Citrus Sinensis ID: 047110

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780----
MHAESQETTLSSCSSSSSSSSPSCSACVVPLAFSPVQGTVTVPFSAGWNRRYRDASGENLITSLEIIPLRFTNLEWTDVEARFDRLAYTKNGTEPVIKWSDFSFCIAKLKLLLYIIVFPSNFVAMQQTPEFANEILRALRGRSEWKVDITKNELRDYWHRMAGSVDSRIQLFFYMCDRNFDGKIDEIDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTKKRGYLEVTNPHKDDLYHEPMSKNEVRFRSYWRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAGYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVCKIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTFSYRTNTRFVFHKEHF
ccccccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccEEccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccEEEEEcccHHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEcccccccccccEEEEEccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHcccccccEEEEcccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHcccccccEEEEEEccc
ccccccHHHHHHcccccccccccccHccccccccHHHHHccccccccccccccHHHHHHHHHccHHEccccccccHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccEEEEHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHccEcccccHccHHHHHHHHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHcHHHHHccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEccccEEEEEEEcccccEEcccEEEEEEcccccccccccEEEcccccccEEEEEEEcccHHHHHHHHHHccccccccccccEEEEEcccccccHHHccEEEEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccEEEccEEEcccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEcccc
mhaesqettlsscsssssssspscsacvvplafspvqgtvtvpfsagwnrryrdasgenlITSLEIiplrftnlewtDVEARFDRlaytkngtepvikwsdfSFCIAKLKLLLYIIVFPsnfvamqqTPEFANEILRALRgrsewkvdITKNELRDYWHRMAGSVDSRIQLFFYMCdrnfdgkideiDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTkkrgylevtnphkddlyhepmsknevRFRSYWRRAWIVLFWLLICAVLFTWKFIqyshrpafQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRwlssiipfndninfHKLIACGIVVGVIlhggthlacdfpriagcdrVLFQQtlasgfghqqptYMQILATKEVATGIAMVILMAIAFPLATKWARRQStllprsvrhvagyntfWYSHHLFVFVYALLFVHGMFlfltnnpfekttWMYIAVPVLLYAGERIYRVVRSGIYeiknltpslypgkvlslkmqkpegfryragmymfvqcpeispfewhpfsltsgpaddfLSVHIRALGDWTYRLYGIFQEEMLgaakgfpkvyidgpygassqdyvKYDVVLLIGLGIGATPFISIIRDVANNaqkaefdqvagsvckipkgplkAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARtgidiisktpmwthysrpdwfNVFSKLArrhpgerigvfycgslllgkeleglcttfsyrtntrfvfHKEHF
mhaesqettlsscssssssssPSCSACVVPLAFSPVQGTVTvpfsagwnrrYRDASGENLITSLEIIPLRFTNLEWTDVEARFDRLAytkngtepvikwsDFSFCIAKLKLLLYIIVFPSNFVAMQQTPEFANEILRAlrgrsewkvdiTKNELRDYWHRMAGSVDSRIQLFFYMCDRNFDGKIDEIDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTKKRGYLEVTnphkddlyhepmskNEVRFRSYWRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAGYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIknltpslypgkvlSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVCKIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTFSYRTNTRFVFHKEHF
MHAESQETTLsscsssssssspscsACVVPLAFSPVQGTVTVPFSAGWNRRYRDASGENLITSLEIIPLRFTNLEWTDVEARFDRLAYTKNGTEPVIKWSDFSFCIAKLKLLLYIIVFPSNFVAMQQTPEFANEILRALRGRSEWKVDITKNELRDYWHRMAGSVDSRIQLFFYMCDRNFDGKIDEIDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTKKRGYLEVTNPHKDDLYHEPMSKNEVRFRSYWRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAGYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVCKIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSlllgkeleglCTTFSYRTNTRFVFHKEHF
************************SACVVPLAFSPVQGTVTVPFSAGWNRRYRDASGENLITSLEIIPLRFTNLEWTDVEARFDRLAYTKNGTEPVIKWSDFSFCIAKLKLLLYIIVFPSNFVAMQQTPEFANEILRALRGRSEWKVDITKNELRDYWHRMAGSVDSRIQLFFYMCDRNFDGKIDEIDMKQTILG****************YAASIMEFLDTKKRGYLEVTNPHKDDLYHEPMSKNEVRFRSYWRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAGYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVCKIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTFSYRTNTRFVFH****
**************************************************************SLEIIPLRFTNLEWTDVEARFDRLAYTKNGTEPVIKWSDFSFCIAKLKLL****************PEFANEILRALRGRSEWKVDITKNELRDYWHRMAGSVDSRIQLFFYMCDRNFDGKIDEIDMKQTIL*****************YAASIMEFLDT**RGYLEVTNPHKDDLYHEPMSKNEVRFRSYWRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAGYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKA**********KIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTFSYRTNTRFVFHKEHF
**************************CVVPLAFSPVQGTVTVPFSAGWNRRYRDASGENLITSLEIIPLRFTNLEWTDVEARFDRLAYTKNGTEPVIKWSDFSFCIAKLKLLLYIIVFPSNFVAMQQTPEFANEILRALRGRSEWKVDITKNELRDYWHRMAGSVDSRIQLFFYMCDRNFDGKIDEIDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTKKRGYLEVTNPHKDDLYHEPMSKNEVRFRSYWRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAGYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVCKIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTFSYRTNTRFVFHKEHF
*************************************************************TSLEIIPLRFTNLEWTDVEARFDRLAYTKNGTEPVIKWSDFSFCIAKLKLLLYIIVFPSNFVAMQQTPEFANEILRALRGRSEWKVDITKNELRDYWHRMAGSVDSRIQLFFYMCDRNFDGKIDEIDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTKKRGYLEVTNPHKDDLYHEPMSKNEVRFRSYWRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAGYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQ**************PKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTFSYRTNTRFVFHKE*F
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHAESQETTLSSCSSSSSSSSPSCSACVVPLAFSPVQGTVTVPFSAGWNRRYRDASGENLITSLEIIPLRFTNLEWTDVEARFDRLAYTKNGTEPVIKWSDFSFCIAKLKLLLYIIVFPSNFVAMQQTPEFANEILRALRGRSEWKVDITKNELRDYWHRMAGSVDSRIQLFFYMCDRNFDGKIDEIDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTKKRGYLEVTNPHKDDLYHEPMSKNEVRFRSYWRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAGYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVCKIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTFSYRTNTRFVFHKEHF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query784 2.2.26 [Sep-21-2011]
O48538944 Respiratory burst oxidase yes no 0.900 0.747 0.475 0.0
Q948U0963 Respiratory burst oxidase N/A no 0.899 0.732 0.474 0.0
Q9FIJ0921 Respiratory burst oxidase no no 0.877 0.747 0.461 0.0
Q9SBI0843 Respiratory burst oxidase no no 0.869 0.809 0.449 0.0
Q948T9867 Respiratory burst oxidase N/A no 0.872 0.788 0.458 0.0
Q2HXL0938 Respiratory burst oxidase N/A no 0.918 0.767 0.428 0.0
Q9SW17849 Putative respiratory burs no no 0.905 0.836 0.439 0.0
Q5ZAJ0905 Respiratory burst oxidase no no 0.878 0.761 0.442 0.0
Q6J2K5905 Respiratory burst oxidase N/A no 0.878 0.761 0.442 0.0
O81211952 Respiratory burst oxidase no no 0.872 0.718 0.456 0.0
>sp|O48538|RBOHF_ARATH Respiratory burst oxidase homolog protein F OS=Arabidopsis thaliana GN=RBOHF PE=1 SV=1 Back     alignment and function desciption
 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/795 (47%), Positives = 501/795 (63%), Gaps = 89/795 (11%)

Query: 55  ASGENLITSLEIIPLRFTNLE-WTDVEARFDRLAYTKNGTEPVIKWSDFSFCIAKLKLLL 113
           +S +  +  L  I  +  N++ W DV++ F++  + KNG    I  SDF+ CI       
Sbjct: 174 SSAQRALRGLRFISNKQKNVDGWNDVQSNFEK--FEKNG---YIYRSDFAQCIG------ 222

Query: 114 YIIVFPSNFVAMQQTPEFANEILRALRGRSEWKVD-ITKNELRDYWHRMAG-SVDSRIQL 171
                      M+ + EFA E+  AL  R   KV+ I  +EL +YW ++   S DSR+Q+
Sbjct: 223 -----------MKDSKEFALELFDALSRRRRLKVEKINHDELYEYWSQINDESFDSRLQI 271

Query: 172 FFYMCDRNFDGKIDEIDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTKKRGYLEV- 230
           FF + D+N DG+I E ++K+ I+ SASANKLS   E+A+EYAA IME LD ++ GY+E+ 
Sbjct: 272 FFDIVDKNEDGRITEEEVKEIIMLSASANKLSRLKEQAEEYAALIMEELDPERLGYIELW 331

Query: 231 ---TNPHKDDLY----------HEPMSKNEVRFRSY-----------------WRRAWIV 260
              T   + D Y           + +S+N    R                   W+R W++
Sbjct: 332 QLETLLLQKDTYLNYSQALSYTSQALSQNLQGLRGKSRIHRMSSDFVYIMQENWKRIWVL 391

Query: 261 LFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWL 320
             W++I   LF WKF QY  + AF VMGYCL TAKGAAETLK NMALIL PV RNT+TWL
Sbjct: 392 SLWIMIMIGLFLWKFFQYKQKDAFHVMGYCLLTAKGAAETLKFNMALILFPVCRNTITWL 451

Query: 321 RKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLFQQTLASG 380
           R  R LS  +PF+DNINFHK IA  IVV VILH G HLACDFPRI       + + L   
Sbjct: 452 RSTR-LSYFVPFDDNINFHKTIAGAIVVAVILHIGDHLACDFPRIVRATEYDYNRYLFHY 510

Query: 381 FGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAGYNTFWY 440
           F  +QPTY  ++   E  TGI MVILM I+F LAT+W RR    LP+    + G+N FWY
Sbjct: 511 FQTKQPTYFDLVKGPEGITGILMVILMIISFTLATRWFRRNLVKLPKPFDRLTGFNAFWY 570

Query: 441 SHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIKNL 500
           SHHLFV VY LL +HG+FL+     + +TTWMY+AVPVLLY GER  R  RSG Y ++ L
Sbjct: 571 SHHLFVIVYILLILHGIFLYFAKPWYVRTTWMYLAVPVLLYGGERTLRYFRSGSYSVRLL 630

Query: 501 TPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRA 560
             ++YPG VL+L+M KP  FRY++G YMFVQCP +SPFEWHPFS+TS P DD++S+HIR 
Sbjct: 631 KVAIYPGNVLTLQMSKPTQFRYKSGQYMFVQCPAVSPFEWHPFSITSAPEDDYISIHIRQ 690

Query: 561 LGDWTYRLYGIFQE----------EMLGA----AKGFPKVYIDGPYGASSQDYVKYDVVL 606
           LGDWT  L  +F E           +L A     K  PK+ IDGPYGA +QDY KYDV+L
Sbjct: 691 LGDWTQELKRVFSEVCEPPVGGKSGLLRADETTKKSLPKLLIDGPYGAPAQDYRKYDVLL 750

Query: 607 LIGLGIGATPFISIIRDVANNAQKAE--FDQVA----------GSVCKIPK-----GPLK 649
           L+GLGIGATPFISI++D+ NN  K E   D ++          GS    P+         
Sbjct: 751 LVGLGIGATPFISILKDLLNNIVKMEEHADSISDFSRSSEYSTGSNGDTPRRKRILKTTN 810

Query: 650 AYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALH 709
           AY YWVTREQ SF+WF+ V+ E++++  ++ VIEMHN+L+SVY+EGD RSA+++++QAL+
Sbjct: 811 AYFYWVTREQGSFDWFKGVMNEVAELD-QRGVIEMHNYLTSVYEEGDARSALITMVQALN 869

Query: 710 YARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTF 769
           +A+ G+DI+S T + TH++RP+W  V +KL+ +H   RIGVFYCG  +LGKEL  LC TF
Sbjct: 870 HAKNGVDIVSGTRVRTHFARPNWKKVLTKLSSKHCNARIGVFYCGVPVLGKELSKLCNTF 929

Query: 770 SYRTNTRFVFHKEHF 784
           + + +T+F FHKEHF
Sbjct: 930 NQKGSTKFEFHKEHF 944
Calcium-dependent NADPH oxidase that generates superoxide. Generates reactive oxygen species (ROS) during incompatible interactions with pathogens and is important in the regulation of the hypersensitive response (HR). Involved in abscisic acid-induced stomatal closing and in UV-B and abscisic acid ROS-dependent signaling.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: 3EC: .EC: -
>sp|Q948U0|RBOHA_SOLTU Respiratory burst oxidase homolog protein A OS=Solanum tuberosum GN=RBOHA PE=1 SV=1 Back     alignment and function description
>sp|Q9FIJ0|RBOHD_ARATH Respiratory burst oxidase homolog protein D OS=Arabidopsis thaliana GN=RBOHD PE=1 SV=1 Back     alignment and function description
>sp|Q9SBI0|RBOHB_ARATH Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana GN=RBOHB PE=2 SV=1 Back     alignment and function description
>sp|Q948T9|RBOHB_SOLTU Respiratory burst oxidase homolog protein B OS=Solanum tuberosum GN=RBOHB PE=1 SV=1 Back     alignment and function description
>sp|Q2HXL0|RBOHC_SOLTU Respiratory burst oxidase homolog protein C OS=Solanum tuberosum GN=RBOHC PE=1 SV=2 Back     alignment and function description
>sp|Q9SW17|RBOHG_ARATH Putative respiratory burst oxidase homolog protein G OS=Arabidopsis thaliana GN=RBOHG PE=2 SV=2 Back     alignment and function description
>sp|Q5ZAJ0|RBOHB_ORYSJ Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. japonica GN=RBOHB PE=1 SV=1 Back     alignment and function description
>sp|Q6J2K5|RBOHB_ORYSI Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. indica GN=RBOHB PE=2 SV=1 Back     alignment and function description
>sp|O81211|RBOHE_ARATH Respiratory burst oxidase homolog protein E OS=Arabidopsis thaliana GN=RBOHE PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query784
356513489776 PREDICTED: respiratory burst oxidase hom 0.853 0.862 0.610 0.0
356562621778 PREDICTED: respiratory burst oxidase hom 0.854 0.861 0.604 0.0
255581371666 respiratory burst oxidase, putative [Ric 0.809 0.953 0.613 0.0
449441093745 PREDICTED: respiratory burst oxidase hom 0.849 0.893 0.560 0.0
242035135628 hypothetical protein SORBIDRAFT_01g02954 0.776 0.969 0.581 0.0
226494217624 uncharacterized protein LOC100274717 [Ze 0.769 0.966 0.572 0.0
414867668624 TPA: hypothetical protein ZEAMMB73_05965 0.769 0.966 0.572 0.0
297742252 922 unnamed protein product [Vitis vinifera] 0.872 0.741 0.494 0.0
225426128 943 PREDICTED: respiratory burst oxidase hom 0.872 0.725 0.494 0.0
302781466 895 hypothetical protein SELMODRAFT_97417 [S 0.959 0.840 0.461 0.0
>gi|356513489|ref|XP_003525446.1| PREDICTED: respiratory burst oxidase homolog protein F-like [Glycine max] Back     alignment and taxonomy information
 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/732 (61%), Positives = 549/732 (75%), Gaps = 63/732 (8%)

Query: 73  NLEWTDVEARFDRLAYTKNGTEPVIKWSDFSFCIAKLKLLLYIIVFPSNFVAMQQTPEFA 132
            +EW D+E RFD++A T++G EP + WS+F FCI                  MQ +PEFA
Sbjct: 88  GMEWKDLEKRFDQVARTESGAEPAVTWSEFGFCIG-----------------MQSSPEFA 130

Query: 133 NEILRALRGRSEWKVDITKNELRDYWHRMA-GSVDSRIQLFFYMCDRNFDGKIDEIDMKQ 191
           NE+LRALR    WK +ITK +L   W RM   S +SR+++FF MC+RN DG++ E D+KQ
Sbjct: 131 NELLRALRRGKGWKSNITKTDLYHLWFRMKDNSFNSRMRIFFDMCNRNKDGRVTETDIKQ 190

Query: 192 TILGSASANKLSMTHEEAQEYAASIMEFLDTKKRGYLEVTNPHKD--------------- 236
           TIL +AS NKLS+TH+EA++YA+ IME LD K +GY+E   P K                
Sbjct: 191 TILLTASTNKLSVTHDEAEDYASLIMESLDKKNKGYIEAHFPMKKVPAAGSSTQNVQNTS 250

Query: 237 ----DLYHEPMSKNEVRFRSYWRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLS 292
               +   EPMS+ EV FR+YWRRAWIVL WLL C  LF WKF+QY HR  F+VMGYCLS
Sbjct: 251 GDFCEEREEPMSRTEVLFRTYWRRAWIVLVWLLACLGLFVWKFVQYRHRSGFEVMGYCLS 310

Query: 293 TAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVIL 352
           TAKGAAETLKLNMAL+LLPV RNT+TWLRK R ++S+IPFNDNINFHKLIA GIVVGVIL
Sbjct: 311 TAKGAAETLKLNMALVLLPVCRNTITWLRKHRPINSVIPFNDNINFHKLIAGGIVVGVIL 370

Query: 353 HGGTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFP 412
           HGGTHLACDFPRI+  D+ +F+QT+ASGFG+ +PTY QILAT EVA+GI MV+LM IAF 
Sbjct: 371 HGGTHLACDFPRISESDKSIFRQTIASGFGYHRPTYAQILATTEVASGIGMVVLMGIAFA 430

Query: 413 LATKWARRQSTLLPRSVRHVAGYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWM 472
           LATKW RR+S +LP S+R V GYNTFWYSHHLFV VYALL +H MFLFLT+   EKTTWM
Sbjct: 431 LATKWPRRRSPVLPVSLRRVTGYNTFWYSHHLFVLVYALLIIHSMFLFLTDKLMEKTTWM 490

Query: 473 YIAVPVLLYAGERIYRVVRSGIYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQC 532
           YIA PVLLYAGERI+R +RSG YE+  L  SLYPGKVL LKMQKPEGF++ +GMY+F+QC
Sbjct: 491 YIAFPVLLYAGERIFRAIRSGSYEVDILKASLYPGKVLYLKMQKPEGFKFHSGMYIFIQC 550

Query: 533 PEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAAKGFPKVYIDGPY 592
           P+ISPFEWHPFSLTSGP +D+LSVHIR LGDW+Y++Y +FQE +L  ++G PK+YIDGPY
Sbjct: 551 PQISPFEWHPFSLTSGPQEDYLSVHIRTLGDWSYQIYDLFQEAVLSRSQGCPKLYIDGPY 610

Query: 593 GASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVCKIPKGPLKAYL 652
           G+++QD+VKYD+++LIGLGIGATPFISI++DV    Q                       
Sbjct: 611 GSAAQDHVKYDILVLIGLGIGATPFISILKDVVKGVQ----------------------- 647

Query: 653 YWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYAR 712
              T E  SF+WFRDV+ EIS    KQ V+EMHNFL+SV+ EGD RSA+LSVIQALH A+
Sbjct: 648 ---TTEPNSFDWFRDVMKEISISTKKQSVVEMHNFLTSVHPEGDIRSALLSVIQALHLAK 704

Query: 713 TGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTFSYR 772
            G DI+S+TP+ TH++RP+WFN+FS+LAR+H G +IGVFYCG   L +EL+ LCT FS +
Sbjct: 705 NGTDIVSRTPIHTHFARPNWFNIFSRLARKHGGAKIGVFYCGPSKLARELKKLCTKFSTK 764

Query: 773 TNTRFVFHKEHF 784
           T TRFVFHKE++
Sbjct: 765 TTTRFVFHKENY 776

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356562621|ref|XP_003549568.1| PREDICTED: respiratory burst oxidase homolog protein F-like [Glycine max] Back     alignment and taxonomy information
>gi|255581371|ref|XP_002531494.1| respiratory burst oxidase, putative [Ricinus communis] gi|223528881|gb|EEF30881.1| respiratory burst oxidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449441093|ref|XP_004138318.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|242035135|ref|XP_002464962.1| hypothetical protein SORBIDRAFT_01g029540 [Sorghum bicolor] gi|241918816|gb|EER91960.1| hypothetical protein SORBIDRAFT_01g029540 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|226494217|ref|NP_001142490.1| uncharacterized protein LOC100274717 [Zea mays] gi|195605032|gb|ACG24346.1| hypothetical protein [Zea mays] Back     alignment and taxonomy information
>gi|414867668|tpg|DAA46225.1| TPA: hypothetical protein ZEAMMB73_059657 [Zea mays] Back     alignment and taxonomy information
>gi|297742252|emb|CBI34401.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225426128|ref|XP_002277529.1| PREDICTED: respiratory burst oxidase homolog protein A [Vitis vinifera] Back     alignment and taxonomy information
>gi|302781466|ref|XP_002972507.1| hypothetical protein SELMODRAFT_97417 [Selaginella moellendorffii] gi|300159974|gb|EFJ26593.1| hypothetical protein SELMODRAFT_97417 [Selaginella moellendorffii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query784
TAIR|locus:2024603944 RBOH F "respiratory burst oxid 0.482 0.400 0.572 3.9e-200
TAIR|locus:2160917921 RBOHD "respiratory burst oxida 0.484 0.412 0.560 6.5e-196
TAIR|locus:2157348905 RHD2 "ROOT HAIR DEFECTIVE 2" [ 0.442 0.383 0.512 3.4e-174
UNIPROTKB|Q5ZAJ0905 RBOHB "Respiratory burst oxida 0.405 0.351 0.535 5.7e-172
TAIR|locus:2077192912 AT3G45810 [Arabidopsis thalian 0.427 0.367 0.470 2.1e-168
TAIR|locus:2183309902 RBOHA "respiratory burst oxida 0.408 0.354 0.531 2.5e-167
TAIR|locus:2128248941 AT4G11230 [Arabidopsis thalian 0.505 0.420 0.507 2.2e-164
TAIR|locus:2117258849 AT4G25090 [Arabidopsis thalian 0.670 0.619 0.489 4.6e-164
TAIR|locus:2168113886 AT5G60010 [Arabidopsis thalian 0.463 0.409 0.431 1.2e-159
TAIR|locus:2036104843 RBOHB "respiratory burst oxida 0.507 0.472 0.465 6.8e-157
TAIR|locus:2024603 RBOH F "respiratory burst oxidase protein F" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1178 (419.7 bits), Expect = 3.9e-200, Sum P(3) = 3.9e-200
 Identities = 225/393 (57%), Positives = 272/393 (69%)

Query:   254 WRRAWIVLFWLLICAVLFTWKFIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVS 313
             W+R W++  W++I   LF WKF QY  + AF VMGYCL TAKGAAETLK NMALIL PV 
Sbjct:   385 WKRIWVLSLWIMIMIGLFLWKFFQYKQKDAFHVMGYCLLTAKGAAETLKFNMALILFPVC 444

Query:   314 RNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHGGTHLACDFPRIAGCDRVLF 373
             RNT+TWLR  R LS  +PF+DNINFHK IA  IVV VILH G HLACDFPRI       +
Sbjct:   445 RNTITWLRSTR-LSYFVPFDDNINFHKTIAGAIVVAVILHIGDHLACDFPRIVRATEYDY 503

Query:   374 QQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVA 433
              + L   F  +QPTY  ++   E  TGI MVILM I+F LAT+W RR    LP+    + 
Sbjct:   504 NRYLFHYFQTKQPTYFDLVKGPEGITGILMVILMIISFTLATRWFRRNLVKLPKPFDRLT 563

Query:   434 GYNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSG 493
             G+N FWYSHHLFV VY LL +HG+FL+     + +TTWMY+AVPVLLY GER  R  RSG
Sbjct:   564 GFNAFWYSHHLFVIVYILLILHGIFLYFAKPWYVRTTWMYLAVPVLLYGGERTLRYFRSG 623

Query:   494 IYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDF 553
              Y ++ L  ++YPG VL+L+M KP  FRY++G YMFVQCP +SPFEWHPFS+TS P DD+
Sbjct:   624 SYSVRLLKVAIYPGNVLTLQMSKPTQFRYKSGQYMFVQCPAVSPFEWHPFSITSAPEDDY 683

Query:   554 LSVHIRALGDWTYRLYGIFQEE----------MLGA----AKGFPKVYIDGPYGASSQDY 599
             +S+HIR LGDWT  L  +F E           +L A     K  PK+ IDGPYGA +QDY
Sbjct:   684 ISIHIRQLGDWTQELKRVFSEVCEPPVGGKSGLLRADETTKKSLPKLLIDGPYGAPAQDY 743

Query:   600 VKYDVVLLIGLGIGATPFISIIRDVANNAQKAE 632
              KYDV+LL+GLGIGATPFISI++D+ NN  K E
Sbjct:   744 RKYDVLLLVGLGIGATPFISILKDLLNNIVKME 776
GO:0004601 "peroxidase activity" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0050664 "oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor" evidence=IEA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA;TAS
GO:0006952 "defense response" evidence=IMP
GO:0043069 "negative regulation of programmed cell death" evidence=RCA;IMP
GO:0072593 "reactive oxygen species metabolic process" evidence=IMP
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA;TAS
GO:0016174 "NAD(P)H oxidase activity" evidence=IMP;TAS
GO:0009723 "response to ethylene stimulus" evidence=RCA;IMP
GO:0010119 "regulation of stomatal movement" evidence=IMP
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA;IMP
GO:0002679 "respiratory burst involved in defense response" evidence=IMP
GO:0050832 "defense response to fungus" evidence=RCA;IMP
GO:0052542 "defense response by callose deposition" evidence=RCA;IMP
GO:0007231 "osmosensory signaling pathway" evidence=IMP
GO:0033500 "carbohydrate homeostasis" evidence=IMP
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0007154 "cell communication" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0005887 "integral to plasma membrane" evidence=IMP
TAIR|locus:2160917 RBOHD "respiratory burst oxidase homologue D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157348 RHD2 "ROOT HAIR DEFECTIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZAJ0 RBOHB "Respiratory burst oxidase homolog protein B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2077192 AT3G45810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183309 RBOHA "respiratory burst oxidase homolog A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128248 AT4G11230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117258 AT4G25090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168113 AT5G60010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036104 RBOHB "respiratory burst oxidase homolog B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.6.30.691
3rd Layer1.11.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query784
cd06186210 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NO 4e-40
pfam08030149 pfam08030, NAD_binding_6, Ferric reductase NAD bin 1e-36
pfam08022103 pfam08022, FAD_binding_8, FAD-binding domain 3e-31
PLN02844 722 PLN02844, PLN02844, oxidoreductase/ferric-chelate 1e-27
PLN02292702 PLN02292, PLN02292, ferric-chelate reductase 3e-21
PLN02631 699 PLN02631, PLN02631, ferric-chelate reductase 1e-19
cd00322223 cd00322, FNR_like, Ferredoxin reductase (FNR), an 5e-16
cd06198216 cd06198, FNR_like_3, NAD(P) binding domain of ferr 3e-15
COG4097438 COG4097, COG4097, Predicted ferric reductase [Inor 5e-10
pfam0841496 pfam08414, NADPH_Ox, Respiratory burst NADPH oxida 2e-09
pfam01794122 pfam01794, Ferric_reduct, Ferric reductase like tr 5e-09
cd06187224 cd06187, O2ase_reductase_like, The oxygenase reduc 2e-08
PRK00054250 PRK00054, PRK00054, dihydroorotate dehydrogenase e 3e-07
cd06192243 cd06192, DHOD_e_trans_like, FAD/NAD binding domain 7e-06
COG0543252 COG0543, UbiB, 2-polyprenylphenol hydroxylase and 1e-05
cd06196218 cd06196, FNR_like_1, Ferredoxin reductase-like pro 1e-05
cd06194222 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulf 3e-05
cd06221253 cd06221, sulfite_reductase_like, Anaerobic sulfite 5e-05
cd06189224 cd06189, flavin_oxioreductase, NAD(P)H dependent f 6e-05
cd06212232 cd06212, monooxygenase_like, The oxygenase reducta 9e-05
cd06211238 cd06211, phenol_2-monooxygenase_like, Phenol 2-mon 1e-04
cd06217235 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur bi 0.001
cd06220233 cd06220, DHOD_e_trans_like2, FAD/NAD binding domai 0.001
COG1018266 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NA 0.004
>gnl|CDD|99783 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide Back     alignment and domain information 
 Score =  146 bits (371), Expect = 4e-40
 Identities = 54/190 (28%), Positives = 93/190 (48%), Gaps = 23/190 (12%)

Query: 507 GKVLSLKMQKPEGFRYRAGMYMFVQCPEI-SPFEWHPFSLTSGPAD--DFLSVHIRAL-G 562
             V+ L + KP+ F+++ G ++++  P + S ++ HPF++ S P D  D LS+ IRA  G
Sbjct: 10  SDVIRLTIPKPKPFKWKPGQHVYLNFPSLLSFWQSHPFTIASSPEDEQDTLSLIIRAKKG 69

Query: 563 DWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIR 622
             T  L    +           KV ++GPYG+SS+D + YD VLL+  G G T  + I+R
Sbjct: 70  FTTRLLRKALKSPG---GGVSLKVLVEGPYGSSSEDLLSYDNVLLVAGGSGITFVLPILR 126

Query: 623 DVANNAQKAEFDQVAGSVCKIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVI 682
           D+   + K    +             +  L WV R++   EWF D +    ++   +   
Sbjct: 127 DLLRRSSKTSRTR-------------RVKLVWVVRDREDLEWFLDELRAAQEL---EVDG 170

Query: 683 EMHNFLSSVY 692
           E+  +++ V 
Sbjct: 171 EIEIYVTRVV 180

ROS were originally identified as bactericidal agents in phagocytes, but are now also implicated in cell signaling and metabolism. NOX has a 6-alpha helix heme-binding transmembrane domain fused to a flavoprotein with the nucleotide binding domain located in the cytoplasm. Duox enzymes link a peroxidase domain to the NOX domain via a single transmembrane and EF-hand Ca2+ binding sites. The flavoprotein module has a ferredoxin like FAD/NADPH binding domain. In classical phagocytic NOX2, electron transfer occurs from NADPH to FAD to the heme of cytb to oxygen leading to superoxide formation. Length = 210
>gnl|CDD|203841 pfam08030, NAD_binding_6, Ferric reductase NAD binding domain Back     alignment and domain information
>gnl|CDD|219702 pfam08022, FAD_binding_8, FAD-binding domain Back     alignment and domain information
>gnl|CDD|215453 PLN02844, PLN02844, oxidoreductase/ferric-chelate reductase Back     alignment and domain information
>gnl|CDD|215165 PLN02292, PLN02292, ferric-chelate reductase Back     alignment and domain information
>gnl|CDD|178238 PLN02631, PLN02631, ferric-chelate reductase Back     alignment and domain information
>gnl|CDD|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>gnl|CDD|99795 cd06198, FNR_like_3, NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>gnl|CDD|226582 COG4097, COG4097, Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|203934 pfam08414, NADPH_Ox, Respiratory burst NADPH oxidase Back     alignment and domain information
>gnl|CDD|216705 pfam01794, Ferric_reduct, Ferric reductase like transmembrane component Back     alignment and domain information
>gnl|CDD|99784 cd06187, O2ase_reductase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>gnl|CDD|234601 PRK00054, PRK00054, dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>gnl|CDD|99789 cd06192, DHOD_e_trans_like, FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>gnl|CDD|223617 COG0543, UbiB, 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|99793 cd06196, FNR_like_1, Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>gnl|CDD|99791 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99817 cd06221, sulfite_reductase_like, Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>gnl|CDD|99808 cd06212, monooxygenase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>gnl|CDD|99807 cd06211, phenol_2-monooxygenase_like, Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>gnl|CDD|99813 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99816 cd06220, DHOD_e_trans_like2, FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>gnl|CDD|223949 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 784
KOG0039646 consensus Ferric reductase, NADH/NADPH oxidase and 100.0
PLN02631 699 ferric-chelate reductase 100.0
PLN02844722 oxidoreductase/ferric-chelate reductase 100.0
PLN02292702 ferric-chelate reductase 100.0
COG4097438 Predicted ferric reductase [Inorganic ion transpor 100.0
cd06186210 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyz 100.0
PRK08051232 fre FMN reductase; Validated 99.96
cd06189224 flavin_oxioreductase NAD(P)H dependent flavin oxid 99.96
cd06216243 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferr 99.96
cd06195241 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-c 99.96
cd06184247 flavohem_like_fad_nad_binding FAD_NAD(P)H binding 99.96
cd06210236 MMO_FAD_NAD_binding Methane monooxygenase (MMO) re 99.96
cd06212232 monooxygenase_like The oxygenase reductase FAD/NAD 99.96
cd06213227 oxygenase_e_transfer_subunit The oxygenase reducta 99.96
cd06190232 T4MO_e_transfer_like Toluene-4-monoxygenase electr 99.96
cd06211238 phenol_2-monooxygenase_like Phenol 2-monooxygenase 99.96
cd06209228 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenD 99.96
cd06191231 FNR_iron_sulfur_binding Iron-sulfur binding Ferred 99.96
cd06215231 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferr 99.96
cd06194222 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding 99.96
cd06198216 FNR_like_3 NAD(P) binding domain of ferredoxin red 99.96
cd06197220 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin 99.96
cd06217235 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferr 99.96
cd06188283 NADH_quinone_reductase Na+-translocating NADH:quin 99.96
cd06187224 O2ase_reductase_like The oxygenase reductase FAD/N 99.95
cd06214241 PA_degradation_oxidoreductase_like NAD(P) binding 99.95
TIGR02160 352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.95
cd00322223 FNR_like Ferredoxin reductase (FNR), an FAD and NA 99.95
PRK07609339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.95
PRK11872340 antC anthranilate dioxygenase reductase; Provision 99.95
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.95
cd06196218 FNR_like_1 Ferredoxin reductase-like proteins cata 99.95
PRK13289399 bifunctional nitric oxide dioxygenase/dihydropteri 99.95
PRK10926248 ferredoxin-NADP reductase; Provisional 99.94
PRK05713312 hypothetical protein; Provisional 99.94
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 99.94
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase 99.94
cd06183234 cyt_b5_reduct_like Cytochrome b5 reductase catalyz 99.94
COG1018266 Hmp Flavodoxin reductases (ferredoxin-NADPH reduct 99.94
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 99.94
PLN03116307 ferredoxin--NADP+ reductase; Provisional 99.93
PRK05464409 Na(+)-translocating NADH-quinone reductase subunit 99.93
cd06185211 PDR_like Phthalate dioxygenase reductase (PDR) is 99.93
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 99.93
cd06208286 CYPOR_like_FNR These ferredoxin reductases are rel 99.93
TIGR01941405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.93
PRK08221263 anaerobic sulfite reductase subunit B; Provisional 99.93
PTZ00274325 cytochrome b5 reductase; Provisional 99.93
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 99.92
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron 99.92
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 99.92
TIGR02911261 sulfite_red_B sulfite reductase, subunit B. Member 99.92
PLN03115367 ferredoxin--NADP(+) reductase; Provisional 99.92
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 99.92
KOG0534286 consensus NADH-cytochrome b-5 reductase [Coenzyme 99.91
PRK05802320 hypothetical protein; Provisional 99.91
cd06182267 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) 99.91
PTZ00319300 NADH-cytochrome B5 reductase; Provisional 99.91
cd06200245 SiR_like1 Cytochrome p450- like alpha subunits of 99.91
TIGR03224411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 99.9
cd06201289 SiR_like2 Cytochrome p450- like alpha subunits of 99.9
PF08030156 NAD_binding_6: Ferric reductase NAD binding domain 99.89
PLN02252888 nitrate reductase [NADPH] 99.89
COG0543252 UbiB 2-polyprenylphenol hydroxylase and related fl 99.89
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.86
cd06193235 siderophore_interacting Siderophore interacting pr 99.85
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 99.84
PTZ003061167 NADH-dependent fumarate reductase; Provisional 99.83
PRK12779944 putative bifunctional glutamate synthase subunit b 99.83
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.8
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.8
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.78
PF08022105 FAD_binding_8: FAD-binding domain; InterPro: IPR01 99.78
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.74
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.74
cd06199360 SiR Cytochrome p450- like alpha subunits of E. col 99.73
cd06206384 bifunctional_CYPOR These bifunctional proteins fus 99.72
cd06207382 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) 99.71
TIGR01931597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 99.7
cd06203398 methionine_synthase_red Human methionine synthase 99.63
PTZ00184149 calmodulin; Provisional 99.63
COG2871410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.62
cd06204416 CYPOR NADPH cytochrome p450 reductase (CYPOR) serv 99.61
PRK06214530 sulfite reductase; Provisional 99.61
PTZ00183158 centrin; Provisional 99.6
cd06202406 Nitric_oxide_synthase The ferredoxin-reductase (FN 99.6
PRK10953600 cysJ sulfite reductase subunit alpha; Provisional 99.58
KOG0038189 consensus Ca2+-binding kinase interacting protein 99.55
PF01794125 Ferric_reduct: Ferric reductase like transmembrane 99.5
PF00175109 NAD_binding_1: Oxidoreductase NAD-binding domain ; 99.44
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.42
KOG0036463 consensus Predicted mitochondrial carrier protein 99.28
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 99.28
KOG3378385 consensus Globins and related hemoproteins [Energy 99.24
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.23
PF0097099 FAD_binding_6: Oxidoreductase FAD-binding domain; 99.21
COG0369587 CysJ Sulfite reductase, alpha subunit (flavoprotei 99.18
PLN02964644 phosphatidylserine decarboxylase 99.18
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.18
PRK065671028 putative bifunctional glutamate synthase subunit b 99.14
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.13
KOG1158645 consensus NADP/FAD dependent oxidoreductase [Energ 99.1
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.08
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.99
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 98.98
PTZ00183158 centrin; Provisional 98.94
PTZ00184149 calmodulin; Provisional 98.82
KOG1159574 consensus NADP-dependent flavoprotein reductase [E 98.75
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 98.73
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 98.72
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.72
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 98.71
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.57
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.54
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 98.48
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.48
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.41
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.39
KOG0751694 consensus Mitochondrial aspartate/glutamate carrie 98.37
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.36
KOG0377631 consensus Protein serine/threonine phosphatase RDG 98.36
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.35
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.34
PF08414100 NADPH_Ox: Respiratory burst NADPH oxidase; InterPr 98.33
PLN02964644 phosphatidylserine decarboxylase 98.3
KOG0036463 consensus Predicted mitochondrial carrier protein 98.27
cd0005267 EH Eps15 homology domain; found in proteins implic 98.27
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.27
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 98.27
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.24
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.24
KOG4666412 consensus Predicted phosphate acyltransferase, con 98.2
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.19
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.18
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.18
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.16
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.15
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.13
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.13
PRK05419205 putative sulfite oxidase subunit YedZ; Reviewed 98.1
cd0005267 EH Eps15 homology domain; found in proteins implic 98.07
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.03
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 98.03
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 97.99
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.97
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.95
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.95
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.93
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.88
KOG4251362 consensus Calcium binding protein [General functio 97.78
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.78
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.77
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.71
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.71
COG2717209 Predicted membrane protein [Function unknown] 97.65
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.61
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 97.61
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.57
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 97.52
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.48
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 97.47
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.45
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.27
PF1465866 EF-hand_9: EF-hand domain 97.23
COG2375265 ViuB Siderophore-interacting protein [Inorganic io 97.2
KOG0038189 consensus Ca2+-binding kinase interacting protein 97.17
KOG4251362 consensus Calcium binding protein [General functio 97.13
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.12
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 97.12
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 96.9
KOG4065144 consensus Uncharacterized conserved protein [Funct 96.89
KOG0377631 consensus Protein serine/threonine phosphatase RDG 96.87
PF1465866 EF-hand_9: EF-hand domain 96.86
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 96.79
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 96.63
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.25
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.03
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 95.88
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.73
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 95.73
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 95.71
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.61
KOG0039646 consensus Ferric reductase, NADH/NADPH oxidase and 95.59
KOG4347671 consensus GTPase-activating protein VRP [General f 95.57
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 95.22
PF08021117 FAD_binding_9: Siderophore-interacting FAD-binding 95.09
KOG0751694 consensus Mitochondrial aspartate/glutamate carrie 95.08
KOG0046627 consensus Ca2+-binding actin-bundling protein (fim 94.9
KOG0046627 consensus Ca2+-binding actin-bundling protein (fim 94.86
KOG0169746 consensus Phosphoinositide-specific phospholipase 94.84
KOG4666412 consensus Predicted phosphate acyltransferase, con 94.78
KOG4065144 consensus Uncharacterized conserved protein [Funct 94.64
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 94.61
KOG3866442 consensus DNA-binding protein of the nucleobindin 93.28
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 91.83
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 88.65
KOG0035890 consensus Ca2+-binding actin-bundling protein (act 87.86
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 86.59
KOG3555434 consensus Ca2+-binding proteoglycan Testican [Gene 86.08
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 85.99
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 85.07
PLN02952599 phosphoinositide phospholipase C 84.84
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 80.69
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 80.42
>KOG0039 consensus Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=1e-80  Score=717.65  Aligned_cols=608  Identities=45%  Similarity=0.778  Sum_probs=527.1

Q ss_pred             ccccHHHHHHHHHHhc-CCHHHHHHHHHHHhccCCCCcccHHHHHHHHhhhhccCCCCCChHHHHHHHHHHHHHcCCCCC
Q 047110          147 VDITKNELRDYWHRMA-GSVDSRIQLFFYMCDRNFDGKIDEIDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTKKR  225 (784)
Q Consensus       147 g~I~f~ef~~~~~~~~-~~~~~~l~~aF~~~D~dgdG~Is~~El~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~D~d~d  225 (784)
                      + |+++||.     .. .+.|++++.+|+++|. +||.++.+|+..++......+.....+++..++...++++.|.++.
T Consensus         3 ~-~~~~~~~-----~~~~~~d~~l~~~f~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   75 (646)
T KOG0039|consen    3 G-ISFQELK-----ITDCSYDDKLQTFFDMYDK-GDGKLTEEEVRELIMSSISANWLSLIKKQTEEYAALIMEELDPDHK   75 (646)
T ss_pred             C-cchhhhc-----ccCCChhHHHHHHHHHHhh-hcCCccHHHHHHHHHHHHHhhhhhhhhhhhhHHHHHhhhhcccccc
Confidence            7 9999998     33 7899999999999999 9999999999999987665555666688899999999999999999


Q ss_pred             CcccccCCCC---------------C----------------CCCCcccchhhHhhhccceeeehhHHHHHHHHHHHHHH
Q 047110          226 GYLEVTNPHK---------------D----------------DLYHEPMSKNEVRFRSYWRRAWIVLFWLLICAVLFTWK  274 (784)
Q Consensus       226 G~i~~~eF~~---------------~----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~nv~l~~~~  274 (784)
                      |++.++++..               .                .+..+...+...+++++|++.+.+++|+.++++++.|+
T Consensus        76 ~y~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~lf~~~  155 (646)
T KOG0039|consen   76 GYITNEDLEILLLQIPTLLFAILLSFANLSLLLSQPLKPTRRKPLLRNLVRMGAFLPNLWLRVWVLFLWLGLNVGLFTWR  155 (646)
T ss_pred             ceeeecchhHHHHhchHHHHHHHHHHHHHHhhhccccccccccccchheeeeeeeeccceEeeeeehHHHHHHHHHHHHH
Confidence            9999888762               0                01224455567789999999999999999999999999


Q ss_pred             HHhccCcchhhhhcchhhhcchhhhhhhhHhHHHHHHhhhhhhhhhcccccccccccCchhhhHHHHHHHHHHHHHHHHH
Q 047110          275 FIQYSHRPAFQVMGYCLSTAKGAAETLKLNMALILLPVSRNTVTWLRKKRWLSSIIPFNDNINFHKLIACGIVVGVILHG  354 (784)
Q Consensus       275 ~~~~~~~~~~~~~g~~~~~ar~~~~~~~~n~~ll~l~~~Rn~l~~L~~~~~l~~~~~~d~~~~~Hr~~g~~~~~~~~vH~  354 (784)
                      +..|.......++|++++.+++.+..+++|+.++++++|||.++||++.+++..++|+|+.+.||+.+|........+|.
T Consensus       156 ~~~y~~~~~~~~~g~~~~~~~~~~~~l~~~~~~ill~~~R~~~~~L~~~~fl~~~~p~~~n~~fh~l~g~~~~~~~~~H~  235 (646)
T KOG0039|consen  156 FLQYVYLGTRHILGLCLALARGSAETLNFNMALILLPVCRNRLTFLRCSTFLFSYLPFDRNLNFHKLVALTIAVFILLHI  235 (646)
T ss_pred             HHHHHhhhhhhhhhheeeeeccccccchhhHHHHHHHHHHHHHHHHHHhhhhheEeeccccchHHHHHHHHHHHHHHHHH
Confidence            99988777888899999999999999999999999999999999999658888889999999999999999999999999


Q ss_pred             hhhhccccceeeecchhhHHHHhhhccCCCCCceeeeccchhhHHHHHHHHHHHHHHHhhcHHHHhhccCCCcccccccc
Q 047110          355 GTHLACDFPRIAGCDRVLFQQTLASGFGHQQPTYMQILATKEVATGIAMVILMAIAFPLATKWARRQSTLLPRSVRHVAG  434 (784)
Q Consensus       355 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~tG~~~lv~l~i~~~~S~~~iRr~~~~~~~~~~~~~~  434 (784)
                      ++|.++.+..+++.............+  ..+.++++..+..+++|+++++++++|+++|++++||+.            
T Consensus       236 w~~~~~~~~~~ih~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~tGv~~~i~~~im~v~s~~~fRR~~------------  301 (646)
T KOG0039|consen  236 WLHLVNFFPFLVHGLEYTISLASELFF--LPKTYKWLLLGVVGLTGVILLILMLIMFVLSLPFFRRRF------------  301 (646)
T ss_pred             HHHHHHHHHHHHhhhHHHHHHHHHhcc--cchhhhhhhcCCCcchhHHHHHHHHHHHHHhhHHHHHHH------------
Confidence            999877665555432221111111112  134556677788899999999999999999999999998            


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhhhhhccCCCcccceeeeeeheeeeehhhhhhheeeeeeeEEEEEeEeeCCCEEEEEE
Q 047110          435 YNTFWYSHHLFVFVYALLFVHGMFLFLTNNPFEKTTWMYIAVPVLLYAGERIYRVVRSGIYEIKNLTPSLYPGKVLSLKM  514 (784)
Q Consensus       435 Ye~F~~~H~l~~~~~v~~~~H~~~~~~~~~~~~~~~w~~~~~~~~i~~~~r~~r~~r~~~~~~~v~~~~~~~~~v~~l~l  514 (784)
                      ||.||++|++++++|+++++|+......      .+|+|+++|+.+|++||++|..|. ..+++++++..+++++++|++
T Consensus       302 ~e~F~ytH~l~~v~~illi~hg~~~~~~------~~w~~~~~p~~ly~~dR~~r~~r~-~~~~~i~~~~llp~~vi~L~~  374 (646)
T KOG0039|consen  302 YEAFWYTHHLYIVFYILLIIHGGFRLLG------TTWMYIAVPVLLYILDRILRFLRS-QKNVKIAKVVLLPSDVLELIM  374 (646)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcccccc------cchhHHHHHHHHHHHHHHHHHHHH-hcCceEEEEEEcCCCeEEEEE
Confidence            9999999999999999999998754332      689999988999999999999888 477999999999999999999


Q ss_pred             ecCCCceecCCcEEEEecCCCCCCcccccccccCCCCCeEEEEEEecCCccHHHHHHHHHhhhccC----CCCCEEEEeC
Q 047110          515 QKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDFLSVHIRALGDWTYRLYGIFQEEMLGAA----KGFPKVYIDG  590 (784)
Q Consensus       515 ~~p~~~~~~pGQ~v~l~~p~~~~~~~HPFTIaS~p~~~~l~l~Ir~~g~~T~~L~~~~~~~~~~~~----~~~~~v~i~G  590 (784)
                      ++|+.++|+||||++|++|.++.+|||||||+|+|+|++++++||+.||||++|++.+++.+.++.    ....++.|||
T Consensus       375 ~Kp~~f~y~~Gqyifv~~p~ls~~qwHPFTItSsp~dd~lsvhIk~~g~wT~~L~~~~~~~~~~~~~~~~~~~~~i~IdG  454 (646)
T KOG0039|consen  375 SKPPGFKYKPGQYIFVNCPSLSKLEWHPFTITSAPEDDFLSVHIKALGDWTEKLRNAFSEVSQPPESDKSYPFPKILIDG  454 (646)
T ss_pred             eCCCCCCCCCCCEEEEECccccccccCCceeecCCCCCEEEEEEEecCcHHHHHHHHHhhhcccccccccccCceEEEEC
Confidence            999999999999999999999999999999999999999999999999999999999885332211    1378999999


Q ss_pred             CCCCCCCCCCCCCeEEEEEcCCCHHHHHHHHHHHHHHhhhhhcccccccccCCCCCccEEEEEEEecCCCcHHHHHHHHH
Q 047110          591 PYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVCKIPKGPLKAYLYWVTREQISFEWFRDVIT  670 (784)
Q Consensus       591 PyG~~~~~~~~~~~vvlIagG~GItp~lsil~~l~~~~~~~~~~~~~~~~~~~~~~~~~v~liW~~R~~~~~~~~~~~L~  670 (784)
                      |||.+..+..++++++|||||+|+||++|++++++.+.+.++..++ .+........++++++|.+|+..+++||.+.+.
T Consensus       455 PYG~~s~d~~~~e~~vLV~~GiGvtPf~sil~~l~~~~~~~~~~~~-~~~~~~~~~~~~~~F~Wv~~~~~sf~wf~~~l~  533 (646)
T KOG0039|consen  455 PYGAPSQDVFKYEVLVLVGGGIGVTPFASILKDLLNKISLGRTKAP-TSDYSDSLKLKKVYFYWVTREQRSFEWFKGLLT  533 (646)
T ss_pred             CCCCCchhhhhcceEEEEccCcccCccHHHHHHHHhhccCCCCcCc-cccccccceecceeEEEEeccccchHHHHHHHH
Confidence            9999998999999999999999999999999999998765432111 111223446789999999999999999999999


Q ss_pred             HHHHhcCCCCcEEEEEEEecCCCCCCchhhHHHHHHHhhhhccCccccCCCCceeeecCCChHHHHHHHHHhCCCCeEEE
Q 047110          671 EISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGV  750 (784)
Q Consensus       671 ~l~~~~~~~~~l~v~i~vT~~~~~~d~~~~~~~~~~~~~~~~~~~d~~~g~~~~~~~GRPd~~~i~~~~~~~~~~~~~~V  750 (784)
                      ++.+.+ ..+.+++++|+|+...+.|.++.++.+.|.+.+.+++.|+.+|++...+.|||||+++++++++.++..+++|
T Consensus       534 ~v~~~~-~~~~~e~~~~~t~~~~~~d~~~~~~~~~~~~~~~~~~~di~~g~~~~~~~gRPn~~~~~~~~~~~~~~~~vgV  612 (646)
T KOG0039|consen  534 EVEEYD-SSGVIELHNYVTSSYEEGDARSALIQMVQKLLHAKNGVDIVTGLKVETHFGRPNWKEVFKEIAKSHPNVRVGV  612 (646)
T ss_pred             HHHHHH-hcCCchhheehhHhHhhhhhhhHHHHHHHhhcccccCccccccceeeeeCCCCCHHHHHHHHHhhCCCceEEE
Confidence            999877 4456899999999988889888888889999888899999999999999999999999999999998777999


Q ss_pred             EEeCChhHHHHHHHHHHhcccCCCceEEEEeeCC
Q 047110          751 FYCGSLLLGKELEGLCTTFSYRTNTRFVFHKEHF  784 (784)
Q Consensus       751 ~vCGP~~m~~~v~~~~~~~~~~~~~~~~~~~E~F  784 (784)
                      ++|||++|.+++++.|.+.+.+..+.++||+|+|
T Consensus       613 f~CGp~~l~~~~~~~~~~~~~~~~~~~~f~~E~F  646 (646)
T KOG0039|consen  613 FSCGPPGLVKELRKLCNDFSSSTATRFEFHKENF  646 (646)
T ss_pred             EEeCCHHHHHHHHHHHHhcccccCceeeeeeccC
Confidence            9999999999999999998877778999999998

>PLN02631 ferric-chelate reductase Back     alignment and domain information
>PLN02844 oxidoreductase/ferric-chelate reductase Back     alignment and domain information
>PLN02292 ferric-chelate reductase Back     alignment and domain information
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide Back     alignment and domain information
>PRK08051 fre FMN reductase; Validated Back     alignment and domain information
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin Back     alignment and domain information
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system Back     alignment and domain information
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain Back     alignment and domain information
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins Back     alignment and domain information
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain Back     alignment and domain information
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional Back     alignment and domain information
>PRK10926 ferredoxin-NADP reductase; Provisional Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information
>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>PLN03116 ferredoxin--NADP+ reductase; Provisional Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PRK08221 anaerobic sulfite reductase subunit B; Provisional Back     alignment and domain information
>PTZ00274 cytochrome b5 reductase; Provisional Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B Back     alignment and domain information
>PLN03115 ferredoxin--NADP(+) reductase; Provisional Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>KOG0534 consensus NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>PTZ00319 NADH-cytochrome B5 reductase; Provisional Back     alignment and domain information
>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>PF08030 NAD_binding_6: Ferric reductase NAD binding domain; InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins Back     alignment and domain information
>PLN02252 nitrate reductase [NADPH] Back     alignment and domain information
>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>PF08022 FAD_binding_8: FAD-binding domain; InterPro: IPR013112 This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245 Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd06199 SiR Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) Back     alignment and domain information
>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>PRK06214 sulfite reductase; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>PF01794 Ferric_reduct: Ferric reductase like transmembrane component; InterPro: IPR013130 This family includes a common region in the transmembrane proteins mammalian cytochrome b-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from Arabidopsis thaliana Back     alignment and domain information
>PF00175 NAD_binding_1: Oxidoreductase NAD-binding domain ; InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG3378 consensus Globins and related hemoproteins [Energy production and conversion] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF00970 FAD_binding_6: Oxidoreductase FAD-binding domain; InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain Back     alignment and domain information
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG1158 consensus NADP/FAD dependent oxidoreductase [Energy production and conversion] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG1159 consensus NADP-dependent flavoprotein reductase [Energy production and conversion] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF08414 NADPH_Ox: Respiratory burst NADPH oxidase; InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PRK05419 putative sulfite oxidase subunit YedZ; Reviewed Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>COG2717 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>COG2375 ViuB Siderophore-interacting protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0039 consensus Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4347 consensus GTPase-activating protein VRP [General function prediction only] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF08021 FAD_binding_9: Siderophore-interacting FAD-binding domain; InterPro: IPR013113 Proteins in this entry are siderophore-interacting FAD-binding proteins Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query784
3a1f_A186 The Crystal Structure Of Nadph Binding Domain Of Gp 2e-22
3a8r_A179 The Structure Of The N-Terminal Regulatory Domain O 4e-17
>pdb|3A1F|A Chain A, The Crystal Structure Of Nadph Binding Domain Of Gp91(Phox) Length = 186 Back     alignment and structure 
Iteration: 1

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 104/211 (49%), Gaps = 37/211 (17%)
Query: 586 VYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDV----ANNAQKAEFDQVAGSVC 641
           + +DGP+G +S+D   Y+VV+L+G GIG TPF SI++ V     NNA   +  ++     
Sbjct: 1   IAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKI----- 55
Query: 642 KIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHN--FLS-SVYQEGDGR 698
                    Y YW+ R+  +FEWF D++       L+  + E +N  FLS ++Y  G   
Sbjct: 56  ---------YFYWLCRDTHAFEWFADLLQ-----LLESQMQERNNAGFLSYNIYLTGWDE 101
Query: 699 SAILSVIQALHYA---RTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCG- 754
           S      QA H+A       D+I+     T Y RP+W N F  +A +HP  RIGVF CG 
Sbjct: 102 S------QANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGP 155
Query: 755 -SXXXXXXXXXXCTTFSYRTNTRFVFHKEHF 784
            +            + S      F+F+KE+F
Sbjct: 156 EALAETLSKQSISNSESGPRGVHFIFNKENF 186
>pdb|3A8R|A Chain A, The Structure Of The N-Terminal Regulatory Domain Of A Plant Nadph Oxidase Length = 179 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query784
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi 5e-45
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 1e-36
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 3e-10
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2bgi_A272 Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi 6e-08
1tvc_A250 Methane monooxygenase component C, methane monooxy 4e-07
2qdx_A257 Ferredoxin reductase; oxidoreductase; HET: FAD; 1. 4e-07
4fk8_A271 Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st 9e-06
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, 2e-05
1gvh_A396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 6e-05
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 4e-04
1cqx_A403 Flavohemoprotein; globin fold, six-stranded antipa 8e-04
>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Length = 186 Back     alignment and structure
 Score =  159 bits (402), Expect = 5e-45
 Identities = 58/204 (28%), Positives = 92/204 (45%), Gaps = 23/204 (11%)

Query: 586 VYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVCKIPK 645
           + +DGP+G +S+D   Y+VV+L+G GIG TPF SI++ V                     
Sbjct: 1   IAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCN----------NATNL 50

Query: 646 GPLKAYLYWVTREQISFEWFRDVITEISKIYLKQP---VIEMHNFLSSVYQEGDGRSAIL 702
              K Y YW+ R+  +FEWF D++  +     ++     +  + +L+   +         
Sbjct: 51  KLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQA------ 104

Query: 703 SVIQALHYARTGIDIISKTPMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKEL 762
                  +     D+I+     T Y RP+W N F  +A +HP  RIGVF CG   L + L
Sbjct: 105 --NHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETL 162

Query: 763 EGLCTTFSY--RTNTRFVFHKEHF 784
                + S        F+F+KE+F
Sbjct: 163 SKQSISNSESGPRGVHFIFNKENF 186
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Length = 232 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Length = 272 Back     alignment and structure
>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Length = 250 Back     alignment and structure
>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Length = 257 Back     alignment and structure
>4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Length = 271 Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Length = 290 Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Length = 396 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Length = 403 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query784
4eh1_A243 Flavohemoprotein; structural genomics, niaid, nati 99.97
1tvc_A250 Methane monooxygenase component C, methane monooxy 99.96
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin 99.96
4fk8_A271 Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st 99.96
3vo2_A310 Putative uncharacterized protein; rossmann fold, o 99.96
3lo8_A311 Ferredoxin--NADP reductase; electron transport, ox 99.96
3jqq_A316 Ferredoxin NADP reductase; FAD, oxidoreductase; HE 99.96
1fdr_A248 Flavodoxin reductase; ferredoxin reductase, flavin 99.96
4g1v_A399 Flavohemoglobin; three domains: globin fold, antip 99.95
2qdx_A257 Ferredoxin reductase; oxidoreductase; HET: FAD; 1. 99.95
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, 99.95
2eix_A243 NADH-cytochrome B5 reductase; flavoprotein, FAD-bi 99.95
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.95
2bgi_A272 Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi 99.95
1cqx_A403 Flavohemoprotein; globin fold, six-stranded antipa 99.95
1gvh_A396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 99.95
2bmw_A304 Ferredoxin--NADP reductase; oxidoreductase, flavop 99.94
1fnb_A314 Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( 99.94
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.94
1umk_A275 B5R, NADH-cytochrome B5 reductase; flavoprotein, b 99.94
2b5o_A402 FNR, ferredoxin--NADP reductase; complex with FAD, 99.94
2cnd_A270 NADH-dependent nitrate reductase; nitrate assimila 99.93
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); het 99.93
2rc5_A314 Ferredoxin-NADP reductase; FAD, oxidoreductase; HE 99.93
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi 99.92
2gpj_A252 Siderophore-interacting protein; structural genomi 99.84
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.81
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.81
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.8
1ddg_A374 Sulfite reductase (NADPH) flavoprotein alpha- comp 99.8
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.79
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.79
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.78
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.76
4dql_A393 Bifunctional P-450/NADPH-P450 reductase; rossmann 99.76
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.75
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.74
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.74
3fwb_A161 Cell division control protein 31; gene gating, com 99.74
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.74
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.74
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.74
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.73
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.73
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.73
1f20_A435 Nitric-oxide synthase; nitric-xoide synthase, redu 99.73
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.73
1tll_A688 Nitric-oxide synthase, brain; reductase module, FM 99.73
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.72
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.72
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.71
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.71
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.71
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.71
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.71
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.7
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.7
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.7
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.7
2qtl_A539 MSR;, methionine synthase reductase; alpha-beta-al 99.7
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.7
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.7
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.69
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.69
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.69
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.69
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.69
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.68
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.68
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.68
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.68
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.68
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.68
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.67
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.67
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.67
2bpo_A682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 99.67
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.66
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.66
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.66
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.66
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.66
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.66
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.66
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.66
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.66
1y1x_A191 Leishmania major homolog of programmed cell death 99.66
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.65
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.65
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.65
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.65
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.65
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.65
3qfs_A458 CPR, P450R, NADPH--cytochrome P450 reductase; flav 99.65
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.64
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.64
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.64
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.64
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.64
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.64
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.64
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.64
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.63
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.63
3qe2_A618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 99.63
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.62
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.61
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.61
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.61
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.61
3lrx_A158 Putative hydrogenase; alpha-beta protein, structur 99.6
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.59
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.59
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.58
3lyu_A142 Putative hydrogenase; the C-terminal has AN alpha- 99.58
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.57
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.56
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.56
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.54
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.54
1y1x_A191 Leishmania major homolog of programmed cell death 99.54
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.53
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.49
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.46
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.46
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.44
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.41
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.4
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.39
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.39
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.39
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.39
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.39
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.38
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.38
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.37
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.36
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.36
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.35
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.34
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.34
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.34
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.33
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.33
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.32
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.3
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.29
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.27
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.26
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.26
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.22
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.21
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.21
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.2
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.2
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.18
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.18
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.18
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.18
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.16
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.15
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.14
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.14
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.14
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.14
3fwb_A161 Cell division control protein 31; gene gating, com 99.13
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.13
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.13
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.12
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.12
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.12
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.11
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.11
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.11
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.1
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.1
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.08
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.08
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.08
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.07
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.07
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.07
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.06
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.06
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.06
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.06
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.06
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.06
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.05
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.04
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.03
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.03
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.03
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.02
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.01
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.0
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.99
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.99
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.99
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.98
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.98
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.97
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.97
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.97
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.97
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.97
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.96
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.96
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.96
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.96
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.95
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.95
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.94
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.93
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.93
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.93
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.92
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.92
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.92
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.91
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.9
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.89
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.88
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.88
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.88
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.87
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.87
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.87
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.85
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.84
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.83
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.83
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.83
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.83
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.82
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.82
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.82
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.82
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.8
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.8
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.8
1c07_A95 Protein (epidermal growth factor receptor pathway 98.79
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.77
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.77
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.77
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.75
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.74
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.74
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.73
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.73
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.72
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.72
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.7
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.7
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.68
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.68
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.66
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.66
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.65
3li6_A66 Calcium-binding protein; calcium signaling protein 98.65
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.63
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.63
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.63
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.63
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.61
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.61
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.61
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.6
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.59
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.59
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.59
3li6_A66 Calcium-binding protein; calcium signaling protein 98.58
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.57
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.57
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.56
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.56
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.56
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.56
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.56
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.55
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.54
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.54
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.54
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.54
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.53
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.52
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.52
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.52
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.52
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.51
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 98.5
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.5
1c07_A95 Protein (epidermal growth factor receptor pathway 98.5
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.49
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.49
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.48
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.48
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.47
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.47
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.46
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.46
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.45
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.45
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.45
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.45
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.44
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.43
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.43
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.42
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.41
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.4
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.39
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.39
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.39
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.39
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.38
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.38
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.37
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.37
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.37
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.36
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.33
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.32
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.31
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.31
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.3
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.24
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.24
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.23
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.21
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.18
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.16
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.14
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.13
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.12
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.11
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.11
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.1
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.07
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.01
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.97
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.94
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.93
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 97.89
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.79
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.77
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.52
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.25
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.14
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 96.92
1nub_A229 Basement membrane protein BM-40; extracellular mod 95.49
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 91.25
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 90.89
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 87.9
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 87.54
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 87.12
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 86.65
3ul4_B65 Cellulosome enzyme, dockerin type I; cohesin, type 85.81
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 83.06
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 82.83
2jrf_A184 Tubulin polymerization-promoting protein family me 82.04
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 81.81
4gba_A221 DCN1-like protein 3; E3 ligase, ligase-peptide com 80.02
>4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
Probab=99.97  E-value=1.6e-29  Score=261.61  Aligned_cols=221  Identities=14%  Similarity=0.124  Sum_probs=175.8

Q ss_pred             eeeEEEEEeEeeCCCEEEEEEecCC---CceecCCcEEEEecCCCCC--CcccccccccCCCCCeEEEEEEec-------
Q 047110          494 IYEIKNLTPSLYPGKVLSLKMQKPE---GFRYRAGMYMFVQCPEISP--FEWHPFSLTSGPADDFLSVHIRAL-------  561 (784)
Q Consensus       494 ~~~~~v~~~~~~~~~v~~l~l~~p~---~~~~~pGQ~v~l~~p~~~~--~~~HPFTIaS~p~~~~l~l~Ir~~-------  561 (784)
                      +.+++|++++.+++++.+++|..|.   ...|+||||++|.+|..+.  .++|||||+|.|+++.++|+||..       
T Consensus         3 ~~~~~V~~~~~~~~~~~~~~l~~~~~~~~~~~~pGq~v~l~~~~~~~~~~~~R~ySi~s~~~~~~~~i~vk~~~~~~~~~   82 (243)
T 4eh1_A            3 GRTFVVREKQVESAYVTSFVLVPADGGAVLDYQPGQYIGIEVTPEGSDYREIRQYSLSHASNGREYRISVKREGVGSDNP   82 (243)
T ss_dssp             CEEEEEEEEEECSSSEEEEEEEESSCSCCCCCCTTCEEEEEECCSSCSSCEEEEEEBCSCCCSSCEEEEEECTTTTSSSC
T ss_pred             cEEEEEEEEEEcCCCeEEEEEEeCCCCcCCCcCCCCEEEEEEecCCCccccceeeEeccCCCCCeEEEEEEEeecCCCCC
Confidence            4678899999999999999999765   3679999999999986543  378999999999889999999998       


Q ss_pred             CCccHHHHHHHHHhhhccCCCCCEEEEeCCCCCCCCCCCCCCeEEEEEcCCCHHHHHHHHHHHHHHhhhhhccccccccc
Q 047110          562 GDWTYRLYGIFQEEMLGAAKGFPKVYIDGPYGASSQDYVKYDVVLLIGLGIGATPFISIIRDVANNAQKAEFDQVAGSVC  641 (784)
Q Consensus       562 g~~T~~L~~~~~~~~~~~~~~~~~v~i~GPyG~~~~~~~~~~~vvlIagG~GItp~lsil~~l~~~~~~~~~~~~~~~~~  641 (784)
                      |.+|+.|.+.        .++|+++.|+||||.+..+ ..++++||||||+||||++++++++....             
T Consensus        83 G~~S~~l~~~--------l~~G~~v~v~gP~G~~~~~-~~~~~~vliagGtGitp~~~~l~~l~~~~-------------  140 (243)
T 4eh1_A           83 GLVSHYLHNN--------VKVGDSVKLYAPAGDFFYV-ERERPVVLISAGVGATPMQAILHTLAKQN-------------  140 (243)
T ss_dssp             CHHHHHHHHH--------CCTTCEEEEEEEECSCCCC-CCSSCEEEEEEGGGHHHHHHHHHHHHHTT-------------
T ss_pred             CeehhHHHhc--------CCCCCEEEEEccCcccCcC-CCCCCEEEEEccccHHHHHHHHHHHHHcC-------------
Confidence            7788877643        2589999999999998765 67899999999999999999999988653             


Q ss_pred             CCCCCccEEEEEEEecCCCcHHHHHHHHHHHHHhcCCCCcEEEEEEEecCCCCCCchhhHHHHHHHhhhhccCccccCCC
Q 047110          642 KIPKGPLKAYLYWVTREQISFEWFRDVITEISKIYLKQPVIEMHNFLSSVYQEGDGRSAILSVIQALHYARTGIDIISKT  721 (784)
Q Consensus       642 ~~~~~~~~v~liW~~R~~~~~~~~~~~L~~l~~~~~~~~~l~v~i~vT~~~~~~d~~~~~~~~~~~~~~~~~~~d~~~g~  721 (784)
                          ..+ ++|+|++|+.+++ ++.++|+++.+..    .+++++++++....+.                         
T Consensus       141 ----~~~-v~l~~~~r~~~~~-~~~~el~~l~~~~----~~~~~~~~s~~~~~~~-------------------------  185 (243)
T 4eh1_A          141 ----KSG-VTYLYACNSAKEH-TFAQETAQLIAQQ----GWMQQVWYRDESADDV-------------------------  185 (243)
T ss_dssp             ----CCS-EEEEEEESSGGGC-TTHHHHHHHHHHH----TCEEEEEESSCCCTTC-------------------------
T ss_pred             ----CCe-EEEEEEeCChhhh-hHHHHHHHHHHhC----CeEEEEEEccCCCccc-------------------------
Confidence                224 9999999999988 7889999887753    5777777775322100                         


Q ss_pred             CceeeecCCChHHHHHHHHHhCCCCeEEEEEeCChhHHHHHHHHHHhcccCCCceEEEEeeCC
Q 047110          722 PMWTHYSRPDWFNVFSKLARRHPGERIGVFYCGSLLLGKELEGLCTTFSYRTNTRFVFHKEHF  784 (784)
Q Consensus       722 ~~~~~~GRPd~~~i~~~~~~~~~~~~~~V~vCGP~~m~~~v~~~~~~~~~~~~~~~~~~~E~F  784 (784)
                          ..||++...+      ..+.....||+|||++|++++++.+.+.+.   +.-++|.|.|
T Consensus       186 ----~~g~~~~~~~------~~~~~~~~vyvCGp~~m~~~v~~~l~~~g~---~~~~i~~E~F  235 (243)
T 4eh1_A          186 ----LQGEMQLAEL------ILPIEDGDFYLCGPIGFMQYVVKQLLALGV---DKARIHYEVF  235 (243)
T ss_dssp             ----EESSCCCTTS------CCCTTTCEEEEEECHHHHHHHHHHHHHHTC---CGGGEEEEEC
T ss_pred             ----ccCCccHHHe------eccCCCcEEEEECCHHHHHHHHHHHHHcCC---CHHHEEEecc
Confidence                2355554332      112234679999999999999999988653   4457888887
>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Back     alignment and structure
>4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Back     alignment and structure
>3vo2_A Putative uncharacterized protein; rossmann fold, oxidoreductase, FAD binding; HET: FAD; 1.39A {Zea mays} PDB: 3vo1_A* 1gaw_A* 1gaq_A* 1qg0_A* 4af6_A* 1qga_A* 1qfz_A* 1qfy_A* 4af7_A* 1sm4_A* 3mhp_A* 1fnb_A* 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 2xnc_A* Back     alignment and structure
>3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Back     alignment and structure
>3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Back     alignment and structure
>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* Back     alignment and structure
>4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* Back     alignment and structure
>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Back     alignment and structure
>2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Back     alignment and structure
>2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Back     alignment and structure
>1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Back     alignment and structure
>2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Back     alignment and structure
>2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Back     alignment and structure
>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Back     alignment and structure
>2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 784
d1a8pa199 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxi 2e-10
d1qfja197 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {E 2e-04
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 0.002
d1fdra199 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxi 0.004
>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} Length = 99 Back     information, alignment and structure

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Ferredoxin reductase FAD-binding domain-like
domain: Ferredoxin reductase (flavodoxin reductase) N-terminal domain
species: Azotobacter vinelandii [TaxId: 354]

 Score = 56.1 bits (135), Expect = 2e-10
 Identities = 12/78 (15%), Positives = 27/78 (34%), Gaps = 7/78 (8%)

Query: 494 IYEIKNLTPSLYPGKVLSLKMQKPEGFRYRAGMYMFVQCPEISPFEWHPFSLTSGPADDF 553
           +  + +   +L+     S K  +    R+  G ++ +            +S+ S   ++ 
Sbjct: 8   VLSVHHWNDTLF-----SFKTTRNPSLRFENGQFVMIGLEVDGRPLMRAYSIASPNYEEH 62

Query: 554 LSVHIRAL--GDWTYRLY 569
           L      +  G  T RL 
Sbjct: 63  LEFFSIKVQNGPLTSRLQ 80
>d1qfja1 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query784
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.78
d1tvca2141 Methane monooxygenase component C, MmoC {Methyloco 99.75
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.74
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.73
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.73
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.73
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.72
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.72
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.71
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.71
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.71
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.71
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.69
d1cqxa3142 Flavohemoglobin, C-terminal domain {Alcaligenes eu 99.69
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.69
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.69
d1krha2133 Benzoate dioxygenase reductase {Acinetobacter sp. 99.68
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.68
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.67
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.66
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.66
d1umka2147 cytochrome b5 reductase {Human (Homo sapiens) [Tax 99.66
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.65
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.64
d1qfja2135 NAD(P)H:flavin oxidoreductase {Escherichia coli [T 99.63
d1gvha3143 Flavohemoglobin, C-terminal domain {Escherichia co 99.62
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.62
d1fdra2148 Ferredoxin reductase (flavodoxin reductase) {Esche 99.6
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.59
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.59
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1fnda2160 Ferredoxin reductase (flavodoxin reductase) {Spina 99.52
d2cnda2146 Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} 99.52
d1qfja197 NAD(P)H:flavin oxidoreductase {Escherichia coli [T 99.51
d2piaa2120 Phthalate dioxygenase reductase {Pseudomonas cepac 99.51
d2bmwa2162 Ferredoxin reductase (flavodoxin reductase) {Cyano 99.51
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.49
d1a8pa199 Ferredoxin reductase (flavodoxin reductase) N-term 99.47
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.46
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.45
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.45
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.45
d1f20a2165 Neuronal nitric-oxide synthase FAD/NADP+ domain {R 99.44
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.44
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.44
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.44
d1fdra199 Ferredoxin reductase (flavodoxin reductase) N-term 99.43
d1jb9a2154 Ferredoxin reductase (flavodoxin reductase) {Maize 99.42
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.42
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.41
d1krha1100 Benzoate dioxygenase reductase {Acinetobacter sp. 99.39
d1ddga2153 Sulfite reductase flavoprotein {Escherichia coli [ 99.38
d1a8pa2158 Ferredoxin reductase (flavodoxin reductase) {Azoto 99.37
d1ja1a3160 NADPH-cytochrome p450 reductase {Rat (Rattus norve 99.37
d1tvca1109 Methane monooxygenase component C, MmoC {Methyloco 99.37
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.36
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.35
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.32
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.32
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 99.31
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.29
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1cqxa2111 Flavohemoglobin, central domain {Alcaligenes eutro 99.25
d1ep3b1101 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 99.23
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.23
d1gvha2107 Flavohemoglobin, central domain {Escherichia coli 99.21
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.2
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.19
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.15
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.15
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.14
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.08
d2piaa1103 Phthalate dioxygenase reductase {Pseudomonas cepac 99.07
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.07
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.06
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.05
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.04
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.04
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.03
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.03
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.03
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.03
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.01
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.0
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.99
d2cnda1114 Nitrate reductase core domain {Corn (Zea mays) [Ta 98.99
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.97
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.97
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.96
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.95
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.95
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.95
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.94
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.92
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.91
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.9
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.9
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.9
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.89
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.88
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.88
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.88
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.87
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.85
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.85
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.84
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.84
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.84
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.84
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.84
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.83
d1umka1124 cytochrome b5 reductase {Human (Homo sapiens) [Tax 98.83
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.83
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.82
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.81
d1fnda1136 Ferredoxin reductase (flavodoxin reductase) N-term 98.8
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.8
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.8
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.78
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.77
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.77
d2bmwa1133 Ferredoxin reductase (flavodoxin reductase) N-term 98.76
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.75
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.75
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.74
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.73
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.7
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.7
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.69
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.68
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.67
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.66
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.6
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.59
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.58
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.58
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.55
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.53
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.5
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.5
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.5
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.45
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.44
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.44
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.44
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.43
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.43
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.41
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.4
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.4
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.39
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.39
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.35
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.35
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.3
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.3
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.29
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.26
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.25
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1jb9a1157 Ferredoxin reductase (flavodoxin reductase) N-term 98.19
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.18
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.18
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.15
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 98.13
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.09
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.08
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.06
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.93
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.8
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.78
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.58
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.56
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.52
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.51
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.38
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.27
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.17
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.04
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.01
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.34
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.0
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 91.23
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 88.77
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 88.05
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 87.87
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 85.75
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 84.22
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 82.17
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calcineurin B-like protein 2
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.78  E-value=3.6e-19  Score=173.03  Aligned_cols=145  Identities=16%  Similarity=0.268  Sum_probs=126.0

Q ss_pred             cCChhHHHHHHHHHHHccc--CCCCccccchhchHHHHHHhhhhhhhhccCccccCCCCcHHHHHHHHHHHHccCCCCcc
Q 047110           71 FTNLEWTDVEARFDRLAYT--KNGTEPVIKWSDFSFCIAKLKLLLYIIVFPSNFVAMQQTPEFANEILRALRGRSEWKVD  148 (784)
Q Consensus        71 ~~~~~~~~l~~~F~~~d~~--~dG~~~~I~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~d~~~d~g~  148 (784)
                      .+..+++.|+++|+.+|.+  +||   .|+.+||..++              ...+..+. ..++++|+ .+|.++| |.
T Consensus        11 Fs~~ei~~L~~~F~~~d~~~~~~G---~i~~~ef~~~l--------------~~~~~~~~-~~~~~lf~-~~d~~~d-g~   70 (183)
T d2zfda1          11 FSVSEIEALYELFKKISSAVIDDG---LINKEEFQLAL--------------FKTNKKES-LFADRVFD-LFDTKHN-GI   70 (183)
T ss_dssp             CCHHHHHHHHHHHHHHHTSSSCSS---SBCHHHHHHHH--------------HSCSSCCC-HHHHHHHH-HHCSSCS-SS
T ss_pred             CCHHHHHHHHHHHHHHCcCCCCCC---cCcHHHHHHHH--------------HhcCCCCC-HHHHHHHH-HHccCCC-Cc
Confidence            5678899999999999875  578   89999999998              34455444 56899999 5999996 99


Q ss_pred             ccHHHHHHHHHHhc--CCHHHHHHHHHHHhccCCCCcccHHHHHHHHhhhhccCCCCCChHHHHHHHHHHHHHcCCCCCC
Q 047110          149 ITKNELRDYWHRMA--GSVDSRIQLFFYMCDRNFDGKIDEIDMKQTILGSASANKLSMTHEEAQEYAASIMEFLDTKKRG  226 (784)
Q Consensus       149 I~f~ef~~~~~~~~--~~~~~~l~~aF~~~D~dgdG~Is~~El~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~D~d~dG  226 (784)
                      |+|+||+.+++.+.  +..+++++.+|++||.||||+|+.+|++.++.......+....++..++.++.+|+++|.|+||
T Consensus        71 I~f~EFl~~l~~~~~~~~~~~~~~~~F~~~D~d~~G~Is~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~if~~~D~d~dG  150 (183)
T d2zfda1          71 LGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDG  150 (183)
T ss_dssp             BCHHHHHHHHHHTSTTSCHHHHHHHHHHHHCTTSSSSEEHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHCSSCSS
T ss_pred             CcHHHHHHHHHhhhccCcHHHHHHHhhcccccCCCCCccHHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHhCCCCCC
Confidence            99999999998876  6788999999999999999999999999999776655555666888999999999999999999


Q ss_pred             cccccCCCC
Q 047110          227 YLEVTNPHK  235 (784)
Q Consensus       227 ~i~~~eF~~  235 (784)
                      .|+|+||++
T Consensus       151 ~Is~~EF~~  159 (183)
T d2zfda1         151 KIDKEEWRS  159 (183)
T ss_dssp             EECHHHHHH
T ss_pred             eEcHHHHHH
Confidence            999999974
>d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qfja1 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1ep3b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fnda1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2bmwa1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure