Citrus Sinensis ID: 047019

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MPTRSYYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGGGMCSGVSFCPPSFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVALLLSAAFDS
cccccEEEccccEEEEEEEEEcccccccccccccccccccccccccccccccccEEcccccccccccccccccccEEccccccccccccccEEEcccccEEEEEEEcccccccc
cccccEEcccccEEEEEEHHHccccccccccHHcccHHHcccccccccccccEEEEEcccccccccHHEEEEEEccccccccccccccccccEEcccccEEEEEcccccccccc
MPTRSYYILASTHLFINACqlqrdpriweeqckvqpetfltrhkdidvrGQHFELlsrggggmcsgvsfcppsfdfatpsnkplvmgeglrltvkksAPLEVLVALLLSAAFDS
MPTRSYYILASTHLFINACQLQRDPRIWEEQCKVQPEtfltrhkdidvRGQHFELLSRGGGGMCSGVSFCPPSFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVALLLSAAFDS
MPTRSYYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGGGMCSGVSFCPPSFDFATPSNKPLVMGEGLRLTVKKsaplevlvalllsaaFDS
*****YYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGGGMCSGVSFCPPSFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVALLLSA****
MPTRSYYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGGGMCSGVSFCPPSFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVALLLS*****
MPTRSYYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGGGMCSGVSFCPPSFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVALLLSAAFDS
MPTRSYYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGGGMCSGVSFCPPSFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVALLLSA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTRSYYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGGGMCSGVSFCPPSFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVALLLSAAFDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
O49859525 Cytochrome P450 82A4 OS=G no no 0.912 0.198 0.396 3e-16
O49858527 Cytochrome P450 82A3 OS=G no no 0.868 0.187 0.396 1e-15
Q43068544 Cytochrome P450 82A1 (Fra N/A no 0.912 0.191 0.396 6e-15
O81972522 Cytochrome P450 82A2 OS=G no no 0.912 0.199 0.370 4e-14
Q9SZ46524 Cytochrome P450 82C4 OS=A yes no 0.877 0.190 0.380 3e-13
O49394523 Cytochrome P450 82C2 OS=A no no 0.877 0.191 0.362 4e-12
O49396512 Cytochrome P450 82C3 OS=A no no 0.868 0.193 0.375 4e-12
P48418506 Flavonoid 3',5'-hydroxyla N/A no 0.868 0.195 0.362 1e-10
P48419508 Flavonoid 3',5'-hydroxyla N/A no 0.868 0.194 0.362 2e-10
O04773523 Flavonoid 3',5'-hydroxyla N/A no 0.868 0.189 0.327 2e-09
>sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 63/116 (54%), Gaps = 12/116 (10%)

Query: 6   YYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGG-GMC 64
           Y++   T L  N  ++  DP +W +  + +P+ FLT HKDIDV+G HF+LL  G G  +C
Sbjct: 403 YHVKKGTRLITNIWKIHTDPNVWSDPFEFKPDRFLTTHKDIDVKGHHFQLLPFGSGRRVC 462

Query: 65  SGVSFCPP-----------SFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVALLLS 109
            G+SF              SF+   PS +PL M E   +T  K+ PLEVLV   LS
Sbjct: 463 PGISFGLQTVHLALASFLHSFEILNPSTEPLDMTEAFGVTNTKATPLEVLVKPCLS 518

Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 Back     alignment and function description
>sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 Back     alignment and function description
>sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 Back     alignment and function description
>sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 Back     alignment and function description
>sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 Back     alignment and function description
>sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 Back     alignment and function description
>sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 Back     alignment and function description
>sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
359492088 525 PREDICTED: cytochrome P450 82A3-like [Vi 0.877 0.190 0.446 9e-19
359492645 731 PREDICTED: cytochrome P450 82A3 [Vitis v 0.921 0.143 0.452 3e-18
359492639 526 PREDICTED: cytochrome P450 82A4-like [Vi 0.921 0.199 0.427 3e-18
359492086 514 PREDICTED: cytochrome P450 82A3-like [Vi 0.877 0.194 0.446 3e-18
147781110 538 hypothetical protein VITISV_027433 [Viti 0.938 0.198 0.433 7e-18
356550295 523 PREDICTED: cytochrome P450 82A4-like [Gl 0.912 0.198 0.439 9e-18
297743622 313 unnamed protein product [Vitis vinifera] 0.938 0.341 0.420 1e-17
225443113 518 PREDICTED: cytochrome P450 82C4 [Vitis v 0.938 0.206 0.420 1e-17
225443111 543 PREDICTED: cytochrome P450 82C4-like [Vi 0.938 0.197 0.420 1e-17
147807677 500 hypothetical protein VITISV_020998 [Viti 0.938 0.214 0.420 1e-17
>gi|359492088|ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 97.4 bits (241), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 66/112 (58%), Gaps = 12/112 (10%)

Query: 6   YYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGG-GMC 64
           Y+I   T L +N  ++QRDPR+W    + QP+ FLT HKD+DVRG+HFEL   GGG  +C
Sbjct: 404 YHISKGTRLILNLTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKHFELTPFGGGRRIC 463

Query: 65  SGVSFCPP-----------SFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVA 105
            G+ F               F  +TPS+ P+ M EG  LT  KS PLEVL++
Sbjct: 464 PGIVFALQVLHLTLANFLHRFQLSTPSDAPVDMSEGFGLTNIKSTPLEVLIS 515

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359492645|ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492639|ref|XP_002282091.2| PREDICTED: cytochrome P450 82A4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492086|ref|XP_003634362.1| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147781110|emb|CAN76287.1| hypothetical protein VITISV_027433 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356550295|ref|XP_003543523.1| PREDICTED: cytochrome P450 82A4-like [Glycine max] Back     alignment and taxonomy information
>gi|297743622|emb|CBI36489.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443113|ref|XP_002274740.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443111|ref|XP_002274509.1| PREDICTED: cytochrome P450 82C4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147807677|emb|CAN75482.1| hypothetical protein VITISV_020998 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
TAIR|locus:2116607524 CYP82C4 ""cytochrome P450, fam 0.798 0.173 0.365 1.2e-09
TAIR|locus:2116622512 CYP82C3 ""cytochrome P450, fam 0.798 0.177 0.355 6.3e-09
TAIR|locus:2116652523 CYP82C2 ""cytochrome P450, fam 0.798 0.173 0.355 1.4e-08
TAIR|locus:2012673368 CYP76C5 ""cytochrome P450, fam 0.526 0.163 0.365 5.3e-07
TAIR|locus:2043605512 CYP76C2 ""cytochrome P450, fam 0.526 0.117 0.380 9e-07
TAIR|locus:2100982498 CYP76C7 ""cytochrome P450, fam 0.526 0.120 0.380 1.4e-06
TAIR|locus:2043694511 CYP76C4 ""cytochrome P450, fam 0.526 0.117 0.365 2.4e-06
TAIR|locus:2043699512 CYP76C1 ""cytochrome P450, fam 0.526 0.117 0.365 2.4e-06
TAIR|locus:2043614515 CYP76C3 ""cytochrome P450, fam 0.535 0.118 0.375 2.5e-06
TAIR|locus:2093501502 CYP71B17 ""cytochrome P450, fa 0.552 0.125 0.363 3e-06
TAIR|locus:2116607 CYP82C4 ""cytochrome P450, family 82, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 149 (57.5 bits), Expect = 1.2e-09, P = 1.2e-09
 Identities = 38/104 (36%), Positives = 54/104 (51%)

Query:     6 YYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRH-KDIDVRGQHFELLSRGGGGM- 63
             YY+   T L +N  ++QRDP+++ E  + +PE F+T   K+ DVRGQ+FEL+  G G   
Sbjct:   403 YYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRS 462

Query:    64 CSGVSFCPP-----------SFDFATPSNKPLVMGEGLRLTVKK 96
             C G S               SFD  T  + P+ M E   LT+ K
Sbjct:   463 CPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPGLTIPK 506
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IDA
GO:0071281 "cellular response to iron ion" evidence=IEP
GO:0010043 "response to zinc ion" evidence=RCA
TAIR|locus:2116622 CYP82C3 ""cytochrome P450, family 82, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116652 CYP82C2 ""cytochrome P450, family 82, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012673 CYP76C5 ""cytochrome P450, family 76, subfamily C, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100982 CYP76C7 ""cytochrome P450, family 76, subfamily C, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043694 CYP76C4 ""cytochrome P450, family 76, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043699 CYP76C1 ""cytochrome P450, family 76, subfamily C, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043614 CYP76C3 ""cytochrome P450, family 76, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093501 CYP71B17 ""cytochrome P450, family 71, subfamily B, polypeptide 17"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-14
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 8e-10
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-06
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 4e-06
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 0.003
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information 
 Score = 68.0 bits (166), Expect = 1e-14
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 13/112 (11%)

Query: 6   YYILASTHLFINACQLQRDPRIWEEQCKVQPETFLT-RHKDIDVRGQHFELLSRGGG-GM 63
           YYI  +T L +N   + RDP +WE   + +PE FL+ ++  ID RG  FEL+  G G  +
Sbjct: 382 YYIPKNTRLSVNIWAIGRDPDVWENPEEFRPERFLSEKNAKIDPRGNDFELIPFGAGRRI 441

Query: 64  CSGVSF-----------CPPSFDFATPSNKPLVMGEGLRLTVKKSAPLEVLV 104
           C+G                 SFD+  P    L M E   L ++K+ PL  +V
Sbjct: 442 CAGTRMGIVLVEYILGTLVHSFDWKLPDGVELNMDEAFGLALQKAVPLSAMV 493

Length = 504
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.95
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.95
PLN02394503 trans-cinnamate 4-monooxygenase 99.95
PLN02971543 tryptophan N-hydroxylase 99.94
PLN03234499 cytochrome P450 83B1; Provisional 99.94
PLN02183516 ferulate 5-hydroxylase 99.94
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.94
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.94
PTZ00404482 cytochrome P450; Provisional 99.94
PLN00168519 Cytochrome P450; Provisional 99.93
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.93
PLN02738633 carotene beta-ring hydroxylase 99.93
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.93
PLN02966502 cytochrome P450 83A1 99.93
PLN02290516 cytokinin trans-hydroxylase 99.93
PLN02936489 epsilon-ring hydroxylase 99.93
PLN02655466 ent-kaurene oxidase 99.92
PLN02687517 flavonoid 3'-monooxygenase 99.92
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.92
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.92
PLN02500490 cytochrome P450 90B1 99.92
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.92
PLN03112514 cytochrome P450 family protein; Provisional 99.92
PLN03018534 homomethionine N-hydroxylase 99.92
PLN02774463 brassinosteroid-6-oxidase 99.92
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.91
PLN02987472 Cytochrome P450, family 90, subfamily A 99.91
PLN02302490 ent-kaurenoic acid oxidase 99.91
PLN02196463 abscisic acid 8'-hydroxylase 99.9
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.88
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.81
PLN02648480 allene oxide synthase 99.77
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.95  E-value=2.3e-28  Score=180.61  Aligned_cols=102  Identities=21%  Similarity=0.305  Sum_probs=86.3

Q ss_pred             ccc-cEEeCCCCEEEEcccccccCCCCCCCCCCcCCCcccCCCCCcCccCccceEEecCCC-CCCCCCccCCC-------
Q 047019            2 PTR-SYYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGG-GMCSGVSFCPP-------   72 (114)
Q Consensus         2 ~i~-g~~ipkg~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~~~pFg~G-r~C~G~~lA~~-------   72 (114)
                      ++. ++.|+||+.|.++.|++||||++||||++|+||||.+++.  + ...+.+|+|||.| |+|||++||++       
T Consensus       382 ~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~--~-~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~  458 (499)
T KOG0158|consen  382 EIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENN--K-SRHPGAYLPFGVGPRNCIGMRFALMEAKLALA  458 (499)
T ss_pred             ecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCcc--c-ccCCccccCCCCCccccHHHHHHHHHHHHHHH
Confidence            466 8999999999999999999999999999999999997652  1 4467899999999 99999999999       


Q ss_pred             ----ceeeecCCCCcccccccc---ceEeeecCCeEEEEEEcc
Q 047019           73 ----SFDFATPSNKPLVMGEGL---RLTVKKSAPLEVLVALLL  108 (114)
Q Consensus        73 ----~f~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~r~  108 (114)
                          +|+++..+. .+.. ...   +.++.++.++.+++++|.
T Consensus       459 ~lL~~f~~~~~~~-t~~~-~~~~~~~~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  459 HLLRNFSFEVCPT-TIIP-LEGDPKGFTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             HHHhhCEEecCCc-ccCc-ccCCccceeeecCCceEEEEEeCC
Confidence                999988763 2222 333   677888999999999874

>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-08
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-06
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-05
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-04
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score = 49.2 bits (118), Expect = 3e-08
 Identities = 24/124 (19%), Positives = 39/124 (31%), Gaps = 23/124 (18%)

Query: 4   RSYYILASTHLFINA-CQLQRDPRIWEEQCKVQPETFL----TRHKDIDVRGQ--HFELL 56
           + Y++     L +      Q DP+I ++    Q + FL    T  KD    G    +  +
Sbjct: 344 QEYHLRRGDRLCVFPFISPQMDPQIHQQPEMFQFDRFLNADRTEKKDFFKNGARVKYPSV 403

Query: 57  SRGGGG-MCSGVSFCPP-----------SFDFATPSNK---PLVMGEGLRLTV-KKSAPL 100
             G    +C G  F               FD          PLV        + + +  L
Sbjct: 404 PWGTEDNLCPGRHFAVHAIKELVFTILTRFDVELCDKNATVPLVDPSRYGFGILQPAGDL 463

Query: 101 EVLV 104
           E+  
Sbjct: 464 EIRY 467
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.96
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.94
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.94
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.94
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.94
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.94
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.94
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.93
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.93
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.93
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.93
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.93
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.93
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.93
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.93
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.92
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.92
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.92
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.92
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.92
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.91
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.91
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.9
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.9
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.9
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.9
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.89
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.89
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.88
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.88
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.87
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.87
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.87
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.87
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.87
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.87
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.87
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.87
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.86
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.86
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.86
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.86
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.86
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.86
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.86
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.86
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.86
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.86
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.85
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.85
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.85
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.85
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.85
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.85
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.85
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.85
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.85
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.85
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.84
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.84
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.84
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.84
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.84
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.84
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.84
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.84
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.83
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.83
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.83
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.83
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.82
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.8
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.8
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.8
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.79
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.79
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.74
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.96  E-value=3.7e-30  Score=186.83  Aligned_cols=104  Identities=21%  Similarity=0.369  Sum_probs=84.3

Q ss_pred             ccccEEeCCCCEEEEcccccccCCCCCCCCCCcCCCcccCCCCCcCccCccceEEecCCC-CCCCCCccCCC--------
Q 047019            2 PTRSYYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGG-GMCSGVSFCPP--------   72 (114)
Q Consensus         2 ~i~g~~ipkg~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~~~pFg~G-r~C~G~~lA~~--------   72 (114)
                      +++||.|||||.|+++.+++||||++|+||++|+||||+++++   ....+.+|+|||.| |+|+|++||++        
T Consensus       361 ~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~---~~~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~  437 (479)
T 3tbg_A          361 EVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQG---HFVKPEAFLPFSAGRRACLGEPLARMELFLFFTS  437 (479)
T ss_dssp             EETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTC---CBCCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHH
T ss_pred             eECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCc---ccCCCCceecCCCCCcCChhHHHHHHHHHHHHHH
Confidence            5799999999999999999999999999999999999997652   12346789999999 99999999998        


Q ss_pred             ---ceeeecCCCCcc-ccccccceEeeecCCeEEEEEEccc
Q 047019           73 ---SFDFATPSNKPL-VMGEGLRLTVKKSAPLEVLVALLLS  109 (114)
Q Consensus        73 ---~f~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~r~~  109 (114)
                         +|+|++++++.. ......+++..| .++++++++|..
T Consensus       438 ll~~f~~~~~~~~~~~~~~~~~~~~~~P-~~~~v~~~pRs~  477 (479)
T 3tbg_A          438 LLQHFSFSVPTGQPRPSHHGVFAFLVSP-SPYELCAVPRHH  477 (479)
T ss_dssp             HHHHEEEECCTTSCCCCSCEEESSSEEE-CCCCBEEEEC--
T ss_pred             HHHccEEEeCCCCCCccccccceeeecC-CCeEEEEEECCC
Confidence               999998876432 333334455555 478999999975
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-05
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 9e-04
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 0.001
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 39.3 bits (90), Expect = 3e-05
 Identities = 24/111 (21%), Positives = 39/111 (35%), Gaps = 15/111 (13%)

Query: 6   YYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGGG-MC 64
            +I     + I +  L RDP+ W E  K  PE F  ++KD       +     G G   C
Sbjct: 359 MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKD---NIDPYIYTPFGSGPRNC 415

Query: 65  SGVSFCP-----------PSFDFATPSNKPLVMGEGLRLTVKKSAPLEVLV 104
            G+ F              +F F       + +   L   ++   P+ + V
Sbjct: 416 IGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKV 466
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.95
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.95
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.94
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.94
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.94
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.92
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.91
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.88
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.88
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.88
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.87
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.86
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.85
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.85
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.84
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.83
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.83
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.81
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.8
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.8
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.8
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=6.5e-30  Score=182.74  Aligned_cols=104  Identities=22%  Similarity=0.360  Sum_probs=88.9

Q ss_pred             ccccEEeCCCCEEEEcccccccCCCCCCCCCCcCCCcccCCCCCcCccCccceEEecCCC-CCCCCCccCCC--------
Q 047019            2 PTRSYYILASTHLFINACQLQRDPRIWEEQCKVQPETFLTRHKDIDVRGQHFELLSRGGG-GMCSGVSFCPP--------   72 (114)
Q Consensus         2 ~i~g~~ipkg~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~~~pFg~G-r~C~G~~lA~~--------   72 (114)
                      .++||.||||+.|+++.+++|+||++|+||++|+||||++.++   ....+.+|+|||.| |.|+|++||++        
T Consensus       355 ~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~---~~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~  431 (472)
T d1tqna_         355 EINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNK---DNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIR  431 (472)
T ss_dssp             EETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTG---GGCCTTTSCTTCCSTTSCTTHHHHHHHHHHHHHH
T ss_pred             cccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCc---ccCCCceecCCCCCCccChhHHHHHHHHHHHHHH
Confidence            5789999999999999999999999999999999999997652   12346689999999 99999999998        


Q ss_pred             ---ceeeecCCCCccccccccceEeeecCCeEEEEEEcc
Q 047019           73 ---SFDFATPSNKPLVMGEGLRLTVKKSAPLEVLVALLL  108 (114)
Q Consensus        73 ---~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~  108 (114)
                         +|+|+++++...++......++.++.++.+++++|.
T Consensus       432 ll~~f~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R~  470 (472)
T d1tqna_         432 VLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRD  470 (472)
T ss_dssp             HHTTEEEECCTTCCSSCCBCSSSSCCBSSCCEEEEEETT
T ss_pred             HHHhCEEEeCCCCCCCceeccceEEeeCCCEEEEEEECC
Confidence               999998876555555555556678889999999985
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure