433 pfam05577, Peptidase_S28, Serine carboxypeptidase 9e-17
>gnl|CDD|218645 pfam05577, Peptidase_S28, Serine carboxypeptidase S28 Back     alignment and domain information 
 Score = 73.6 bits (181), Expect = 9e-17
 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 1/51 (1%)

Query: 18  LAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFL 68
           LAK+FGA V SLEH +YG+S P   LST NL+YLSS QAL D+A  FI  +
Sbjct: 54  LAKEFGALVFSLEHRFYGQSKPIGDLSTANLRYLSSLQALADVA-SFIKAM 103

These serine proteases include several eukaryotic enzymes such as lysosomal Pro-X carboxypeptidase, dipeptidyl-peptidase II, and thymus-specific serine peptidase. Length = 433

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 105
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 100.0
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 100.0
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 99.97
PF05576 448 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 99.41
PLN02298 330 hydrolase, alpha/beta fold family protein 95.23
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 94.49
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 94.42
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 93.9
PHA02857 276 monoglyceride lipase; Provisional 93.64
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 92.58
PRK10749 330 lysophospholipase L2; Provisional 91.97
PLN02824 294 hydrolase, alpha/beta fold family protein 91.77
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 91.71
PRK10566 249 esterase; Provisional 91.64
PRK10673 255 acyl-CoA esterase; Provisional 91.57
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 91.52
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 91.18
PRK00870 302 haloalkane dehalogenase; Provisional 90.53
PLN02385 349 hydrolase; alpha/beta fold family protein 90.11
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 89.25
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 89.07
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 88.72
PLN02652 395 hydrolase; alpha/beta fold family protein 88.68
PF07859 211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 88.45
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 87.9
PLN02965 255 Probable pheophorbidase 87.62
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 87.24
KOG4178 322 consensus Soluble epoxide hydrolase [Lipid transpo 86.66
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 85.09
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 84.79
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 84.56
PRK03592 295 haloalkane dehalogenase; Provisional 83.22
PRK10985 324 putative hydrolase; Provisional 81.45
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 81.05
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 80.24
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information 
Probab=100.00  E-value=3.8e-38  Score=253.36  Aligned_cols=98  Identities=44%  Similarity=0.601  Sum_probs=79.7

Q ss_pred             CcCCCCCCC--CCccHHHHHHHHhCCcEEEeeeeeeeccCCCCCCCccCccCCChHHHHHhHHHHHHHHHHHhhcc---c
Q 046985            1 ICGEYTCDG--IPNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENLKYLSSKQALFDLAIRFIFFLAYVLLG---Y   75 (105)
Q Consensus         1 igGE~~~~~--~~~g~~~~lA~~~~al~v~lEHRyYG~S~P~~~~s~~~L~yLt~~QALaD~a~fi~~~~~~~~~~---~   75 (105)
                      +|||+++++  +.+|++.+||+++||++|++||||||+|.|+++++++||||||++|||+|+|+||++++.+++..   .
T Consensus        35 ~ggE~~~~~~~~~~~~~~~lA~~~~a~~v~lEHRyYG~S~P~~~~s~~nL~yLt~~QALaD~a~F~~~~~~~~~~~~~~p  114 (434)
T PF05577_consen   35 IGGEGPIEPFWINNGFMWELAKEFGALVVALEHRYYGKSQPFGDLSTENLRYLTSEQALADLAYFIRYVKKKYNTAPNSP  114 (434)
T ss_dssp             E--SS-HHHHHHH-HHHHHHHHHHTEEEEEE--TTSTTB-TTGGGGGSTTTC-SHHHHHHHHHHHHHHHHHHTTTGCC--
T ss_pred             ECCCCccchhhhcCChHHHHHHHcCCcEEEeehhhhcCCCCccccchhhHHhcCHHHHHHHHHHHHHHHHHhhcCCCCCC
Confidence            699999976  47789999999999999999999999999999999999999999999999999999999876432   2


Q ss_pred             ccccCCCcchhhhhhhhcccCCCc
Q 046985           76 NFKFAVKQPSVLIEHFSFEFVPCL   99 (105)
Q Consensus        76 ~~~~g~sypg~l~aw~R~kY~~~~   99 (105)
                      .++|||||||+|+||||+|| |++
T Consensus       115 wI~~GgSY~G~Laaw~r~ky-P~~  137 (434)
T PF05577_consen  115 WIVFGGSYGGALAAWFRLKY-PHL  137 (434)
T ss_dssp             EEEEEETHHHHHHHHHHHH--TTT
T ss_pred             EEEECCcchhHHHHHHHhhC-CCe
Confidence            33689999999999999999 554

Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to MEROPS peptidase family S28 (clan SC). The predicted active site residues for members of this family and family S10 occur in the same order in the sequence: S, D, H. These serine proteases include several eukaryotic enzymes such as lysosomal Pro-X carboxypeptidase, dipeptidyl-peptidase II, and thymus-specific serine peptidase [, , , ].; GO: 0008236 serine-type peptidase activity, 0006508 proteolysis; PDB: 3N2Z_B 3JYH_A 3N0T_C.
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
4ebb_A 472 Structure Of Dpp2 Length = 472 2e-04
3jyh_A 469 Human Dipeptidyl Peptidase Dpp7 Length = 469 2e-04
>pdb|4EBB|A Chain A, Structure Of Dpp2 Length = 472 Back     alignment and structure 
Iteration: 1

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 2/50 (4%)
Query: 14  YLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTE--NLKYLSSKQALFDLA 61
           ++  LA + GA +V  EH YYGKS PF + ST+  + + L+ +QAL D A
Sbjct: 64  FVAELAAERGALLVFAEHRYYGKSLPFGAQSTQRGHTELLTVEQALADFA 113
>pdb|3JYH|A Chain A, Human Dipeptidyl Peptidase Dpp7 Length = 469 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
3jyh_A 469 Dipeptidyl-peptidase 2; structural genomics, struc 1e-12
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 2e-12
>3jyh_A Dipeptidyl-peptidase 2; structural genomics, structural genomics consortium, SGC, aminopeptidase, cleavage on PAIR of basic residues; HET: NAG BMA; 2.19A {Homo sapiens} PDB: 3n0t_A* Length = 469 Back     alignment and structure
 Score = 61.5 bits (148), Expect = 1e-12
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 1   ICGEYTCDGIPND--YLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTE--NLKYLSSKQA 56
              E       N+  ++  LA + GA +V  EH YYGKS PF + ST+  + + L+ +QA
Sbjct: 52  TGNEGDVWAFANNSAFVAELAAERGALLVFAEHRYYGKSLPFGAQSTQRGHTELLTVEQA 111

Query: 57  LFDLAIRFIFFL 68
           L D A   +  L
Sbjct: 112 LADFA-ELLRAL 122
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Length = 446 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 100.0
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 99.83
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 96.61
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.35
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 95.93
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 95.81
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 95.61
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 94.87
3llc_A 270 Putative hydrolase; structural genomics, joint cen 94.57
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 94.56
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 94.45
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 94.42
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 94.31
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 94.06
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 94.03
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 93.99
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 93.91
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 93.82
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 93.8
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 93.78
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 93.76
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 93.47
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 93.38
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 93.38
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 93.23
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 93.2
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 93.1
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 93.06
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 92.87
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 92.86
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 92.81
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 92.81
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 92.8
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 92.7
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 92.64
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 92.62
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 92.5
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 92.44
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 92.31
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 92.3
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 92.26
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 92.04
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 91.97
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 91.93
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 91.91
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 91.85
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 91.79
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 91.78
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 91.64
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 91.6
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 91.59
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 91.57
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 91.21
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 91.15
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 90.99
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 90.89
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 90.88
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 90.65
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 90.59
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 90.55
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 90.49
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 90.43
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 90.36
1iup_A 282 META-cleavage product hydrolase; aromatic compound 90.35
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 90.17
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 90.15
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 90.03
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 90.02
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 89.95
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 89.93
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 89.84
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 89.76
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 89.7
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 89.63
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 89.59
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 89.54
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 89.5
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 89.44
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 89.29
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 89.19
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 89.17
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 89.16
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 89.09
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 88.94
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 88.42
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 88.33
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 88.05
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 87.83
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 87.71
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 87.54
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 87.52
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 87.51
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 87.42
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 87.31
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 87.26
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 87.21
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 87.15
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 86.9
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 86.58
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 86.2
3h04_A 275 Uncharacterized protein; protein with unknown func 85.78
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 85.64
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 85.21
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 85.2
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 85.15
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 85.11
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 84.68
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 84.26
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 84.13
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 84.05
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 83.89
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 83.64
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 83.52
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 83.47
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 83.14
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 83.03
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 82.03
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 81.91
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 81.86
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 81.62
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 81.36
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 81.14
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 81.01
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 80.86
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 80.7
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
Probab=100.00  E-value=2.9e-37  Score=251.37  Aligned_cols=98  Identities=28%  Similarity=0.322  Sum_probs=88.0

Q ss_pred             CcCCCCCCCC--CccHHHHHHHHhCCcEEEeeeeeeeccCCCCCCCcc--CccCCChHHHHHhHHHHHHHHHHHhhccc-
Q 046985            1 ICGEYTCDGI--PNDYLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTE--NLKYLSSKQALFDLAIRFIFFLAYVLLGY-   75 (105)
Q Consensus         1 igGE~~~~~~--~~g~~~~lA~~~~al~v~lEHRyYG~S~P~~~~s~~--~L~yLt~~QALaD~a~fi~~~~~~~~~~~-   75 (105)
                      +|||+++.+.  +.|++.+||+++||++|++||||||+|.|+++++++  ||+|||++|||+|+|+||++++.+++.+. 
T Consensus        49 ~gGEg~~~~~~~~~g~~~~lA~~~~a~~v~lEHRyYG~S~P~~~~st~~~nL~yLt~eQALaD~a~fi~~~k~~~~~~~~  128 (472)
T 4ebb_A           49 TGNEGDVWAFANNSAFVAELAAERGALLVFAEHRYYGKSLPFGAQSTQRGHTELLTVEQALADFAELLRALRRDLGAQDA  128 (472)
T ss_dssp             ECCSSCHHHHHHHCHHHHHHHHHHTCEEEEECCTTSTTCCTTGGGGGSTTSCTTCSHHHHHHHHHHHHHHHHHHTTCTTC
T ss_pred             ECCCccccccccCccHHHHHHHHhCCeEEEEecccccCCcCCCCCCccccccccCCHHHHHHHHHHHHHHHHhhcCCCCC
Confidence            5899998763  678999999999999999999999999999988876  89999999999999999999999887542 


Q ss_pred             -ccccCCCcchhhhhhhhcccCCCc
Q 046985           76 -NFKFAVKQPSVLIEHFSFEFVPCL   99 (105)
Q Consensus        76 -~~~~g~sypg~l~aw~R~kY~~~~   99 (105)
                       .+.|||||||+|+||||+|| |+|
T Consensus       129 pwI~~GGSY~G~LaAW~R~kY-P~l  152 (472)
T 4ebb_A          129 PAIAFGGSYGGMLSAYLRMKY-PHL  152 (472)
T ss_dssp             CEEEEEETHHHHHHHHHHHHC-TTT
T ss_pred             CEEEEccCccchhhHHHHhhC-CCe
Confidence             23689999999999999999 554
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 95.37
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 94.42
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 94.37
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 94.22
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 94.1
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 93.97
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 93.6
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 93.55
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 93.28
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 93.25
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 93.22
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 92.83
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 91.88
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 91.23
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 91.17
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 90.86
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 90.51
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 89.78
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 87.97
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 87.85
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 87.03
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 84.64
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 84.23
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 83.89
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 83.32
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 83.16
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 81.4
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 80.98
d2nysa1117 Uncharacterized protein AGR_C_3712p {Agrobacterium 80.24
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 80.17
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Gastric lipase
domain: Gastric lipase
species: Dog (Canis familiaris) [TaxId: 9615]

Probab=95.37  E-value=0.0056  Score=42.41  Aligned_cols=81  Identities=14%  Similarity=-0.066  Sum_probs=55.9

Q ss_pred             HHHHHHHHhCCcEEEeeeeeeeccCCCCCCCccCc---cCCChHHHHHhHHHHHHHHHHHhhcccccccCCCcchhhhhh
Q 046985           14 YLGVLAKKFGAAVVSLEHHYYGKSSPFKSLSTENL---KYLSSKQALFDLAIRFIFFLAYVLLGYNFKFAVKQPSVLIEH   90 (105)
Q Consensus        14 ~~~~lA~~~~al~v~lEHRyYG~S~P~~~~s~~~L---~yLt~~QALaD~a~fi~~~~~~~~~~~~~~~g~sypg~l~aw   90 (105)
                      ++..|+++ |=.|+++.+|-+|.|..-.+......   .+.=.+.+..|++..++.+....+.+....+|-|.+|+++.-
T Consensus        83 la~~L~~~-Gy~V~~~D~rG~G~S~~~~~~~~~~~~~~~~~~~~~~~~Dl~~~i~~i~~~~g~~~v~lvGhS~GG~ia~~  161 (377)
T d1k8qa_          83 LAFILADA-GYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFILKKTGQDKLHYVGHSQGTTIGFI  161 (377)
T ss_dssp             HHHHHHHT-TCEEEECCCTTSTTSCEESSSCTTSTTTTCCCHHHHHHTHHHHHHHHHHHHHCCSCEEEEEETHHHHHHHH
T ss_pred             HHHHHHHC-CCEEEEEcCCCCCCCCCCCCCCCcchhhccCCHHHHhhhhHHHHHHHHHHHcCCCCEEEEEecchHHHHHH
Confidence            45566655 88999999999999964332222222   222235678999999999988777654444699999998755


Q ss_pred             hhccc
Q 046985           91 FSFEF   95 (105)
Q Consensus        91 ~R~kY   95 (105)
                      +=..|
T Consensus       162 ~a~~~  166 (377)
T d1k8qa_         162 AFSTN  166 (377)
T ss_dssp             HHHHC
T ss_pred             HHHhh
Confidence            44455
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2nysa1 b.136.1.2 (A:3-119) Uncharacterized protein AGR_C_3712p {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure