Citrus Sinensis ID: 047006

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MDSKAERAKEPVANFLEFVEETDPVRRICAGCAHAEAVQNGDYKSTSGARFSLFGCSLPLTETDWGEVAGLNANSMSSKTSETHPWHLHPHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGCVHRK
ccHHHHHccccccccccccccccccEEcccccEEEEEEccccccccccccEEEcccccEEEEccccccccccccccccccccccccEEccccEEEEEEEccccEEEEEccccHHHHHHccEEEEEEcccccccccccccccccccc
cccHHHHcccccccccccccccHHHHHHHHHcccccccEccccccccccccccccccccccccEEEEEEEEccccccccccccEEEEEcccEEEEEEEEccccEEEEEEEccHHHHHcccEEEEEEcHHHcccccHHHcccccccc
mdskaerakepvanflefveetdpvrricagcahaeavqngdykstsgarfslfgcslpltetdwgevaglnansmssktsethpwhlhphgwtelrfradnpgawtfhchieshFYVGMGVVFAEGIerlgalpssifegcvhrk
mdskaerakepvanflefveetdPVRRICAGCAHAEAVQNGDYKSTSGARFSLFGCSLPLTETDWGEVAGLNANSMSSKTSETHPWHLHPHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLgalpssifegcvhrk
MDSKAERAKEPVANFLEFVEETDPVRRICAGCAHAEAVQNGDYKSTSGARFSLFGCSLPLTETDWGEVAGLNANSMSSKTSETHPWHLHPHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGCVHRK
************ANFLEFVEETDPVRRICAGCAHAEAVQNGDYKSTSGARFSLFGCSLPLTETDWGEVAGLN***********HPWHLHPHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGCV***
************ANFLEFVEETDPVRRICAGCAHAEAVQNGDYKSTSGARFSLFGCSLPLTETDWGEVAGLNANSMSSKTSETHPWHLHPHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGCV***
*********EPVANFLEFVEETDPVRRICAGCAHAEAVQNGDYKSTSGARFSLFGCSLPLTETDWGEVAGLNAN************HLHPHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGCVHRK
***********VANFLEFVEETDPVRRICAGCAHAEAVQNGDYKSTSGARFSLFGCSLPLTETDWGEVAGLNANSMSSKTSETHPWHLHPHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGC****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSKAERAKEPVANFLEFVEETDPVRRICAGCAHAEAVQNGDYKSTSGARFSLFGCSLPLTETDWGEVAGLNANSMSSKTSETHPWHLHPHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGCVHRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
P37064552 L-ascorbate oxidase OS=Cu N/A no 0.486 0.128 0.427 8e-20
P24792579 L-ascorbate oxidase OS=Cu N/A no 0.445 0.112 0.425 2e-19
P14133587 L-ascorbate oxidase OS=Cu N/A no 0.438 0.109 0.405 9e-18
Q40588578 L-ascorbate oxidase OS=Ni N/A no 0.438 0.110 0.39 1e-16
Q9LYQ2569 Laccase-13 OS=Arabidopsis no no 0.239 0.061 0.571 5e-08
P43561622 Iron transport multicoppe yes no 0.273 0.064 0.55 7e-08
Q56YT0570 Laccase-3 OS=Arabidopsis no no 0.239 0.061 0.6 9e-08
Q5N7A3580 Laccase-6 OS=Oryza sativa no no 0.226 0.056 0.606 9e-08
Q5N7B4559 Laccase-7 OS=Oryza sativa no no 0.486 0.127 0.373 1e-07
Q96WT3 635 Iron transport multicoppe no no 0.273 0.062 0.55 1e-07
>sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 Back     alignment and function desciption
 Score = 95.9 bits (237), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 57/110 (51%), Gaps = 39/110 (35%)

Query: 66  GEVAGL---NANSMSSKTSETHPWHLH--------------------------------- 89
           GEV  +   NAN M    SETHPWHLH                                 
Sbjct: 424 GEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYGDGKFSAEEESSLNLKNPPLRNTV 483

Query: 90  ---PHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPS 136
              P+GWT +RF ADNPG W FHCHIE H ++GMGVVFAEG+E++G +P+
Sbjct: 484 VIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVEKVGRIPT 533
May be involved in a redox system involving ascorbic acid.
Cucurbita pepo var. melopepo (taxid: 3665)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 3
>sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 Back     alignment and function description
>sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 Back     alignment and function description
>sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 Back     alignment and function description
>sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 Back     alignment and function description
>sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 Back     alignment and function description
>sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 Back     alignment and function description
>sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 Back     alignment and function description
>sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
296082455 595 unnamed protein product [Vitis vinifera] 0.479 0.117 0.509 6e-24
359480826 570 PREDICTED: L-ascorbate oxidase [Vitis vi 0.479 0.122 0.509 1e-23
359480832 730 PREDICTED: L-ascorbate oxidase-like [Vit 0.479 0.095 0.5 3e-23
225438645 567 PREDICTED: L-ascorbate oxidase [Vitis vi 0.479 0.123 0.5 3e-23
224093788 542 predicted protein [Populus trichocarpa] 0.506 0.136 0.5 4e-23
296082450 567 unnamed protein product [Vitis vinifera] 0.479 0.123 0.5 4e-23
147853298 551 hypothetical protein VITISV_007617 [Viti 0.479 0.127 0.5 5e-23
357519559 577 L-ascorbate oxidase [Medicago truncatula 0.479 0.121 0.509 5e-23
359480821 553 PREDICTED: L-ascorbate oxidase [Vitis vi 0.479 0.126 0.5 5e-23
356511231 577 PREDICTED: L-ascorbate oxidase [Glycine 0.479 0.121 0.509 6e-23
>gi|296082455|emb|CBI21460.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 55/108 (50%), Positives = 62/108 (57%), Gaps = 38/108 (35%)

Query: 72  NANSMSSKTSETHPWHLH-------------------------------------PHGWT 94
           NAN+M  K SETHPWHLH                                     P+GWT
Sbjct: 451 NANTMVVKNSETHPWHLHGHDFWVLGYGEGTFNMSSDPRTYNLINPIMKNTAPVHPYGWT 510

Query: 95  ELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGC 142
            LRFR++NPGAW FHCHIESHFY+GMGVVF EG+ER+G LPSSI  GC
Sbjct: 511 ALRFRSNNPGAWAFHCHIESHFYMGMGVVFEEGVERVGKLPSSIM-GC 557

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359480826|ref|XP_002272946.2| PREDICTED: L-ascorbate oxidase [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480832|ref|XP_002281314.2| PREDICTED: L-ascorbate oxidase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225438645|ref|XP_002281435.1| PREDICTED: L-ascorbate oxidase [Vitis vinifera] gi|296082452|emb|CBI21457.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224093788|ref|XP_002309992.1| predicted protein [Populus trichocarpa] gi|222852895|gb|EEE90442.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296082450|emb|CBI21455.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147853298|emb|CAN78541.1| hypothetical protein VITISV_007617 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357519559|ref|XP_003630068.1| L-ascorbate oxidase [Medicago truncatula] gi|355524090|gb|AET04544.1| L-ascorbate oxidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|359480821|ref|XP_002281497.2| PREDICTED: L-ascorbate oxidase [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511231|ref|XP_003524331.1| PREDICTED: L-ascorbate oxidase [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
TAIR|locus:2135242582 AT4G39830 [Arabidopsis thalian 0.397 0.099 0.644 4.7e-25
TAIR|locus:505006625588 AT5G21105 [Arabidopsis thalian 0.369 0.091 0.6 9.1e-21
TAIR|locus:2178973573 AT5G21100 [Arabidopsis thalian 0.369 0.094 0.561 4.4e-19
TAIR|locus:2182895569 LAC13 "laccase 13" [Arabidopsi 0.239 0.061 0.571 1.4e-13
TAIR|locus:2060879570 LAC3 "laccase 3" [Arabidopsis 0.239 0.061 0.6 1.2e-12
TAIR|locus:2153469565 LAC12 "laccase 12" [Arabidopsi 0.301 0.077 0.413 3e-10
ASPGD|ASPL0000072567 673 AN8581 [Emericella nidulans (t 0.260 0.056 0.473 7.4e-10
TAIR|locus:2063109580 LAC5 "laccase 5" [Arabidopsis 0.232 0.058 0.470 8.2e-10
TAIR|locus:2184802569 LAC14 "laccase 14" [Arabidopsi 0.232 0.059 0.588 2e-09
TAIR|locus:2083604567 LAC7 "laccase 7" [Arabidopsis 0.226 0.058 0.575 2.3e-09
TAIR|locus:2135242 AT4G39830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 226 (84.6 bits), Expect = 4.7e-25, Sum P(2) = 4.7e-25
 Identities = 38/59 (64%), Positives = 47/59 (79%)

Query:    88 LHPHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGCVHRK 146
             + P GWT LRFRADNPG W+FHCHIESHF++GMG+VF  GI+++ +LPSSI  GC   K
Sbjct:   524 VQPFGWTALRFRADNPGVWSFHCHIESHFFMGMGIVFESGIDKVSSLPSSIM-GCGQTK 581
GO:0005507 "copper ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM;IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0046520 "sphingoid biosynthetic process" evidence=RCA
TAIR|locus:505006625 AT5G21105 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178973 AT5G21100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182895 LAC13 "laccase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060879 LAC3 "laccase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153469 LAC12 "laccase 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000072567 AN8581 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2063109 LAC5 "laccase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184802 LAC14 "laccase 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083604 LAC7 "laccase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
PLN02604566 PLN02604, PLN02604, oxidoreductase 2e-36
TIGR03388541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 1e-33
PLN02191574 PLN02191, PLN02191, L-ascorbate oxidase 3e-22
pfam07731135 pfam07731, Cu-oxidase_2, Multicopper oxidase 4e-14
TIGR03389539 TIGR03389, laccase, laccase, plant 2e-10
TIGR03390538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 3e-08
COG2132451 COG2132, SufI, Putative multicopper oxidases [Seco 4e-07
TIGR01480587 TIGR01480, copper_res_A, copper-resistance protein 2e-05
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information 
 Score =  130 bits (329), Expect = 2e-36
 Identities = 55/108 (50%), Positives = 62/108 (57%), Gaps = 38/108 (35%)

Query: 72  NANSMSSKTSETHPWHLH-------------------------------------PHGWT 94
           NAN+M++  SETHPWHLH                                     P+GWT
Sbjct: 455 NANTMNANNSETHPWHLHGHDFWVLGYGEGKFNMSSDPKKYNLVDPIMKNTVPVHPYGWT 514

Query: 95  ELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSSIFEGC 142
            LRFRADNPG W FHCHIESHF++GMGVVF EGIER+G LPSSI  GC
Sbjct: 515 ALRFRADNPGVWAFHCHIESHFFMGMGVVFEEGIERVGKLPSSIM-GC 561

Length = 566
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information
>gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase Back     alignment and domain information
>gnl|CDD|219541 pfam07731, Cu-oxidase_2, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
PLN02191574 L-ascorbate oxidase 99.94
PLN02604566 oxidoreductase 99.93
TIGR03388541 ascorbase L-ascorbate oxidase, plant type. Members 99.93
PLN02792536 oxidoreductase 99.92
PLN02835539 oxidoreductase 99.92
TIGR03389539 laccase laccase, plant. Members of this protein fa 99.92
PLN02354552 copper ion binding / oxidoreductase 99.92
PLN02991543 oxidoreductase 99.91
PLN02168545 copper ion binding / pectinesterase 99.91
PLN00044596 multi-copper oxidase-related protein; Provisional 99.91
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 99.89
KOG1263563 consensus Multicopper oxidases [Secondary metaboli 99.88
TIGR03390538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 99.85
TIGR01480587 copper_res_A copper-resistance protein, CopA famil 99.63
COG2132451 SufI Putative multicopper oxidases [Secondary meta 99.49
PRK10965523 multicopper oxidase; Provisional 99.43
PRK10883471 FtsI repressor; Provisional 99.4
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 99.26
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 99.1
PLN02604 566 oxidoreductase 99.07
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 98.76
PLN02191 574 L-ascorbate oxidase 98.51
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 98.44
TIGR01480 587 copper_res_A copper-resistance protein, CopA famil 98.35
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 98.27
TIGR03389 539 laccase laccase, plant. Members of this protein fa 98.24
PLN02835 539 oxidoreductase 98.22
PLN02168 545 copper ion binding / pectinesterase 98.2
PLN00044 596 multi-copper oxidase-related protein; Provisional 98.15
PLN02354 552 copper ion binding / oxidoreductase 98.12
PLN02792 536 oxidoreductase 98.08
PLN02991 543 oxidoreductase 97.91
PRK10965 523 multicopper oxidase; Provisional 97.89
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 97.88
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 97.87
PRK10883 471 FtsI repressor; Provisional 97.74
KOG1263 563 consensus Multicopper oxidases [Secondary metaboli 97.7
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 97.69
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 97.39
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 97.21
PRK02888635 nitrous-oxide reductase; Validated 97.08
COG4454158 Uncharacterized copper-binding protein [Inorganic 96.96
PRK02710119 plastocyanin; Provisional 96.96
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 96.96
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 96.46
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 96.13
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.13
TIGR0265783 amicyanin amicyanin. Members of this family are am 96.04
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 95.52
COG3794128 PetE Plastocyanin [Energy production and conversio 95.16
COG2132 451 SufI Putative multicopper oxidases [Secondary meta 94.17
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 93.78
TIGR02866201 CoxB cytochrome c oxidase, subunit II. Cytochrome 92.81
MTH00140228 COX2 cytochrome c oxidase subunit II; Provisional 90.42
COG1622247 CyoA Heme/copper-type cytochrome/quinol oxidases, 85.33
TIGR01433226 CyoA cytochrome o ubiquinol oxidase subunit II. Th 83.88
MTH00008228 COX2 cytochrome c oxidase subunit II; Validated 83.18
TIGR01432217 QOXA cytochrome aa3 quinol oxidase, subunit II. Th 83.17
MTH00038229 COX2 cytochrome c oxidase subunit II; Provisional 82.87
MTH00023240 COX2 cytochrome c oxidase subunit II; Validated 82.07
MTH00168225 COX2 cytochrome c oxidase subunit II; Provisional 81.2
MTH00047194 COX2 cytochrome c oxidase subunit II; Provisional 80.2
>PLN02191 L-ascorbate oxidase Back     alignment and domain information 
Probab=99.94  E-value=6.4e-27  Score=207.76  Aligned_cols=128  Identities=41%  Similarity=0.773  Sum_probs=97.6

Q ss_pred             CCCCceeecCCCchh-ccccccc---hhh----hh---hc--CCC---cCCCCceEEEcccccCCCCeeeEEEEEEeCCC
Q 047006           12 VANFLEFVEETDPVR-RICAGCA---HAE----AV---QN--GDY---KSTSGARFSLFGCSLPLTETDWGEVAGLNANS   75 (146)
Q Consensus        12 ~~n~~~f~~pt~p~l-~i~s~~~---~~~----~~---~~--~~~---~~~~~~~~~ing~~l~~g~~~~Veivl~N~~~   75 (146)
                      .+|+++|.+|++|+| +++++..   ...    .+   ++  +..   .+..+++++    .++.|+.  |||+|+|...
T Consensus       385 ~~n~~s~~~p~~P~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~----~~~~~~~--Vdivi~n~~~  458 (574)
T PLN02191        385 AINNVSLVTPATPYLGSVKYNLKLGFNRKSPPRSYRMDYDIMNPPPFPNTTTGNGIY----VFPFNVT--VDVIIQNANV  458 (574)
T ss_pred             EECcccCcCCCcchHHHHhhccCcccccCCCcccccccccccCCCccccccccceeE----EecCCCE--EEEEEECCCc
Confidence            489999999999998 6654211   110    00   00  000   122456777    8899977  9999999752


Q ss_pred             CCCCCCCCCcceec-------------------------------------CCCceEEEEEeCCCeeEEEEecCcccccc
Q 047006           76 MSSKTSETHPWHLH-------------------------------------PHGWTELRFRADNPGAWTFHCHIESHFYV  118 (146)
Q Consensus        76 ~~~~~~~~HP~HlH-------------------------------------~~~~~~irf~adnpG~W~lHCHi~~H~~~  118 (146)
                      ..+.....||||||                                     ++||++|||+|||||.|+|||||+||+.+
T Consensus       459 ~~~~~~~~HP~HLHGh~F~Vlg~G~g~~~~~~~~~~~nl~nP~rRDTv~vp~~Gw~vIRf~aDNPG~Wl~HCHi~~Hl~~  538 (574)
T PLN02191        459 LKGVVSEIHPWHLHGHDFWVLGYGDGKFKPGIDEKTYNLKNPPLRNTAILYPYGWTAIRFVTDNPGVWFFHCHIEPHLHM  538 (574)
T ss_pred             ccCCCCCCCCEEeCCCCeEEEEecCCCCCcccCcccccCCCCCcCCeEEeCCCCEEEEEEECCCCEEEEEecCchhhhhc
Confidence            11112358999999                                     68999999999999999999999999999


Q ss_pred             CceEEEeccccccCCCCcccccCCCCCC
Q 047006          119 GMGVVFAEGIERLGALPSSIFEGCVHRK  146 (146)
Q Consensus       119 GM~~~~~~~~~~~~~~p~~~~~~C~~~~  146 (146)
                      ||+++|.+++++++++|++++ .|+.|+
T Consensus       539 Gm~~~~~e~~~~~~~~p~~~~-~C~~~~  565 (574)
T PLN02191        539 GMGVVFAEGLNRIGKIPDEAL-GCGLTK  565 (574)
T ss_pred             CCEEEEecChhhccCCCcchh-hhhccc
Confidence            999999999999999999987 898764

>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02866 CoxB cytochrome c oxidase, subunit II Back     alignment and domain information
>MTH00140 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion] Back     alignment and domain information
>TIGR01433 CyoA cytochrome o ubiquinol oxidase subunit II Back     alignment and domain information
>MTH00008 COX2 cytochrome c oxidase subunit II; Validated Back     alignment and domain information
>TIGR01432 QOXA cytochrome aa3 quinol oxidase, subunit II Back     alignment and domain information
>MTH00038 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00023 COX2 cytochrome c oxidase subunit II; Validated Back     alignment and domain information
>MTH00168 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00047 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1aoz_A552 Refined Crystal Structure Of Ascorbate Oxidase At 1 7e-21
1kya_A499 Active Laccase From Trametes Versicolor Complexed W 2e-07
1hfu_A503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 2e-07
1a65_A504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 2e-07
2q9o_A559 Near-Atomic Resolution Structure Of A Melanocarpus 3e-07
3dkh_A559 L559a Mutant Of Melanocarpus Albomyces Laccase Leng 3e-07
1gw0_A559 Crystal Structure Of Laccase From Melanocarpus Albo 3e-07
1v10_A521 Structure Of Rigidoporus Lignosus Laccase From Hemi 4e-07
2hrg_A496 Crystal Structure Of Blue Laccase From Trametes Tro 5e-07
3pps_A604 Crystal Structure Of An Ascomycete Fungal Laccase F 6e-07
4a2f_A497 Coriolopsis Gallica Laccase Collected At 12.65 Kev 7e-07
4a2d_A496 Coriolopsis Gallica Laccase T2 Copper Depleted At P 7e-07
3kw7_A502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 1e-06
1gyc_A499 Crystal Structure Determination At Room Temperature 2e-06
2hzh_A499 Crystal Structure Of Laccase From Coriolus Zonatus 4e-06
2qt6_A498 Crystal Structure Determination Of A Blue Laccase F 5e-06
3t6v_A495 Crystal Structure Of Laccase From Steccherinum Ochr 6e-06
1zpu_A534 Crystal Structure Of Fet3p, A Multicopper Oxidase T 2e-05
2xyb_A497 Crystal Structure Of A Fully Functional Laccase Fro 4e-05
3v9e_A580 Structure Of The L513m Mutant Of The Laccase From B 9e-05
3pxl_A499 Type-2 Cu-Depleted Fungus Laccase From Trametes Hir 1e-04
3fpx_A499 Native Fungus Laccase From Trametes Hirsuta Length 1e-04
3sqr_A580 Crystal Structure Of Laccase From Botrytis Aclada A 2e-04
3div_A499 Crystal Structure Of Laccase From Cerrena Maxima At 3e-04
2h5u_A499 Crystal Structure Of Laccase From Cerrena Maxima At 3e-04
>pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 Back     alignment and structure 
Iteration: 1

 Score = 95.9 bits (237), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 57/110 (51%), Gaps = 39/110 (35%)
Query: 66  GEVAGL---NANSMSSKTSETHPWHLH--------------------------------- 89
           GEV  +   NAN M    SETHPWHLH                                 
Sbjct: 424 GEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYGDGKFSAEEESSLNLKNPPLRNTV 483
Query: 90  ---PHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPS 136
              P+GWT +RF ADNPG W FHCHIE H ++GMGVVFAEG+E++G +P+
Sbjct: 484 VIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVEKVGRIPT 533
>pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 Back     alignment and structure
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure
>pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 Back     alignment and structure
>pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 Back     alignment and structure
>pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure
>pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 Back     alignment and structure
>pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 Back     alignment and structure
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure
>pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 Back     alignment and structure
>pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 Back     alignment and structure
>pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 5e-24
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 5e-21
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 9e-21
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 8e-20
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 1e-19
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 2e-19
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 3e-19
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 3e-19
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 5e-10
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 4e-09
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 2e-08
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 6e-08
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 5e-08
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 2e-07
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-06
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 6e-08
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 3e-07
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 8e-07
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 7e-06
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 1e-05
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 2e-05
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 2e-05
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 6e-05
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 2e-04
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 2e-04
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 2e-04
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 4e-04
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 4e-04
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 7e-04
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 7e-04
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 7e-04
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
 Score = 95.5 bits (238), Expect = 5e-24
 Identities = 44/102 (43%), Positives = 53/102 (51%), Gaps = 36/102 (35%)

Query: 72  NANSMSSKTSETHPWHLH------------------------------------PHGWTE 95
           NAN M    SETHPWHLH                                    P+GWT 
Sbjct: 433 NANMMKENLSETHPWHLHGHDFWVLGYGDGKFSAEEESSLNLKNPPLRNTVVIFPYGWTA 492

Query: 96  LRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPSS 137
           +RF ADNPG W FHCHIE H ++GMGVVFAEG+E++G +P+ 
Sbjct: 493 IRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVEKVGRIPTK 534
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Length = 140 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 99.93
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 99.93
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 99.93
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 99.91
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 99.91
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 99.91
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 99.91
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 99.86
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 99.78
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 99.76
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 99.75
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 99.68
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 99.68
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 99.66
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 99.64
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.63
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 99.63
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 99.62
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 99.6
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 99.59
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 99.58
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.58
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.57
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 99.56
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.52
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 99.52
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.47
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.47
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 99.45
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 99.4
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.38
3gdc_A 288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.24
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 99.23
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.07
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.05
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.05
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 99.04
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 99.02
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 99.02
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 98.97
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 98.93
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 98.93
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 98.89
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.87
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 98.85
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 98.83
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 98.75
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 98.75
3kw8_A 276 Laccase, putative copper oxidase; two-domain lacca 98.73
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 98.71
3tas_A 313 Small laccase, multi-copper oxidase; two-domain la 98.69
3t9w_A 299 Small laccase, multi-copper oxidase; two-domain co 98.68
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 98.68
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.68
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 98.68
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 98.66
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.61
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 98.58
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 98.57
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 98.57
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.55
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 98.54
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 98.53
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.52
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 98.5
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 98.5
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.5
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 98.48
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 98.47
2cal_A154 Rusticyanin; iron respiratory electron transport c 98.47
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 98.43
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 98.41
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 98.41
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.38
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 98.38
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.35
1sdd_A 306 Coagulation factor V; copper-binding protein, cofa 98.35
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 98.27
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.17
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 98.13
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.12
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.02
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 97.97
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 97.9
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 97.88
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 97.77
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 97.73
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 97.69
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 97.66
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 97.59
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.31
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 97.26
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.21
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.17
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 97.09
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.08
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.79
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 96.67
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 96.66
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 96.62
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 96.53
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 95.97
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 95.78
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 95.75
1v54_B227 Cytochrome C oxidase polypeptide II; oxidoreductas 92.42
1cyx_A205 CYOA; electron transport; 2.30A {Escherichia coli} 91.05
3hb3_B298 Cytochrome C oxidase subunit 2; electron transfer, 88.01
2gsm_B262 Cytochrome C oxidase subunit 2; transmembrane prot 87.26
1fft_B315 Ubiquinol oxidase; electron transport, cytochrome 82.46
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
Probab=99.93  E-value=2.9e-27  Score=206.72  Aligned_cols=127  Identities=40%  Similarity=0.738  Sum_probs=96.6

Q ss_pred             CCCCceeecCCCchh-ccccccc---hhhh----h---hc-----CCCcCCCCceEEEcccccCCCCeeeEEEEEEeCCC
Q 047006           12 VANFLEFVEETDPVR-RICAGCA---HAEA----V---QN-----GDYKSTSGARFSLFGCSLPLTETDWGEVAGLNANS   75 (146)
Q Consensus        12 ~~n~~~f~~pt~p~l-~i~s~~~---~~~~----~---~~-----~~~~~~~~~~~~ing~~l~~g~~~~Veivl~N~~~   75 (146)
                      .||+++|..|++|+| ++..+..   ..+.    +   ++     ....+..++.++    .++.|++  |+|+|+|.+.
T Consensus       363 ~iNg~s~~~p~~P~L~~~~~~~~g~~~~~~p~~~~~~~~~~~~~~~~~~~~~~t~~~----~~~~g~~--v~ivi~N~~~  436 (552)
T 1aoz_A          363 AINDVSLALPPTPYLGAMKYNLLHAFDQNPPPEVFPEDYDIDTPPTNEKTRIGNGVY----QFKIGEV--VDVILQNANM  436 (552)
T ss_dssp             EETTEEECCCSSCHHHHHHTTCTTSSCCSCCCSCCCTTCCTTSCCCCTTCEEECCCE----EECTTCE--EEEEEEECCC
T ss_pred             EECCCccCCCCCCHHHHHhhcCccccccCCCccccccccccccccccccccccceEE----EecCCCE--EEEEEeCCcc
Confidence            479999999999998 5433211   1000    0   00     000112345666    8899988  9999999875


Q ss_pred             CCCCCCCCCcceec------------------------------------CCCceEEEEEeCCCeeEEEEecCccccccC
Q 047006           76 MSSKTSETHPWHLH------------------------------------PHGWTELRFRADNPGAWTFHCHIESHFYVG  119 (146)
Q Consensus        76 ~~~~~~~~HP~HlH------------------------------------~~~~~~irf~adnpG~W~lHCHi~~H~~~G  119 (146)
                      +.+...+.||||||                                    +++|++|||+|||||.|+|||||++|+++|
T Consensus       437 ~~~~~~~~HP~HLHGh~F~Vl~~g~G~~~~~~~~~~n~~~p~~RDTv~vpp~g~v~Irf~aDNPG~W~~HCHi~~H~~~G  516 (552)
T 1aoz_A          437 MKENLSETHPWHLHGHDFWVLGYGDGKFSAEEESSLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMG  516 (552)
T ss_dssp             SSTTCCCCEEEEETTCCEEEEEEEESSCCGGGGGGSCCSSCCEESEEEECTTEEEEEEEECCSCEEEEEEESSHHHHHTT
T ss_pred             cccccCCCCCEEEcCCceEEEecccCccCcccccccccCCCCccCeEEeCCCceEEEEEEcCCCeEEEEEeeehhHhhCC
Confidence            42222458999999                                    478899999999999999999999999999


Q ss_pred             ceEEEeccccccCCCCcccccCCCCC
Q 047006          120 MGVVFAEGIERLGALPSSIFEGCVHR  145 (146)
Q Consensus       120 M~~~~~~~~~~~~~~p~~~~~~C~~~  145 (146)
                      |+++|.+++++++++|++++ .|+.+
T Consensus       517 M~~~~~~~~~~~~~~P~~~~-~C~~~  541 (552)
T 1aoz_A          517 MGVVFAEGVEKVGRIPTKAL-ACGGT  541 (552)
T ss_dssp             CEEEEEECGGGCCCCCHHHH-SSHHH
T ss_pred             CeEEEEeCchhhccCCcchh-hhhcc
Confidence            99999999889999999998 99864
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>1v54_B Cytochrome C oxidase polypeptide II; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: b.6.1.2 f.17.2.1 PDB: 1oco_B* 1occ_B* 1ocz_B* 1ocr_B* 1v55_B* 2dyr_B* 2dys_B* 2eij_B* 2eik_B* 2eil_B* 2eim_B* 2ein_B* 2occ_B* 2y69_B* 2ybb_M* 2zxw_B* 3abk_B* 3abl_B* 3abm_B* 3ag1_B* ... Back     alignment and structure
>1cyx_A CYOA; electron transport; 2.30A {Escherichia coli} SCOP: b.6.1.2 PDB: 1cyw_A Back     alignment and structure
>3hb3_B Cytochrome C oxidase subunit 2; electron transfer, proton transfer, proton pumping, membrane protein, cell inner membrane, cell membrane, copper; HET: HEA LDA LMT; 2.25A {Paracoccus denitrificans} PDB: 1ar1_B* 3ehb_B* 1qle_B* Back     alignment and structure
>2gsm_B Cytochrome C oxidase subunit 2; transmembrane protein complex, oxidoreductase; HET: DMU HEA TRD; 2.00A {Rhodobacter sphaeroides} SCOP: b.6.1.2 f.17.2.1 PDB: 3dtu_B* 3fye_B* 3fyi_B* 3omi_B* 3om3_B* 3oma_B* 3omn_B* 1m56_B* 1m57_B* Back     alignment and structure
>1fft_B Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: b.6.1.2 f.17.2.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1aoza3214 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (C 2e-17
d2q9oa3216 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyce 3e-15
d1gyca3199 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, 6e-14
d1hfua3200 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Copr 5e-13
d1v10a3190 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus 4e-11
d1gska3154 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Ba 3e-09
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 2e-08
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 9e-08
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 3e-07
d1kcwa2146 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap 1e-06
d1kv7a3181 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Esc 1e-06
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 2e-06
d1qhqa_139 b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus 2e-05
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 0.002
d2bw4a2173 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcali 0.002
d2q9oa1162 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces 0.002
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 214 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]

 Score = 73.4 bits (179), Expect = 2e-17
 Identities = 45/117 (38%), Positives = 56/117 (47%), Gaps = 36/117 (30%)

Query: 56  CSLPLTETDWGEVAGLNANSMSSKTSETHPWHLH-------------------------- 89
                   +  +V   NAN M    SETHPWHLH                          
Sbjct: 79  GVYQFKIGEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYGDGKFSAEEESSLNLKN 138

Query: 90  ----------PHGWTELRFRADNPGAWTFHCHIESHFYVGMGVVFAEGIERLGALPS 136
                     P+GWT +RF ADNPG W FHCHIE H ++GMGVVFAEG+E++G +P+
Sbjct: 139 PPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVEKVGRIPT 195
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 216 Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 199 Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 200 Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 190 Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 154 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 181 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Length = 139 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.96
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.94
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.94
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.93
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.9
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.82
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.81
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.76
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 99.67
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.64
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.55
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.5
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 99.47
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.46
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.46
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.42
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.38
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.34
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 99.27
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.17
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.16
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.11
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 99.1
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 99.1
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.02
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 98.93
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 98.68
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.47
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 98.41
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 98.36
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.05
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 97.92
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 97.89
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.79
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 97.7
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 97.68
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 97.63
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 97.6
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.55
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 97.52
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 97.49
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.48
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 97.48
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 97.47
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 97.38
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.33
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 97.23
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 97.21
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.01
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 97.01
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 96.78
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 96.33
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 95.38
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 94.5
d1cyxa_158 Quinol oxidase (CyoA) {Escherichia coli [TaxId: 56 94.08
d1v54b1137 Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 991 93.59
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 93.26
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 91.65
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 91.23
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 90.1
d3ehbb1145 Cytochrome c oxidase {Paracoccus denitrificans [Ta 89.97
d3dtub1152 Cytochrome c oxidase {Rhodobacter sphaeroides [Tax 88.63
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]

Probab=99.96  E-value=7e-30  Score=199.37  Aligned_cols=127  Identities=42%  Similarity=0.736  Sum_probs=99.1

Q ss_pred             CCCCceeecCCCchh-cccccc---chh---hhhhcCC---------CcCCCCceEEEcccccCCCCeeeEEEEEEeCCC
Q 047006           12 VANFLEFVEETDPVR-RICAGC---AHA---EAVQNGD---------YKSTSGARFSLFGCSLPLTETDWGEVAGLNANS   75 (146)
Q Consensus        12 ~~n~~~f~~pt~p~l-~i~s~~---~~~---~~~~~~~---------~~~~~~~~~~ing~~l~~g~~~~Veivl~N~~~   75 (146)
                      .+||++|+.|++|+| ++....   ...   ..++..+         ..+..+++++    .++.|++  |||+|+|.+.
T Consensus        25 ~iNniSf~~P~~P~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~v~----~~~~g~~--veivl~n~~~   98 (214)
T d1aoza3          25 AINDVSLALPPTPYLGAMKYNLLHAFDQNPPPEVFPEDYDIDTPPTNEKTRIGNGVY----QFKIGEV--VDVILQNANM   98 (214)
T ss_dssp             EETTEEECCCSSCHHHHHHTTCTTSSCCSCCCSCCCTTCCTTSCCCCTTCEEECCCE----EECTTCE--EEEEEEECCC
T ss_pred             EECCEeccCCCcchHHHHhhccccccccCCCcccccccccccCCCCCcccccCceeE----EecCCCE--EEEEEecccc
Confidence            589999999999998 432211   000   0011111         1122356677    8999999  9999999876


Q ss_pred             CCCCCCCCCcceec------------------------------------CCCceEEEEEeCCCeeEEEEecCccccccC
Q 047006           76 MSSKTSETHPWHLH------------------------------------PHGWTELRFRADNPGAWTFHCHIESHFYVG  119 (146)
Q Consensus        76 ~~~~~~~~HP~HlH------------------------------------~~~~~~irf~adnpG~W~lHCHi~~H~~~G  119 (146)
                      +.+.....||||||                                    +++|++|||+|||||.|+||||+++|++.|
T Consensus        99 ~~~~~~~~HP~HlHG~~F~vl~~~~g~~~~~~~~~~n~~~p~~rDTv~v~~g~~~~ir~~adnpG~w~~HCH~~~H~~~G  178 (214)
T d1aoza3          99 MKENLSETHPWHLHGHDFWVLGYGDGKFSAEEESSLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMG  178 (214)
T ss_dssp             SSTTCCCCEEEEETTCCEEEEEEEESSCCGGGGGGSCCSSCCEESEEEECTTEEEEEEEECCSCEEEEEEESSHHHHHTT
T ss_pred             ccCCCCCCcceEeecceeEEeccCCCcccccccccccccCCceecCcccCCCceEEEEEecCCCeeEEEEECcHHHHhCc
Confidence            53334568999999                                    789999999999999999999999999999


Q ss_pred             ceEEEeccccccCCCCcccccCCCCC
Q 047006          120 MGVVFAEGIERLGALPSSIFEGCVHR  145 (146)
Q Consensus       120 M~~~~~~~~~~~~~~p~~~~~~C~~~  145 (146)
                      |+++|.+.+++++++|.+++ .|+.+
T Consensus       179 M~~~~~v~~~~~~~~P~~~~-~cg~~  203 (214)
T d1aoza3         179 MGVVFAEGVEKVGRIPTKAL-ACGGT  203 (214)
T ss_dssp             CEEEEEECGGGCCCCCHHHH-SSHHH
T ss_pred             CcEEEEEccccccCCCcccc-ccccc
Confidence            99999999999999999999 99853
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1cyxa_ b.6.1.2 (A:) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54b1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d3ehbb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3dtub1 b.6.1.2 (B:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure