Citrus Sinensis ID: 047050


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MVINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIPT
ccEEccccccccccccHHHHccccccEEEcccccccccccHHHHccEEcccccEEEEcccccccccccccEEEcccccccccccHHHHcccccccccccccEEEEcccccccHHHHHHHccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccc
cEEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccc
mvinwiqlqpldcefpdvLKTQHQLQLLIISRNQIHGRISNWMWDMGVRtftnnfhgripqtyvqgcnldflrlngnclerpiptslidyVNMNflnvgnnklsgpipkckniqteriLTTSATIDLSSNRFQEKILEVVGKLNslknsnishnnliggipsslrnltefesLDLSLNKFVEHIPT
MVINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTtsatidlssnrFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESldlslnkfvehipt
MVINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIPT
*VINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKF******
MVINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIP*
MVINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIPT
MVINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFV*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep yes no 0.844 0.140 0.359 5e-14
Q9LHP4 1141 Receptor-like protein kin no no 0.913 0.148 0.312 5e-13
Q9ZUI0 980 Putative leucine-rich rep no no 0.913 0.173 0.320 7e-13
Q9SSL9 1123 Leucine-rich repeat recep no no 0.930 0.154 0.326 1e-12
C0LGQ9 1037 Probable LRR receptor-lik no no 0.838 0.150 0.326 2e-12
Q9LYN8 1192 Leucine-rich repeat recep no no 0.887 0.138 0.300 3e-12
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.811 0.120 0.316 3e-12
Q8VZG8 1045 Probable LRR receptor-lik no no 0.913 0.162 0.290 4e-12
O49318 1124 Probable leucine-rich rep no no 0.865 0.143 0.292 5e-12
Q42371 976 LRR receptor-like serine/ no no 0.924 0.176 0.306 6e-12
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/167 (35%), Positives = 80/167 (47%), Gaps = 10/167 (5%)

Query: 24  QLQLLIISRNQIHGRISNWMWDMG----VRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCL 79
           +L  LI+S N I G I   +W+M     +   TNN  G +P+      NL  LRLNGN L
Sbjct: 559 KLGALIMSNNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQL 618

Query: 80  ERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRFQEKILEV 139
              +P  L    N+  L++ +N  S  IP     QT         ++LS N+F   I  +
Sbjct: 619 SGRVPAGLSFLTNLESLDLSSNNFSSEIP-----QTFDSFLKLHDMNLSRNKFDGSIPRL 673

Query: 140 VGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIPT 186
             KL  L   ++SHN L G IPS L +L   + LDLS N     IPT
Sbjct: 674 -SKLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGLIPT 719





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
297735649 778 unnamed protein product [Vitis vinifera] 0.913 0.218 0.411 3e-21
296085012 1221 unnamed protein product [Vitis vinifera] 0.876 0.133 0.349 1e-19
297734767 368 unnamed protein product [Vitis vinifera] 0.768 0.388 0.379 2e-18
449454674 719 PREDICTED: probable LRR receptor-like se 0.715 0.184 0.439 4e-18
296087428 849 unnamed protein product [Vitis vinifera] 0.913 0.200 0.320 6e-17
296086784 816 unnamed protein product [Vitis vinifera] 0.838 0.191 0.377 7e-17
147793123 951 hypothetical protein VITISV_032542 [Viti 0.838 0.164 0.372 8e-17
225455498 980 PREDICTED: receptor-like protein 12-like 0.838 0.159 0.372 8e-17
147826872 751 hypothetical protein VITISV_000530 [Viti 0.913 0.226 0.373 2e-16
356561450 813 PREDICTED: receptor-like protein 12-like 0.940 0.215 0.328 2e-16
>gi|297735649|emb|CBI18143.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 97/180 (53%), Gaps = 10/180 (5%)

Query: 16  PDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTF----TNNFHGRIPQTYVQGCNLDF 71
           P  +     LQ+L  S N + G+I + + + G         NNF G IP  +   C L  
Sbjct: 393 PRSICNATYLQVLDFSNNNLSGKIPSCLIEYGTLGVLNLRRNNFSGAIPGKFPVNCLLQT 452

Query: 72  LRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKC--KNIQTER---ILTTSATID 126
           L L+ N +E  IP SL +   +  LN+GNN+++G  P C  KNI T R   +LT   +ID
Sbjct: 453 LDLSRNHIEGKIPGSLANCTALEVLNLGNNQMNGTFP-CLLKNITTLRLVKVLTLYTSID 511

Query: 127 LSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIPT 186
           LS N FQ  I EV+G   SL   N+SHN   G IPSS+ NL + ESLDLS N+    IPT
Sbjct: 512 LSCNNFQGDIPEVMGNFTSLYVLNLSHNGFTGHIPSSIGNLRQLESLDLSRNRLSGEIPT 571




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296085012|emb|CBI28427.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734767|emb|CBI17001.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454674|ref|XP_004145079.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g26540-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296087428|emb|CBI34017.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296086784|emb|CBI32933.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147793123|emb|CAN75335.1| hypothetical protein VITISV_032542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225455498|ref|XP_002264793.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147826872|emb|CAN73268.1| hypothetical protein VITISV_000530 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356561450|ref|XP_003548994.1| PREDICTED: receptor-like protein 12-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.844 0.140 0.359 1.7e-15
TAIR|locus:2180587 811 RLP52 "receptor like protein 5 0.924 0.212 0.335 9.8e-15
TAIR|locus:2047525 980 AT2G24130 [Arabidopsis thalian 0.897 0.170 0.320 1.6e-14
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.956 0.156 0.306 2e-14
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.887 0.184 0.272 2.4e-14
TAIR|locus:2032697 1123 PEPR1 "PEP1 receptor 1" [Arabi 0.924 0.153 0.328 5.3e-14
TAIR|locus:2119535 725 RLP48 "receptor like protein 4 0.870 0.223 0.322 5.9e-14
TAIR|locus:2078102 875 RLP33 "receptor like protein 3 0.892 0.189 0.279 6.1e-14
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.887 0.146 0.304 1.4e-13
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.811 0.120 0.322 2.6e-13
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 208 (78.3 bits), Expect = 1.7e-15, P = 1.7e-15
 Identities = 60/167 (35%), Positives = 80/167 (47%)

Query:    24 QLQLLIISRNQIHGRISNWMWDMG----VRTFTNNFHGRIPQTYVQGCNLDFLRLNGNCL 79
             +L  LI+S N I G I   +W+M     +   TNN  G +P+      NL  LRLNGN L
Sbjct:   559 KLGALIMSNNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQL 618

Query:    80 ERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRFQEKILEV 139
                +P  L    N+  L++ +N  S  IP     QT         ++LS N+F   I  +
Sbjct:   619 SGRVPAGLSFLTNLESLDLSSNNFSSEIP-----QTFDSFLKLHDMNLSRNKFDGSIPRL 673

Query:   140 VGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIPT 186
               KL  L   ++SHN L G IPS L +L   + LDLS N     IPT
Sbjct:   674 -SKLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGLIPT 719


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047525 AT2G24130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032697 PEPR1 "PEP1 receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-07
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 72.6 bits (178), Expect = 3e-15
 Identities = 56/175 (32%), Positives = 81/175 (46%), Gaps = 15/175 (8%)

Query: 17  DVLKTQHQLQLLIISRNQIHGRISN-WMWDMGVRTFTNN-FHGRIPQTYVQGCNLDFLRL 74
           D+  T   L+ L +S N   G I    + ++     +NN   G IP       +L  L L
Sbjct: 112 DIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDL 171

Query: 75  NGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIP----KCKNIQTERILTTSATIDLSSN 130
            GN L   IP SL +  ++ FL + +N+L G IP    + K+++          I L  N
Sbjct: 172 GGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKW---------IYLGYN 222

Query: 131 RFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIP 185
               +I   +G L SL + ++ +NNL G IPSSL NL   + L L  NK    IP
Sbjct: 223 NLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP 277


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.71
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.68
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.61
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.6
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.6
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.58
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.49
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.49
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.44
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.44
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.43
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.41
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.39
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.36
PLN03150623 hypothetical protein; Provisional 99.36
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.34
PLN03150623 hypothetical protein; Provisional 99.27
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.22
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.61
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.56
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.54
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.54
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.43
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.38
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.33
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.32
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.28
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.24
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.15
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.09
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.01
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.91
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.87
PRK15386 426 type III secretion protein GogB; Provisional 97.84
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.77
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.75
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.62
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 97.35
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.32
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.15
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.93
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.87
PRK15386 426 type III secretion protein GogB; Provisional 96.82
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.33
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.13
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.07
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.54
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.79
KOG4308 478 consensus LRR-containing protein [Function unknown 94.39
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.67
smart0037026 LRR Leucine-rich repeats, outliers. 91.99
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.99
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.15
KOG1947 482 consensus Leucine rich repeat proteins, some prote 90.12
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.66
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.53
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 83.32
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 81.65
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 80.69
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.90  E-value=2.2e-23  Score=178.67  Aligned_cols=185  Identities=29%  Similarity=0.411  Sum_probs=117.6

Q ss_pred             CeeeeeecCCccccCchhhhcccCccEEEeeecccccccchhHhhccee---ee-eceeeeecCcccccCCCCCEEEccC
Q 047050            1 MVINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVR---TF-TNNFHGRIPQTYVQGCNLDFLRLNG   76 (186)
Q Consensus         1 l~~~~l~~~~l~~~~p~~~~~l~~L~~L~l~~n~i~~~~~~~~~~l~~l---~~-~~~~~~~~~~~~~~l~~L~~L~l~~   76 (186)
                      |+.|+++.|.+.+.+|..++++++|+.|++++|.+.+..|.++.+++.|   .+ .|.+.+.+|..+.++++|++|++++
T Consensus       142 L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~  221 (968)
T PLN00113        142 LETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGY  221 (968)
T ss_pred             CCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcC
Confidence            4556666777777777777777777777777777777777766655444   33 5555566666666666677777666


Q ss_pred             CccCCcCchhhhhcCCCCEEEecCcccccCCC-CCCcc------------------chhhhcCcccEEeccCCccCchhh
Q 047050           77 NCLERPIPTSLIDYVNMNFLNVGNNKLSGPIP-KCKNI------------------QTERILTTSATIDLSSNRFQEKIL  137 (186)
Q Consensus        77 n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~-~~~~~------------------~~~~~~~~L~~l~l~~n~l~~~~~  137 (186)
                      |.+.+.+|..++.+++|++|++++|.+.+..| .+..+                  .....+++|+.|++++|.+.+.+|
T Consensus       222 n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p  301 (968)
T PLN00113        222 NNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIP  301 (968)
T ss_pred             CccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCC
Confidence            66666566666666666666666666655444 22110                  011224566666666666666666


Q ss_pred             HHhhccCCCCEEEcCCCccccCccccccCCCCCceeeccCccccccCC
Q 047050          138 EVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIP  185 (186)
Q Consensus       138 ~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~ip  185 (186)
                      .++..+++|+.|++++|.+.+..|..++.+++|+.|++++|.+++.+|
T Consensus       302 ~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p  349 (968)
T PLN00113        302 ELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIP  349 (968)
T ss_pred             hhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCC
Confidence            666666666666666666666666666666667777777776666655



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-06
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-06
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 48.9 bits (115), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 33/186 (17%) Query: 5 WIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMG----VRTFTNNFHGRIP 60 ++Q + P L +L L +S N + G I + + + ++ + N G IP Sbjct: 397 YLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 456 Query: 61 QTYVQGCNLDFLRLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILT 120 Q + L+ L L+ N L IP+ L + N+N++++ NN+L+G IPK Sbjct: 457 QELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKW---------- 506 Query: 121 TSATIDLSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKF 180 +G+L +L +S+N+ G IP+ L + LDL+ N F Sbjct: 507 -------------------IGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLF 547 Query: 181 VEHIPT 186 IP Sbjct: 548 NGTIPA 553
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-27
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-18
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 5e-04
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 8e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  106 bits (268), Expect = 2e-27
 Identities = 39/175 (22%), Positives = 58/175 (33%), Gaps = 7/175 (4%)

Query: 14  EFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFLR 73
             P  L     L  L ++ N  +G I   M+    +   N   G+               
Sbjct: 529 NIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECH 588

Query: 74  LNGNCLE--RPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNR 131
             GN LE        L      N  N+ +    G               +   +D+S N 
Sbjct: 589 GAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF-----DNNGSMMFLDMSYNM 643

Query: 132 FQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIPT 186
               I + +G +  L   N+ HN++ G IP  + +L     LDLS NK    IP 
Sbjct: 644 LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQ 698


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.89
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.86
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.84
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.84
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.82
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.81
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.81
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.78
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.76
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.76
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.75
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.75
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.75
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.74
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.74
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.74
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.67
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.67
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.62
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.55
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.51
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.46
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.39
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.36
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.36
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.29
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.24
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.84
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.82
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.64
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.49
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.45
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.96
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.79
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.73
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.7
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.5
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.19
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.03
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.01
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.88
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.95  E-value=9e-28  Score=200.06  Aligned_cols=108  Identities=27%  Similarity=0.382  Sum_probs=75.0

Q ss_pred             CeeeeeecCCccccCchhhhcccCccEEEeeecccccccchhHhhccee---ee-eceeeeecCcccccCCCCCEEEccC
Q 047050            1 MVINWIQLQPLDCEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVR---TF-TNNFHGRIPQTYVQGCNLDFLRLNG   76 (186)
Q Consensus         1 l~~~~l~~~~l~~~~p~~~~~l~~L~~L~l~~n~i~~~~~~~~~~l~~l---~~-~~~~~~~~~~~~~~l~~L~~L~l~~   76 (186)
                      |+.++++.|.+.+.+|..++.+++|+.|++++|.+.+.+|.++..++.+   .+ .|.+.+.+|..+..+++|++|++++
T Consensus       444 L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~  523 (768)
T 3rgz_A          444 LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSN  523 (768)
T ss_dssp             CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCS
T ss_pred             CCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCC
Confidence            4566777777777777777777777777777777777777766655444   33 5666666777777777777777777


Q ss_pred             CccCCcCchhhhhcCCCCEEEecCcccccCCC
Q 047050           77 NCLERPIPTSLIDYVNMNFLNVGNNKLSGPIP  108 (186)
Q Consensus        77 n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~  108 (186)
                      |++.+.+|..++.+++|++|++++|.+.+.+|
T Consensus       524 N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip  555 (768)
T 3rgz_A          524 NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIP  555 (768)
T ss_dssp             SCCEEECCGGGGGCTTCCEEECCSSEEESBCC
T ss_pred             CcccCcCCHHHcCCCCCCEEECCCCccCCcCC
Confidence            77776677777777777777777777665554



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 45.5 bits (106), Expect = 9e-07
 Identities = 26/168 (15%), Positives = 47/168 (27%), Gaps = 3/168 (1%)

Query: 13  CEFPDVLKTQHQLQLLIISRNQIHGRISNWMWDMGVRTFTNNFHGRIPQTYVQGCNLDFL 72
              P  + +   L  +    N+I G I +          +        +   +       
Sbjct: 139 GTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRN--RLTGKIPPTFAN 196

Query: 73  RLNGNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPKCKNIQTERILTTSATIDLSSNRF 132
                             V                    ++    +      +DL +NR 
Sbjct: 197 LNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRI 256

Query: 133 QEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKF 180
              + + + +L  L + N+S NNL G IP    NL  F+    + NK 
Sbjct: 257 YGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.61
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.61
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.6
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.58
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.47
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.34
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.33
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.32
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.16
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.05
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.98
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.87
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.76
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.08
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.56
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.93  E-value=2.2e-25  Score=165.95  Aligned_cols=183  Identities=24%  Similarity=0.300  Sum_probs=109.0

Q ss_pred             eeeeecCCccc--cCchhhhcccCccEEEeee-cccccccchhHhhccee---ee-eceeeeecCcccccCCCCCEEEcc
Q 047050            3 INWIQLQPLDC--EFPDVLKTQHQLQLLIISR-NQIHGRISNWMWDMGVR---TF-TNNFHGRIPQTYVQGCNLDFLRLN   75 (186)
Q Consensus         3 ~~~l~~~~l~~--~~p~~~~~l~~L~~L~l~~-n~i~~~~~~~~~~l~~l---~~-~~~~~~~~~~~~~~l~~L~~L~l~   75 (186)
                      .++++.+.+.+  .+|++++++++|+.|++++ |.+.|.+|.++++++.|   .+ +|.+.+..+..+..+..|+.++++
T Consensus        54 ~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~  133 (313)
T d1ogqa_          54 NLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFS  133 (313)
T ss_dssp             EEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECC
T ss_pred             EEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccc
Confidence            45566666655  3566666666666666664 56666666665554443   22 444444444444455555555555


Q ss_pred             CCccCCcCchhhhhcCCCCEEEecCcccccCCCC-------------------------C-Cc-----------------
Q 047050           76 GNCLERPIPTSLIDYVNMNFLNVGNNKLSGPIPK-------------------------C-KN-----------------  112 (186)
Q Consensus        76 ~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~-------------------------~-~~-----------------  112 (186)
                      +|.+...+|..++.++.++.+++++|.+.+.+|.                         . ..                 
T Consensus       134 ~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~  213 (313)
T d1ogqa_         134 YNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDA  213 (313)
T ss_dssp             SSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECC
T ss_pred             cccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            5554444455555555555555555544433331                         0 00                 


Q ss_pred             cchhhhcCcccEEeccCCccCchhhHHhhccCCCCEEEcCCCccccCccccccCCCCCceeeccCccccccCCC
Q 047050          113 IQTERILTTSATIDLSSNRFQEKILEVVGKLNSLKNSNISHNNLIGGIPSSLRNLTEFESLDLSLNKFVEHIPT  186 (186)
Q Consensus       113 ~~~~~~~~~L~~l~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~ip~  186 (186)
                      ......+++++.+++++|.+.+.+ +.++.+++++.|++++|.+++.+|+.++++++|+.|++++|+++|.||+
T Consensus       214 ~~~~~~~~~l~~l~~~~~~l~~~~-~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~  286 (313)
T d1ogqa_         214 SVLFGSDKNTQKIHLAKNSLAFDL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ  286 (313)
T ss_dssp             GGGCCTTSCCSEEECCSSEECCBG-GGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC
T ss_pred             cccccccccccccccccccccccc-cccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC
Confidence            001123466777778877776644 3566677888888888888877888888888888888888888888774



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure