Citrus Sinensis ID: 047180


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MAMRSLISERVSCRSSVLGARWMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ
cccHHHHHHHHcccccccccccccccccccccccccHHccHHHHHHcccccccccccccEEEccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccHHHHcccEEEEEccccHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHcccccccccccccccccccHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHHcccccEEEcccccccccccHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEEccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHc
ccHHHHHHHHHHccccHHHHHHHcccccccccccccHHHHHHHHHHcccccccEEcccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccHHccHHHEEEEEEEHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHccEEEEEEcEEccccEEcHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHcHHHHHHHHcccccEEEEEcccccccHHHcEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHH
MAMRSLISERVSCRSSVLGARWMSSWWrnvepaakdpilgvteafladpspdkvnvgvgayrddngkpVVLECVREAERRIAGtanmeylpmggsvKMVEETLKLAygdnsefikDKRIAAVQSLSGTGACRLFADfqkrfhpdsqiyipvptwsnhhniwrdahvtqrtfhyyhpgtkglDFAALMDdiknapngsffLLHAcahnptgvdpseeQWKEISYQIKakghfpffdmayqgfasgdpERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLarpmysnppvhGALIVSTILGDAELKKLWLKEVQ
mamrsliservscrssvLGARWMSSWWRNVEPAAKDPILGVTEAfladpspdKVNVGVgayrddngkpvVLECVREAERriagtanmeylpmggSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ
MAMRSLISERVSCRSSVLGARWMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ
**********VSCRSSVLGARWMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWL****
*********************WMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ
*************RSSVLGARWMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ
**************************WRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMRSLISERVSCRSSVLGARWMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query337 2.2.26 [Sep-21-2011]
P46643430 Aspartate aminotransferas yes no 0.946 0.741 0.849 1e-166
Q55F21426 Aspartate aminotransferas yes no 0.931 0.737 0.539 1e-100
Q28F67427 Aspartate aminotransferas yes no 0.958 0.756 0.525 2e-96
P00507430 Aspartate aminotransferas yes no 0.925 0.725 0.538 2e-94
P05202430 Aspartate aminotransferas yes no 0.925 0.725 0.535 4e-94
P00505430 Aspartate aminotransferas yes no 0.925 0.725 0.535 1e-93
P08907401 Aspartate aminotransferas yes no 0.931 0.783 0.534 1e-93
Q5REB0430 Aspartate aminotransferas yes no 0.925 0.725 0.531 3e-93
Q4R559430 Aspartate aminotransferas N/A no 0.925 0.725 0.531 3e-93
P00508423 Aspartate aminotransferas yes no 0.925 0.737 0.531 2e-92
>sp|P46643|AAT1_ARATH Aspartate aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=ASP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  583 bits (1503), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 271/319 (84%), Positives = 294/319 (92%)

Query: 19  GARWMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAE 78
           G R MSSWW++VEPA KDPILGVTEAFLADPSP+KVNVGVGAYRDDNGKPVVLECVREAE
Sbjct: 25  GLRSMSSWWKSVEPAPKDPILGVTEAFLADPSPEKVNVGVGAYRDDNGKPVVLECVREAE 84

Query: 79  RRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQ 138
           +R+AG+  MEYLPMGGS KMV+ TLKLAYGDNSEFIKDKRIAAVQ+LSGTGACRLFADFQ
Sbjct: 85  KRLAGSTFMEYLPMGGSAKMVDLTLKLAYGDNSEFIKDKRIAAVQTLSGTGACRLFADFQ 144

Query: 139 KRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSF 198
           KRF P SQIYIPVPTWSNHHNIW+DA V Q+T+HYYHP TKGLDF+ALMDD+KNAP GSF
Sbjct: 145 KRFSPGSQIYIPVPTWSNHHNIWKDAQVPQKTYHYYHPETKGLDFSALMDDVKNAPEGSF 204

Query: 199 FLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLK 258
           FLLHACAHNPTGVDP+EEQW+EIS   KAK HF FFDMAYQGFASGDP RDAK+IRIFL+
Sbjct: 205 FLLHACAHNPTGVDPTEEQWREISQLFKAKKHFAFFDMAYQGFASGDPARDAKSIRIFLE 264

Query: 259 DGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALI 318
           DGH +G++QSYAKNMGLYGQRVGCLSVLCED KQAVAVKSQLQQLARPMYSNPP+HGA +
Sbjct: 265 DGHHIGISQSYAKNMGLYGQRVGCLSVLCEDPKQAVAVKSQLQQLARPMYSNPPLHGAQL 324

Query: 319 VSTILGDAELKKLWLKEVQ 337
           VSTIL D ELK LWLKEV+
Sbjct: 325 VSTILEDPELKSLWLKEVK 343




Important for the metabolism of amino acids and Krebs-cycle related organic acids. In plants, it is involved in nitrogen metabolism and in aspects of carbon and energy metabolism.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: 1
>sp|Q55F21|AATM_DICDI Aspartate aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=aatA PE=3 SV=1 Back     alignment and function description
>sp|Q28F67|AATM_XENTR Aspartate aminotransferase, mitochondrial OS=Xenopus tropicalis GN=got2 PE=2 SV=1 Back     alignment and function description
>sp|P00507|AATM_RAT Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Got2 PE=1 SV=2 Back     alignment and function description
>sp|P05202|AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus GN=Got2 PE=1 SV=1 Back     alignment and function description
>sp|P00505|AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens GN=GOT2 PE=1 SV=3 Back     alignment and function description
>sp|P08907|AATM_HORSE Aspartate aminotransferase, mitochondrial OS=Equus caballus GN=GOT2 PE=1 SV=1 Back     alignment and function description
>sp|Q5REB0|AATM_PONAB Aspartate aminotransferase, mitochondrial OS=Pongo abelii GN=GOT2 PE=2 SV=1 Back     alignment and function description
>sp|Q4R559|AATM_MACFA Aspartate aminotransferase, mitochondrial OS=Macaca fascicularis GN=GOT2 PE=2 SV=1 Back     alignment and function description
>sp|P00508|AATM_CHICK Aspartate aminotransferase, mitochondrial OS=Gallus gallus GN=GOT2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
225446660423 PREDICTED: aspartate aminotransferase, m 0.997 0.794 0.884 1e-178
147833248423 hypothetical protein VITISV_015512 [Viti 0.997 0.794 0.884 1e-177
255578685425 aspartate aminotransferase, putative [Ri 1.0 0.792 0.843 1e-171
449459088428 PREDICTED: aspartate aminotransferase, m 1.0 0.787 0.821 1e-171
449525533373 PREDICTED: aspartate aminotransferase, m 1.0 0.903 0.821 1e-171
224131392406 predicted protein [Populus trichocarpa] 0.913 0.758 0.905 1e-169
357474641424 Aspartate aminotransferase [Medicago tru 1.0 0.794 0.821 1e-168
218198356430 hypothetical protein OsI_23308 [Oryza sa 0.949 0.744 0.859 1e-167
53792951430 aspartate transaminase precursor, mitoch 0.949 0.744 0.856 1e-167
356517322427 PREDICTED: aspartate aminotransferase, m 1.0 0.789 0.820 1e-167
>gi|225446660|ref|XP_002281764.1| PREDICTED: aspartate aminotransferase, mitochondrial [Vitis vinifera] gi|302143448|emb|CBI22009.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  630 bits (1625), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 298/337 (88%), Positives = 314/337 (93%), Gaps = 1/337 (0%)

Query: 1   MAMRSLISERVSCRSSVLGARWMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGA 60
           MA R+ IS R+  RS   G R MSSWW +VEPAAKDPILGVTEAFLADPSPDKVNVGVGA
Sbjct: 1   MAFRTGISRRMMIRSG-FGLRSMSSWWGSVEPAAKDPILGVTEAFLADPSPDKVNVGVGA 59

Query: 61  YRDDNGKPVVLECVREAERRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIA 120
           YRDDNGKPVVLECVREAERRIAG  NMEYLPMGGSV MVEETLKLAYG+NSEFIKDKRIA
Sbjct: 60  YRDDNGKPVVLECVREAERRIAGKLNMEYLPMGGSVNMVEETLKLAYGENSEFIKDKRIA 119

Query: 121 AVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKG 180
           AVQ+LSGTGACRLFADFQKRF PDSQIYIPVPTW+NHHNIWRDA V QRTFHYYHP TKG
Sbjct: 120 AVQALSGTGACRLFADFQKRFRPDSQIYIPVPTWANHHNIWRDAQVPQRTFHYYHPETKG 179

Query: 181 LDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQG 240
           LDFA+LMDD+KNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQ K KGHF FFDMAYQG
Sbjct: 180 LDFASLMDDVKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQFKVKGHFAFFDMAYQG 239

Query: 241 FASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQL 300
           FASGDPERDAK+I+IFL+DGHL+G+AQSYAKNMGLYGQRVGCLS+LCEDEKQAVAVKSQL
Sbjct: 240 FASGDPERDAKSIKIFLEDGHLIGIAQSYAKNMGLYGQRVGCLSLLCEDEKQAVAVKSQL 299

Query: 301 QQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ 337
           QQ+ARPMYSNPPV GALIVSTILGD ELKKLWLKEV+
Sbjct: 300 QQIARPMYSNPPVQGALIVSTILGDPELKKLWLKEVK 336




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147833248|emb|CAN73052.1| hypothetical protein VITISV_015512 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255578685|ref|XP_002530202.1| aspartate aminotransferase, putative [Ricinus communis] gi|223530278|gb|EEF32176.1| aspartate aminotransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449459088|ref|XP_004147278.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449525533|ref|XP_004169771.1| PREDICTED: aspartate aminotransferase, mitochondrial-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|224131392|ref|XP_002321073.1| predicted protein [Populus trichocarpa] gi|222861846|gb|EEE99388.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357474641|ref|XP_003607605.1| Aspartate aminotransferase [Medicago truncatula] gi|355508660|gb|AES89802.1| Aspartate aminotransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|218198356|gb|EEC80783.1| hypothetical protein OsI_23308 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|53792951|dbj|BAD54126.1| aspartate transaminase precursor, mitochondrial [Oryza sativa Japonica Group] gi|125597512|gb|EAZ37292.1| hypothetical protein OsJ_21631 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|356517322|ref|XP_003527337.1| PREDICTED: aspartate aminotransferase, mitochondrial [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
TAIR|locus:2052851430 ASP1 "aspartate aminotransfera 0.946 0.741 0.849 2e-150
DICTYBASE|DDB_G0268664426 aatA "aspartate transaminase" 0.931 0.737 0.539 2.7e-91
UNIPROTKB|Q28F67427 got2 "Aspartate aminotransfera 0.958 0.756 0.525 2.2e-89
RGD|2722430 Got2 "glutamic-oxaloacetic tra 0.931 0.730 0.541 7.5e-89
MGI|MGI:95792430 Got2 "glutamate oxaloacetate t 0.931 0.730 0.537 2e-88
ZFIN|ZDB-GENE-030131-7917428 got2b "glutamic-oxaloacetic tr 0.931 0.733 0.544 2e-88
ASPGD|ASPL0000046209429 AN1993 [Emericella nidulans (t 0.997 0.783 0.501 2.5e-88
UNIPROTKB|P00505430 GOT2 "Aspartate aminotransfera 0.931 0.730 0.537 4.1e-88
UNIPROTKB|P00506430 GOT2 "Aspartate aminotransfera 0.931 0.730 0.537 6.7e-88
UNIPROTKB|P12344430 GOT2 "Aspartate aminotransfera 0.931 0.730 0.537 1.1e-87
TAIR|locus:2052851 ASP1 "aspartate aminotransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1468 (521.8 bits), Expect = 2.0e-150, P = 2.0e-150
 Identities = 271/319 (84%), Positives = 294/319 (92%)

Query:    19 GARWMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAE 78
             G R MSSWW++VEPA KDPILGVTEAFLADPSP+KVNVGVGAYRDDNGKPVVLECVREAE
Sbjct:    25 GLRSMSSWWKSVEPAPKDPILGVTEAFLADPSPEKVNVGVGAYRDDNGKPVVLECVREAE 84

Query:    79 RRIAGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQ 138
             +R+AG+  MEYLPMGGS KMV+ TLKLAYGDNSEFIKDKRIAAVQ+LSGTGACRLFADFQ
Sbjct:    85 KRLAGSTFMEYLPMGGSAKMVDLTLKLAYGDNSEFIKDKRIAAVQTLSGTGACRLFADFQ 144

Query:   139 KRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSF 198
             KRF P SQIYIPVPTWSNHHNIW+DA V Q+T+HYYHP TKGLDF+ALMDD+KNAP GSF
Sbjct:   145 KRFSPGSQIYIPVPTWSNHHNIWKDAQVPQKTYHYYHPETKGLDFSALMDDVKNAPEGSF 204

Query:   199 FLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLK 258
             FLLHACAHNPTGVDP+EEQW+EIS   KAK HF FFDMAYQGFASGDP RDAK+IRIFL+
Sbjct:   205 FLLHACAHNPTGVDPTEEQWREISQLFKAKKHFAFFDMAYQGFASGDPARDAKSIRIFLE 264

Query:   259 DGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALI 318
             DGH +G++QSYAKNMGLYGQRVGCLSVLCED KQAVAVKSQLQQLARPMYSNPP+HGA +
Sbjct:   265 DGHHIGISQSYAKNMGLYGQRVGCLSVLCEDPKQAVAVKSQLQQLARPMYSNPPLHGAQL 324

Query:   319 VSTILGDAELKKLWLKEVQ 337
             VSTIL D ELK LWLKEV+
Sbjct:   325 VSTILEDPELKSLWLKEVK 343




GO:0003824 "catalytic activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0008483 "transaminase activity" evidence=IEA
GO:0009058 "biosynthetic process" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005507 "copper ion binding" evidence=IDA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=IDA
DICTYBASE|DDB_G0268664 aatA "aspartate transaminase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q28F67 got2 "Aspartate aminotransferase, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
RGD|2722 Got2 "glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:95792 Got2 "glutamate oxaloacetate transaminase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7917 got2b "glutamic-oxaloacetic transaminase 2b, mitochondrial (aspartate aminotransferase 2)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000046209 AN1993 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|P00505 GOT2 "Aspartate aminotransferase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P00506 GOT2 "Aspartate aminotransferase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P12344 GOT2 "Aspartate aminotransferase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46643AAT1_ARATH2, ., 6, ., 1, ., 10.84950.94650.7418yesno
P05202AATM_MOUSE2, ., 6, ., 1, ., 10.53500.92580.7255yesno
Q28F67AATM_XENTR2, ., 6, ., 1, ., 10.52590.95840.7564yesno
Q5REB0AATM_PONAB2, ., 6, ., 1, ., 10.53180.92580.7255yesno
P12344AATM_BOVIN2, ., 6, ., 1, ., 10.53370.91690.7186yesno
P00508AATM_CHICK2, ., 6, ., 1, ., 10.53180.92580.7375yesno
P00507AATM_RAT2, ., 6, ., 1, ., 10.53820.92580.7255yesno
P00506AATM_PIG2, ., 6, ., 1, ., 10.53370.91690.7186yesno
P00505AATM_HUMAN2, ., 6, ., 1, ., 10.53500.92580.7255yesno
Q55F21AATM_DICDI2, ., 6, ., 1, ., 10.53960.93170.7370yesno
P08907AATM_HORSE2, ., 6, ., 1, ., 10.53480.93170.7830yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.6.10.976
4th Layer2.6.1.10.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00018772001
RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (423 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00024074001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (589 aa)
      0.917
GSVIVG00009618001
RecName- Full=L-lactate dehydrogenase; EC=1.1.1.27; (350 aa)
      0.913
GSVIVG00026376001
hypothetical protein LOC100248878 (320 aa)
      0.911
GSVIVG00017913001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (430 aa)
      0.908
GSVIVG00025551001
RecName- Full=Adenylosuccinate synthetase; EC=6.3.4.4;; Plays an important role in the de novo [...] (489 aa)
     0.907
GSVIVG00035688001
SubName- Full=Chromosome undetermined scaffold_80, whole genome shotgun sequence; (280 aa)
      0.907
GSVIVG00012864001
SubName- Full=Chromosome undetermined scaffold_408, whole genome shotgun sequence; (369 aa)
      0.907
PPO
RecName- Full=Polyphenol oxidase, chloroplastic; Short=PPO; EC=1.10.3.1; AltName- Full=Catechol [...] (607 aa)
      0.903
GSVIVG00000669001
SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (403 aa)
      0.900
GSVIVG00038134001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (500 aa)
       0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
PLN02397423 PLN02397, PLN02397, aspartate transaminase 0.0
PTZ00376404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 1e-171
PRK09257396 PRK09257, PRK09257, aromatic amino acid aminotrans 1e-140
COG1448396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 1e-139
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 2e-79
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 3e-27
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 7e-09
TIGR03542402 TIGR03542, DAPAT_plant, LL-diaminopimelate aminotr 0.003
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information
 Score =  646 bits (1669), Expect = 0.0
 Identities = 205/336 (61%), Positives = 256/336 (76%), Gaps = 2/336 (0%)

Query: 3   MRSLISERVSCRSSVLGARWMSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYR 62
               +  +   RSS+  A   SS + +VEPA  DPILGVTEAFLADPSP K+N+GVGAYR
Sbjct: 1   SNPFLKAKSRSRSSMAAAA-ASSRFEHVEPAPPDPILGVTEAFLADPSPVKLNLGVGAYR 59

Query: 63  DDNGKPVVLECVREAERRI-AGTANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAA 121
            + GKPVVL  VR+AE+R+ AG+ N EYLP+ G  +  + + KLAYG +S  IK+ R+A 
Sbjct: 60  TEEGKPVVLNVVRKAEQRLLAGSRNKEYLPIEGLAEFNKLSAKLAYGADSPAIKENRVAT 119

Query: 122 VQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGL 181
           VQ LSGTG+ RL A+F  RF+P S IYIP PTW NHHNI+RDA V  RT+ YY P T+GL
Sbjct: 120 VQCLSGTGSLRLGAEFLARFYPGSTIYIPNPTWGNHHNIFRDAGVPVRTYRYYDPKTRGL 179

Query: 182 DFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGF 241
           DF  L++D+K AP+GSF LLHACAHNPTGVDP+ EQW++IS  IK+K H PFFD AYQGF
Sbjct: 180 DFDGLLEDLKAAPDGSFVLLHACAHNPTGVDPTPEQWEQISDLIKSKNHLPFFDSAYQGF 239

Query: 242 ASGDPERDAKAIRIFLKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQ 301
           ASGD + DA+++R+F++DGH + +AQSYAKNMGLYG+RVG LSV+C+    AV VKSQL+
Sbjct: 240 ASGDLDADAQSVRMFVEDGHEILVAQSYAKNMGLYGERVGALSVVCKSADVAVRVKSQLK 299

Query: 302 QLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ 337
            +ARPMYSNPP+HGA IV+TILGD EL   W KE++
Sbjct: 300 LIARPMYSNPPIHGASIVATILGDPELFSEWTKELK 335


Length = 423

>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|163316 TIGR03542, DAPAT_plant, LL-diaminopimelate aminotransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 337
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 100.0
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 100.0
PTZ00376404 aspartate aminotransferase; Provisional 100.0
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 100.0
PRK09257396 aromatic amino acid aminotransferase; Provisional 100.0
PLN02397423 aspartate transaminase 100.0
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 100.0
PLN02368407 alanine transaminase 100.0
KOG0257 420 consensus Kynurenine aminotransferase, glutamine t 100.0
PLN02187 462 rooty/superroot1 100.0
PLN00143 409 tyrosine/nicotianamine aminotransferase; Provision 100.0
PRK13355517 bifunctional HTH-domain containing protein/aminotr 100.0
PRK07366388 succinyldiaminopimelate transaminase; Validated 100.0
PRK09147396 succinyldiaminopimelate transaminase; Provisional 100.0
PLN00175413 aminotransferase family protein; Provisional 100.0
PTZ00377 481 alanine aminotransferase; Provisional 100.0
PRK07681 399 aspartate aminotransferase; Provisional 100.0
PRK08637388 hypothetical protein; Provisional 100.0
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 100.0
PRK06855 433 aminotransferase; Validated 100.0
PRK06348384 aspartate aminotransferase; Provisional 100.0
PRK08636403 aspartate aminotransferase; Provisional 100.0
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 100.0
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 100.0
PLN02656409 tyrosine transaminase 100.0
PRK06290410 aspartate aminotransferase; Provisional 100.0
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 100.0
PLN02231 534 alanine transaminase 100.0
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 100.0
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 100.0
PRK08068389 transaminase; Reviewed 100.0
PRK06207405 aspartate aminotransferase; Provisional 100.0
PTZ00433412 tyrosine aminotransferase; Provisional 100.0
PRK08960387 hypothetical protein; Provisional 100.0
PRK09148 405 aminotransferase; Validated 100.0
PRK12414384 putative aminotransferase; Provisional 100.0
PRK05942394 aspartate aminotransferase; Provisional 100.0
PLN02450 468 1-aminocyclopropane-1-carboxylate synthase 100.0
PRK05839374 hypothetical protein; Provisional 100.0
PRK08912387 hypothetical protein; Provisional 100.0
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 100.0
PRK07682378 hypothetical protein; Validated 100.0
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 100.0
PLN02607 447 1-aminocyclopropane-1-carboxylate synthase 100.0
PRK07337388 aminotransferase; Validated 100.0
PRK07683387 aminotransferase A; Validated 100.0
PRK05957389 aspartate aminotransferase; Provisional 100.0
PRK08363398 alanine aminotransferase; Validated 100.0
PRK09082386 methionine aminotransferase; Validated 100.0
PRK07309391 aromatic amino acid aminotransferase; Validated 100.0
KOG0259 447 consensus Tyrosine aminotransferase [Amino acid tr 100.0
PRK07550386 hypothetical protein; Provisional 100.0
PRK15481431 transcriptional regulatory protein PtsJ; Provision 100.0
PRK06108382 aspartate aminotransferase; Provisional 100.0
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 100.0
PRK09275 527 aspartate aminotransferase; Provisional 100.0
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 100.0
PRK07324373 transaminase; Validated 100.0
PRK09265404 aminotransferase AlaT; Validated 100.0
PRK06107 402 aspartate aminotransferase; Provisional 100.0
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 100.0
COG1167 459 ARO8 Transcriptional regulators containing a DNA-b 100.0
PRK07777387 aminotransferase; Validated 100.0
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 100.0
PRK08175395 aminotransferase; Validated 100.0
PRK02610374 histidinol-phosphate aminotransferase; Provisional 100.0
PRK05764393 aspartate aminotransferase; Provisional 100.0
PRK07568 397 aspartate aminotransferase; Provisional 100.0
PRK01533366 histidinol-phosphate aminotransferase; Validated 100.0
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 100.0
PRK08361391 aspartate aminotransferase; Provisional 100.0
PRK14809357 histidinol-phosphate aminotransferase; Provisional 100.0
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 100.0
PRK06358354 threonine-phosphate decarboxylase; Provisional 100.0
PRK09440 416 avtA valine--pyruvate transaminase; Provisional 100.0
PRK03317368 histidinol-phosphate aminotransferase; Provisional 100.0
PRK06836394 aspartate aminotransferase; Provisional 100.0
PRK05166371 histidinol-phosphate aminotransferase; Provisional 100.0
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 100.0
PRK09105370 putative aminotransferase; Provisional 100.0
PRK07392360 threonine-phosphate decarboxylase; Validated 100.0
PRK03158359 histidinol-phosphate aminotransferase; Provisional 100.0
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 100.0
PRK08056356 threonine-phosphate decarboxylase; Provisional 100.0
PRK05387353 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08153369 histidinol-phosphate aminotransferase; Provisional 100.0
PRK03967337 histidinol-phosphate aminotransferase; Provisional 100.0
PRK04870356 histidinol-phosphate aminotransferase; Provisional 100.0
PLN03026380 histidinol-phosphate aminotransferase; Provisional 100.0
PRK14808335 histidinol-phosphate aminotransferase; Provisional 100.0
PLN02672 1082 methionine S-methyltransferase 100.0
KOG0256 471 consensus 1-aminocyclopropane-1-carboxylate syntha 100.0
PRK05664330 threonine-phosphate decarboxylase; Reviewed 100.0
PRK14807351 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08354311 putative aminotransferase; Provisional 100.0
PRK04781364 histidinol-phosphate aminotransferase; Provisional 100.0
PRK06225380 aspartate aminotransferase; Provisional 100.0
PRK01688351 histidinol-phosphate aminotransferase; Provisional 100.0
PRK03321352 putative aminotransferase; Provisional 100.0
PRK02731367 histidinol-phosphate aminotransferase; Validated 100.0
PRK06959339 putative threonine-phosphate decarboxylase; Provis 100.0
PRK04635354 histidinol-phosphate aminotransferase; Provisional 100.0
PRK07908349 hypothetical protein; Provisional 99.98
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.98
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.98
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.98
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.98
KOG0634 472 consensus Aromatic amino acid aminotransferase and 99.96
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.95
KOG0258 475 consensus Alanine aminotransferase [Amino acid tra 99.95
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.93
KOG0633375 consensus Histidinol phosphate aminotransferase [A 99.92
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 99.9
PRK07049 427 methionine gamma-lyase; Validated 99.89
COG3977 417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.88
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.87
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.87
PRK10534333 L-threonine aldolase; Provisional 99.87
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.87
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.86
PLN02721353 threonine aldolase 99.85
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.85
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.85
PLN02242 418 methionine gamma-lyase 99.85
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.84
PRK06234 400 methionine gamma-lyase; Provisional 99.84
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.83
PLN02822 481 serine palmitoyltransferase 99.82
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.81
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.81
PRK02627396 acetylornithine aminotransferase; Provisional 99.81
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 99.8
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.8
PRK08045 386 cystathionine gamma-synthase; Provisional 99.79
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.78
PRK06460 376 hypothetical protein; Provisional 99.78
PLN02483 489 serine palmitoyltransferase 99.78
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.78
cd00378 402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.77
PRK08249 398 cystathionine gamma-synthase; Provisional 99.77
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 99.77
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 99.77
PRK08776 405 cystathionine gamma-synthase; Provisional 99.77
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.77
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.76
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.75
PRK07811 388 cystathionine gamma-synthase; Provisional 99.75
PRK13392 410 5-aminolevulinate synthase; Provisional 99.75
PRK07582 366 cystathionine gamma-lyase; Validated 99.75
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 99.75
PRK06767 386 methionine gamma-lyase; Provisional 99.75
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.74
PRK10874 401 cysteine sulfinate desulfinase; Provisional 99.74
PRK07503 403 methionine gamma-lyase; Provisional 99.74
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.74
PRK02948 381 cysteine desulfurase; Provisional 99.74
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.73
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.73
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 99.73
PRK08247 366 cystathionine gamma-synthase; Reviewed 99.72
PRK07179407 hypothetical protein; Provisional 99.72
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 99.72
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.72
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 99.7
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.7
PRK09331 387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.7
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.7
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.7
TIGR03301 355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.7
PRK07050 394 cystathionine beta-lyase; Provisional 99.69
PRK13479 368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.69
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.69
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 99.69
PRK05939 397 hypothetical protein; Provisional 99.69
PF12897 425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.68
PLN02855 424 Bifunctional selenocysteine lyase/cysteine desulfu 99.68
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.68
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.68
PRK08861 388 cystathionine gamma-synthase; Provisional 99.68
PRK08574 385 cystathionine gamma-synthase; Provisional 99.67
cd06451 356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.67
PLN02409 401 serine--glyoxylate aminotransaminase 99.67
PRK00451 447 glycine dehydrogenase subunit 1; Validated 99.66
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 99.66
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.66
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.65
PRK09064407 5-aminolevulinate synthase; Validated 99.65
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.64
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.64
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.63
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.63
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 99.63
PRK08064 390 cystathionine beta-lyase; Provisional 99.62
PRK07505402 hypothetical protein; Provisional 99.62
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 99.62
PRK07671 377 cystathionine beta-lyase; Provisional 99.61
PRK09028 394 cystathionine beta-lyase; Provisional 99.61
TIGR02326 363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.6
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 99.6
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.6
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 99.6
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.6
TIGR01329 378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.6
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.59
PRK07269 364 cystathionine gamma-synthase; Reviewed 99.58
PRK00011 416 glyA serine hydroxymethyltransferase; Reviewed 99.58
PRK13393 406 5-aminolevulinate synthase; Provisional 99.58
PLN02509 464 cystathionine beta-lyase 99.57
PRK05968 389 hypothetical protein; Provisional 99.57
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.56
PRK13520371 L-tyrosine decarboxylase; Provisional 99.56
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.56
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.55
PRK06176 380 cystathionine gamma-synthase/cystathionine beta-ly 99.55
PRK14012 404 cysteine desulfurase; Provisional 99.55
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.55
PRK04260375 acetylornithine aminotransferase; Provisional 99.54
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.53
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 99.52
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.51
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.51
PRK04366 481 glycine dehydrogenase subunit 2; Validated 99.51
PRK05967 395 cystathionine beta-lyase; Provisional 99.51
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 99.51
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.5
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.5
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.47
PRK08360 443 4-aminobutyrate aminotransferase; Provisional 99.4
PRK09792421 4-aminobutyrate transaminase; Provisional 99.4
PLN00144382 acetylornithine transaminase 99.38
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.37
PLN02651364 cysteine desulfurase 99.37
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.36
PLN02624 474 ornithine-delta-aminotransferase 99.35
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.35
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 99.33
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.3
PRK06918 451 4-aminobutyrate aminotransferase; Reviewed 99.27
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.27
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.27
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 99.26
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.26
TIGR02618 450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.25
COG0399 374 WecE Predicted pyridoxal phosphate-dependent enzym 99.24
PLN02955476 8-amino-7-oxononanoate synthase 99.23
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.22
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 99.18
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.16
PRK04311 464 selenocysteine synthase; Provisional 99.14
COG0520 405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.07
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 99.07
TIGR00709 442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.06
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.06
TIGR00474 454 selA seryl-tRNA(sec) selenium transferase. In bact 99.05
PF01053 386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.02
PRK13237 460 tyrosine phenol-lyase; Provisional 99.0
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 98.98
PRK08117433 4-aminobutyrate aminotransferase; Provisional 98.96
PRK08114 395 cystathionine beta-lyase; Provisional 98.94
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 98.92
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 98.91
PRK06434 384 cystathionine gamma-lyase; Validated 98.89
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 98.87
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 98.86
PF00266 371 Aminotran_5: Aminotransferase class-V; InterPro: I 98.86
PF01276 417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 98.85
PRK13034 416 serine hydroxymethyltransferase; Reviewed 98.85
PRK02769380 histidine decarboxylase; Provisional 98.84
PF04864 363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 98.84
KOG1549 428 consensus Cysteine desulfurase NFS1 [Amino acid tr 98.82
PLN03032374 serine decarboxylase; Provisional 98.82
PRK06541 460 hypothetical protein; Provisional 98.8
COG0626 396 MetC Cystathionine beta-lyases/cystathionine gamma 98.79
PF06838 403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 98.76
PRK03715395 argD acetylornithine transaminase protein; Provisi 98.72
PRK08593 445 4-aminobutyrate aminotransferase; Provisional 98.72
TIGR01788 431 Glu-decarb-GAD glutamate decarboxylase. This model 98.69
PRK15029 755 arginine decarboxylase; Provisional 98.66
PLN02263 470 serine decarboxylase 98.65
KOG0053 409 consensus Cystathionine beta-lyases/cystathionine 98.64
PRK13580 493 serine hydroxymethyltransferase; Provisional 98.61
TIGR01814 406 kynureninase kynureninase. This model describes ky 98.6
COG2873 426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 98.57
PRK05769441 4-aminobutyrate aminotransferase; Provisional 98.53
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 98.52
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 98.49
KOG1368384 consensus Threonine aldolase [Amino acid transport 98.47
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 98.46
PTZ00094 452 serine hydroxymethyltransferase; Provisional 98.42
PLN02414 993 glycine dehydrogenase (decarboxylating) 98.41
COG0076 460 GadB Glutamate decarboxylase and related PLP-depen 98.4
PLN03226 475 serine hydroxymethyltransferase; Provisional 98.39
PRK15400 714 lysine decarboxylase CadA; Provisional 98.39
PRK00615 433 glutamate-1-semialdehyde aminotransferase; Provisi 98.39
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 98.36
COG1104 386 NifS Cysteine sulfinate desulfinase/cysteine desul 98.35
COG0075 383 Serine-pyruvate aminotransferase/archaeal aspartat 98.35
PLN02590 539 probable tyrosine decarboxylase 98.32
PLN02271 586 serine hydroxymethyltransferase 98.28
PRK05639 457 4-aminobutyrate aminotransferase; Provisional 98.26
PLN02880 490 tyrosine decarboxylase 98.26
PRK05965 459 hypothetical protein; Provisional 98.26
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 98.26
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 98.21
PRK12403 460 putative aminotransferase; Provisional 98.2
PRK15399 713 lysine decarboxylase LdcC; Provisional 98.19
PRK06062 451 hypothetical protein; Provisional 98.18
PRK06082459 4-aminobutyrate aminotransferase; Provisional 98.18
TIGR03799 522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 98.18
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 98.17
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 98.17
PRK07482 461 hypothetical protein; Provisional 98.15
PRK13578 720 ornithine decarboxylase; Provisional 98.14
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 98.09
PRK07046 453 aminotransferase; Validated 98.09
cd00611 355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 98.08
PRK06917 447 hypothetical protein; Provisional 98.07
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 98.07
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.05
PRK06209 431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 98.04
PRK07030 466 adenosylmethionine--8-amino-7-oxononanoate transam 98.04
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 98.04
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 98.03
PLN02760 504 4-aminobutyrate:pyruvate transaminase 98.03
PLN02724 805 Molybdenum cofactor sulfurase 98.03
COG1921 395 SelA Selenocysteine synthase [seryl-tRNASer seleni 98.03
PRK07678 451 aminotransferase; Validated 98.03
PRK07480 456 putative aminotransferase; Validated 98.02
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 97.99
COG0160447 GabT 4-aminobutyrate aminotransferase and related 97.97
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 97.97
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 97.94
PRK06916 460 adenosylmethionine--8-amino-7-oxononanoate transam 97.94
TIGR01364 349 serC_1 phosphoserine aminotransferase. This model 97.93
COG0112 413 GlyA Glycine/serine hydroxymethyltransferase [Amin 97.92
PF00464 399 SHMT: Serine hydroxymethyltransferase; InterPro: I 97.92
PRK05367 954 glycine dehydrogenase; Provisional 97.92
PRK06105 460 aminotransferase; Provisional 97.92
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 97.91
PRK13360442 omega amino acid--pyruvate transaminase; Provision 97.87
PRK07481 449 hypothetical protein; Provisional 97.86
PRK07483 443 hypothetical protein; Provisional 97.84
PRK08742 472 adenosylmethionine--8-amino-7-oxononanoate transam 97.84
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 97.84
PRK07036 466 hypothetical protein; Provisional 97.83
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 97.83
TIGR02617 467 tnaA_trp_ase tryptophanase, leader peptide-associa 97.81
PRK09221445 beta alanine--pyruvate transaminase; Provisional 97.8
PRK06149972 hypothetical protein; Provisional 97.76
KOG2862 385 consensus Alanine-glyoxylate aminotransferase AGT1 97.66
TIGR03811 608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 97.57
PRK061481013 hypothetical protein; Provisional 97.57
KOG1401433 consensus Acetylornithine aminotransferase [Amino 97.56
PRK12566 954 glycine dehydrogenase; Provisional 97.51
PRK08297443 L-lysine aminotransferase; Provisional 97.49
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 97.43
PRK05367 954 glycine dehydrogenase; Provisional 97.37
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 97.33
COG4100 416 Cystathionine beta-lyase family protein involved i 97.31
PRK03080 378 phosphoserine aminotransferase; Provisional 97.22
COG1003 496 GcvP Glycine cleavage system protein P (pyridoxal- 97.19
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 97.07
KOG1383 491 consensus Glutamate decarboxylase/sphingosine phos 96.92
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 96.81
PF05889 389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 96.75
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 96.62
PLN02414 993 glycine dehydrogenase (decarboxylating) 96.57
KOG1360 570 consensus 5-aminolevulinate synthase [Coenzyme tra 96.5
COG3033 471 TnaA Tryptophanase [Amino acid transport and metab 96.43
TIGR01365 374 serC_2 phosphoserine aminotransferase, Methanosarc 96.39
PLN02452 365 phosphoserine transaminase 96.1
COG0161 449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 95.97
PRK12462364 phosphoserine aminotransferase; Provisional 95.81
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 95.78
TIGR01366 361 serC_3 phosphoserine aminotransferase, putative. T 95.75
PLN02672 1082 methionine S-methyltransferase 95.7
COG0403 450 GcvP Glycine cleavage system protein P (pyridoxal- 94.84
KOG0628 511 consensus Aromatic-L-amino-acid/L-histidine decarb 94.79
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 94.44
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 94.02
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 93.03
KOG3843 432 consensus Predicted serine hydroxymethyltransferas 92.54
KOG1357 519 consensus Serine palmitoyltransferase [Posttransla 92.46
KOG0629 510 consensus Glutamate decarboxylase and related prot 90.39
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 90.13
COG3844 407 Kynureninase [Amino acid transport and metabolism] 89.31
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 87.39
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 85.87
PRK12566 954 glycine dehydrogenase; Provisional 82.35
KOG2467 477 consensus Glycine/serine hydroxymethyltransferase 80.92
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=5.5e-61  Score=438.18  Aligned_cols=311  Identities=50%  Similarity=0.896  Sum_probs=297.3

Q ss_pred             ccccCCCCCCCchhhHHHHHhcCCCCCeeEeeeeeeecCCCCcccchHHHHHHHHh-cCcCCCCCCCCCCCHHHHHHHHH
Q 047180           26 WWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRI-AGTANMEYLPMGGSVKMVEETLK  104 (337)
Q Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~G~~~~~~~~~~~~~~v~~a~~~~-~~~~~~~Y~~~~G~~~lr~aia~  104 (337)
                      +|++++..++++|+.+.+.+++++++++|||++|.|.+++|.++..++|++|.+.+ +......|.|..|+++|++++++
T Consensus         1 ~F~~i~~~p~DpIlgL~e~f~~D~R~~KVNLgIGvY~de~Gk~pvl~aV~~Ae~~l~~~~~~k~Yl~i~G~~~f~~~~~~   80 (396)
T COG1448           1 MFEKIEAAPADPILGLKEAFKADPRPNKVNLGIGVYKDEDGKTPVLRAVKKAEKRLLEQEKTKNYLPIEGLPEFLEAVQK   80 (396)
T ss_pred             CccccccCCCCchhHHHHHHhcCCCcCeeeeeeeeeeCCCCCcchhHHHHHHHHHhhccccccccCCcCCcHHHHHHHHH
Confidence            38999999999999999999999999999999999999999999999999999887 55567899999999999999999


Q ss_pred             HHhCCCCcccccCceeEEeeccchhHHHHHHHHHhhhCCCCeEEEcCCCCcchHHHHHhcCceeeEeeeccCCCCCCChH
Q 047180          105 LAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFA  184 (337)
Q Consensus       105 ~~~~~~~~~~~~~~i~~~~t~g~~~al~~~~~~l~~~~pgd~Vlv~~P~y~~y~~~~~~~G~~~~~~~~~~~~~~~~d~~  184 (337)
                      .++|.+.+.++++++..++|.||+||+.+.+.+++++.|..+|++++|+|++|..+++.+|.++..||+++.++.++|++
T Consensus        81 llFG~d~~~l~~~Rv~t~Qt~GGTGAL~~~A~fl~~~~~~~~vwis~PtW~NH~~If~~aGl~v~~Y~Yyd~~~~~~df~  160 (396)
T COG1448          81 LLFGADSPALAEDRVATVQTLGGTGALRVAADFLARFFPDATVWISDPTWPNHKAIFEAAGLEVETYPYYDAETKGLDFD  160 (396)
T ss_pred             HhcCCCcHHHHhhhHhheecCCcchHHHHHHHHHHHhCCCceEEeCCCCcHhHHHHHHhcCCceeeeeccccccccccHH
Confidence            99999888888999999999999999999999999888888999999999999999999999999999999888899999


Q ss_pred             HHHHHHHcCCCCeEEEEeCCCCCCCCCCCCHHHHHHHHHHHHhcCceeEEcccCCCCCCCCCccchHHHHHhhhcCCeEE
Q 047180          185 ALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGHLLG  264 (337)
Q Consensus       185 ~l~~~l~~~~~~~~ili~~~p~NPTG~~~s~~~~~~l~~~~~~~~~~ii~De~Y~~~~~~~~~~~~~~~~~~~~~~~~~i  264 (337)
                      .+.+.|++.+.+.++++++|||||||..+|.++|++|+++.++++++++.|-+|++|..| .++|...++.|+.....++
T Consensus       161 ~mla~L~~a~~~~vvLLH~CcHNPTG~D~t~~qW~~l~~~~~~r~lip~~D~AYQGF~~G-leeDa~~lR~~a~~~~~~l  239 (396)
T COG1448         161 GMLADLKTAPEGSVVLLHGCCHNPTGIDPTEEQWQELADLIKERGLIPFFDIAYQGFADG-LEEDAYALRLFAEVGPELL  239 (396)
T ss_pred             HHHHHHHhCCCCCEEEEecCCCCCCCCCCCHHHHHHHHHHHHHcCCeeeeehhhhhhccc-hHHHHHHHHHHHHhCCcEE
Confidence            999999999999999999999999999999999999999999999999999999999988 7889999999988777799


Q ss_pred             EEecccccccccccccceeEeeeCCHHHHHHHHHHHHhhhcccccCCChhHHHHHHHHhCCHHHHHHHHhhhC
Q 047180          265 LAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEVQ  337 (337)
Q Consensus       265 ~~~S~SK~~~~~G~RvG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~w~~el~  337 (337)
                      +++||||+||++|.|+|++.+++.|.+...++.++|..++|++||+||.+|..+++.+|+|++++++|.+||.
T Consensus       240 va~S~SKnfgLYgERVGa~~vva~~~~~a~~v~sqlk~~iR~~ySnPP~~Ga~vva~IL~~p~Lra~W~~El~  312 (396)
T COG1448         240 VASSFSKNFGLYGERVGALSVVAEDAEEADRVLSQLKAIIRTNYSNPPAHGAAVVATILNNPELRAEWEQELE  312 (396)
T ss_pred             EEehhhhhhhhhhhccceeEEEeCCHHHHHHHHHHHHHHHHhccCCCchhhHHHHHHHhCCHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999973



>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
3pd6_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 5e-96
3hlm_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 2e-95
7aat_A401 X-Ray Structure Refinement And Comparison Of Three 4e-95
1aka_A401 Structural Basis For The Catalytic Activity Of Aspa 2e-94
1ajs_A412 Refinement And Comparison Of The Crystal Structures 5e-74
1ajr_A412 Refinement And Comparison Of The Crystal Structures 2e-73
3ii0_A 422 Crystal Structure Of Human Glutamate Oxaloacetate T 9e-73
1aat_A411 Oxoglutarate-Induced Conformational Changes In Cyto 2e-72
2cst_A411 Crystal Structure Of The Closed Form Of Chicken Cyt 2e-72
4eu1_A409 Structure Of A Mitochondrial Aspartate Aminotransfe 4e-72
1yaa_A412 Aspartate Aminotransferase From Saccharomyces Cerev 2e-69
4h51_A420 Crystal Structure Of A Putative Aspartate Aminotran 8e-66
1asl_A396 Crystal Structures Of Escherichia Coli Aspartate Am 2e-62
3aat_A396 Activity And Structure Of The Active-Site Mutants R 2e-62
1ix6_A396 Aspartate Aminotransferase Active Site Mutant V39f 4e-62
1asf_A396 The Structural Basis For The Reduced Activity Of Th 5e-62
2q7w_A396 Structural Studies Reveals The Inactivation Of E. C 8e-62
4f5m_A406 Wild-type E. Coli Aspartate Aminotransferase: A Tem 9e-62
2aat_A396 2.8-Angstroms-Resolution Crystal Structure Of An Ac 9e-62
1aia_A396 Structural Basis For The Catalytic Activity Of Aspa 9e-62
2d5y_A396 Aspartate Aminotransferase Mutant Mc With Isovaleri 1e-61
1aam_A396 The Structural Basis For The Altered Substrate Spec 2e-61
1g7w_A396 Aspartate Aminotransferase Active Site Mutant N194a 2e-61
1asb_A396 The Structural Basis For The Reduced Activity Of Th 2e-61
3fsl_A397 Crystal Structure Of Tyrosine Aminotransferase Trip 2e-61
1arh_A396 Aspartate Aminotransferase, Y225rR386A MUTANT Lengt 2e-61
1b4x_A396 Aspartate Aminotransferase From E. Coli, C191s Muta 3e-61
1ix8_A396 Aspartate Aminotransferase Active Site Mutant V39fN 3e-61
1qis_A396 Aspartate Aminotransferase From Escherichia Coli, C 4e-61
1g4v_A396 Aspartate Aminotransferase Active Site Mutant N194a 5e-61
1qit_A396 Aspartate Aminotransferase From Escherichia Coli, C 5e-61
1qir_A396 Aspartate Aminotransferase From Escherichia Coli, C 5e-61
1ari_A396 Aspartate Aminotransferase, W140h Mutant, Maleate C 7e-61
1bqa_A396 Aspartate Aminotransferase P195a Mutant Length = 39 7e-61
3tat_A397 Tyrosine Aminotransferase From E. Coli Length = 397 7e-61
1g7x_A396 Aspartate Aminotransferase Active Site Mutant N194a 1e-60
1g4x_A396 Aspartate Aminotransferase Active Site Mutant N194a 1e-60
3meb_A448 Structure Of Cytoplasmic Aspartate Aminotransferase 2e-60
1ahy_A396 Aspartate Aminotransferase Hexamutant Length = 396 2e-60
1czc_A396 Aspartate Aminotransferase Mutant Atb17139S142N WIT 2e-60
1bqd_A396 Aspartate Aminotransferase P138aP195A DOUBLE MUTANT 5e-60
3zzj_A396 Structure Of An Engineered Aspartate Aminotransfera 6e-60
2d61_A396 Aspartate Aminotransferase Mutant Ma With Maleic Ac 7e-60
1toe_A396 Unliganded Structure Of Hexamutant + A293d Mutant O 1e-59
4f5f_A406 Structure Of Aspartate Aminotransferase Conversion 1e-59
1yoo_A396 Aspartate Aminotransferase Mutant Atb17 With Isoval 2e-59
2d66_A396 Aspartate Aminotransferase Mutant Mab Length = 396 8e-59
2d64_A396 Aspartate Aminotransferase Mutant Mabc With Isovale 8e-59
1toj_A396 Hydrocinnamic Acid-Bound Structure Of Srhept Mutant 8e-59
1tog_A396 Hydrocinnamic Acid-Bound Structure Of Srhept + A293 1e-58
4f4e_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 1e-58
4eff_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 1e-58
4f5j_A406 Rational Design And Directed Evolution For Conversi 1e-58
4f5h_A406 Intercoversion Of Substrate Specificity: E. Coli As 2e-58
4f5g_A406 Rational Design And Directed Evolution Of E. Coli A 4e-58
4f5i_A406 Substrate Specificity Conversion Of E. Coli Pyridox 1e-57
4f5k_A406 Substrate Specificity Conversion Of Aspartate Amino 2e-57
1ay4_A394 Aromatic Amino Acid Aminotransferase Without Substr 7e-53
3uak_A406 Crystal Structure Of De Novo Designed Cysteine Este 3e-51
3k7y_A405 Aspartate Aminotransferase Of Plasmodium Falciparum 1e-42
4emy_A413 Crystal Structure Of Aminotransferase From Anaeroco 3e-06
3rq1_A418 Crystal Structure Of Aminotransferase Class I And I 5e-06
>pdb|3PD6|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate Aminotransferase, A Newly Identified Kynurenine Aminotransferase-Iv Length = 401 Back     alignment and structure

Iteration: 1

Score = 347 bits (891), Expect = 5e-96, Method: Compositional matrix adjust. Identities = 170/316 (53%), Positives = 225/316 (71%), Gaps = 2/316 (0%) Query: 24 SSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIAG 83 SSWW +VE DPILGVTEAF D + K+N+GVGAYRDDNGKP VL VR+AE +IA Sbjct: 1 SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA 60 Query: 84 -TANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFH 142 + EYLP+GG + + + +LA G+N+E +K R VQ++SGTGA R+ A F +RF Sbjct: 61 KNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFF 120 Query: 143 PDSQ-IYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLL 201 S+ +++P P+W NH I+RDA + + + YY P T G DF+ ++DI P S LL Sbjct: 121 KFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLL 180 Query: 202 HACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGH 261 HACAHNPTGVDP EQWKEI+ +K K F FFDMAYQGFASGD ++DA A+R F++ G Sbjct: 181 HACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGI 240 Query: 262 LLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVST 321 + L QSYAKNMGLYG+RVG +V+C+D ++A V+SQL+ L RP+YSNPP++GA I +T Sbjct: 241 NVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAAT 300 Query: 322 ILGDAELKKLWLKEVQ 337 IL +L+K WL+EV+ Sbjct: 301 ILTSPDLRKQWLQEVK 316
>pdb|3HLM|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate AminotransferaseKYNURENINE AMINOTRANSFERASE IV Length = 401 Back     alignment and structure
>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms Of Mitochondrial Aspartate Aminotransferase Length = 401 Back     alignment and structure
>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding Lysine Residue Length = 401 Back     alignment and structure
>pdb|1AJS|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|1AJR|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|3II0|A Chain A, Crystal Structure Of Human Glutamate Oxaloacetate Transaminase 1 (Got1) Length = 422 Back     alignment and structure
>pdb|1AAT|A Chain A, Oxoglutarate-Induced Conformational Changes In Cytosolic Aspartate Aminotransferase Length = 411 Back     alignment and structure
>pdb|2CST|A Chain A, Crystal Structure Of The Closed Form Of Chicken Cytosolic Aspartate Aminotransferase At 1.9 Angstroms Resolution Length = 411 Back     alignment and structure
>pdb|4EU1|A Chain A, Structure Of A Mitochondrial Aspartate Aminotransferase From Trypanosoma Brucei Length = 409 Back     alignment and structure
>pdb|1YAA|A Chain A, Aspartate Aminotransferase From Saccharomyces Cerevisiae Cytoplasm Length = 412 Back     alignment and structure
>pdb|4H51|A Chain A, Crystal Structure Of A Putative Aspartate Aminotransferase From Leishmania Major Friedlin Length = 420 Back     alignment and structure
>pdb|1ASL|A Chain A, Crystal Structures Of Escherichia Coli Aspartate Aminotransferase In Two Conformations: Comparison Of An Unliganded Open And Two Liganded Closed Forms Length = 396 Back     alignment and structure
>pdb|3AAT|A Chain A, Activity And Structure Of The Active-Site Mutants R386y And R386f Of Escherichia Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1IX6|A Chain A, Aspartate Aminotransferase Active Site Mutant V39f Length = 396 Back     alignment and structure
>pdb|1ASF|A Chain A, The Structural Basis For The Reduced Activity Of The Y226f(Y225f) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|2Q7W|A Chain A, Structural Studies Reveals The Inactivation Of E. Coli L-Aspartate Aminotransferase (S)-4,5-Amino-Dihydro-2-Thiophenecarboxylic Acid (Sadta) Via Two Mechanisms At Ph 6.0 Length = 396 Back     alignment and structure
>pdb|4F5M|A Chain A, Wild-type E. Coli Aspartate Aminotransferase: A Template For The Interconversion Of Substrate Specificity And Activity To Tyrosine Aminotransferase By The Janus Algorithm. Length = 406 Back     alignment and structure
>pdb|2AAT|A Chain A, 2.8-Angstroms-Resolution Crystal Structure Of An Active-Site Mutant Of Aspartate Aminotransferase From Escherichia Coli Length = 396 Back     alignment and structure
>pdb|1AIA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking The Pyridoxal-5'-Phosphate Binding Lysine Residue Length = 396 Back     alignment and structure
>pdb|2D5Y|A Chain A, Aspartate Aminotransferase Mutant Mc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1AAM|A Chain A, The Structural Basis For The Altered Substrate Specificity Of The R292d Active Site Mutant Of Aspartate Aminotransferase From E. Coli Length = 396 Back     alignment and structure
>pdb|1G7W|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR386L Length = 396 Back     alignment and structure
>pdb|1ASB|A Chain A, The Structural Basis For The Reduced Activity Of The D223a(D222a) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|3FSL|A Chain A, Crystal Structure Of Tyrosine Aminotransferase Tripple Mutant (P181q, R183g,A321k) From Escherichia Coli At 2.35 A Resolution Length = 397 Back     alignment and structure
>pdb|1ARH|A Chain A, Aspartate Aminotransferase, Y225rR386A MUTANT Length = 396 Back     alignment and structure
>pdb|1B4X|A Chain A, Aspartate Aminotransferase From E. Coli, C191s Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1IX8|A Chain A, Aspartate Aminotransferase Active Site Mutant V39fN194A Length = 396 Back     alignment and structure
>pdb|1QIS|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191f Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1G4V|A Chain A, Aspartate Aminotransferase Active Site Mutant N194a/y225f Length = 396 Back     alignment and structure
>pdb|1QIT|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191w Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1QIR|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191y Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1ARI|A Chain A, Aspartate Aminotransferase, W140h Mutant, Maleate Complex Length = 396 Back     alignment and structure
>pdb|1BQA|A Chain A, Aspartate Aminotransferase P195a Mutant Length = 396 Back     alignment and structure
>pdb|3TAT|A Chain A, Tyrosine Aminotransferase From E. Coli Length = 397 Back     alignment and structure
>pdb|1G7X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292LR386L Length = 396 Back     alignment and structure
>pdb|1G4X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292L Length = 396 Back     alignment and structure
>pdb|3MEB|A Chain A, Structure Of Cytoplasmic Aspartate Aminotransferase From Giardia Lamblia Length = 448 Back     alignment and structure
>pdb|1AHY|A Chain A, Aspartate Aminotransferase Hexamutant Length = 396 Back     alignment and structure
>pdb|1CZC|A Chain A, Aspartate Aminotransferase Mutant Atb17139S142N WITH GLUTARIC ACID Length = 396 Back     alignment and structure
>pdb|1BQD|A Chain A, Aspartate Aminotransferase P138aP195A DOUBLE MUTANT Length = 396 Back     alignment and structure
>pdb|3ZZJ|A Chain A, Structure Of An Engineered Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|2D61|A Chain A, Aspartate Aminotransferase Mutant Ma With Maleic Acid Length = 396 Back     alignment and structure
>pdb|1TOE|A Chain A, Unliganded Structure Of Hexamutant + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|4F5F|A Chain A, Structure Of Aspartate Aminotransferase Conversion To Tyrosine Aminotransferase: Chimera P1. Length = 406 Back     alignment and structure
>pdb|1YOO|A Chain A, Aspartate Aminotransferase Mutant Atb17 With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|2D66|A Chain A, Aspartate Aminotransferase Mutant Mab Length = 396 Back     alignment and structure
>pdb|2D64|A Chain A, Aspartate Aminotransferase Mutant Mabc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1TOJ|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1TOG|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|4F4E|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Covalently Bound To Pyridoxal Phosphate Length = 420 Back     alignment and structure
>pdb|4EFF|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Length = 420 Back     alignment and structure
>pdb|4F5J|A Chain A, Rational Design And Directed Evolution For Conversion Of Substrate Specificity From E.coli Aspartate Aminotransferase To Tyrosine Aminotransferase: Mutant P5. Length = 406 Back     alignment and structure
>pdb|4F5H|A Chain A, Intercoversion Of Substrate Specificity: E. Coli Aspatate Aminotransferase To Tyrosine Aminotransferase: Chimera P3. Length = 406 Back     alignment and structure
>pdb|4F5G|A Chain A, Rational Design And Directed Evolution Of E. Coli Apartate Aminotransferase To Tyrosine Aminotransferase: Mutant P2. Length = 406 Back     alignment and structure
>pdb|4F5I|A Chain A, Substrate Specificity Conversion Of E. Coli Pyridoxal-5'-phosphate Dependent Aspartate Aminotransferase To Tyrosine Aminotransferase: Chimera P4. Length = 406 Back     alignment and structure
>pdb|4F5K|A Chain A, Substrate Specificity Conversion Of Aspartate Aminotransferase To Tyrosine Aminotransferase By The Janus Algorithm: Chimera P6. Length = 406 Back     alignment and structure
>pdb|1AY4|A Chain A, Aromatic Amino Acid Aminotransferase Without Substrate Length = 394 Back     alignment and structure
>pdb|3UAK|A Chain A, Crystal Structure Of De Novo Designed Cysteine Esterase Ech14, Northeast Structural Genomics Consortium Target Or54 Length = 406 Back     alignment and structure
>pdb|3K7Y|A Chain A, Aspartate Aminotransferase Of Plasmodium Falciparum Length = 405 Back     alignment and structure
>pdb|4EMY|A Chain A, Crystal Structure Of Aminotransferase From Anaerococcus Prevotii Dsm 20548. Length = 413 Back     alignment and structure
>pdb|3RQ1|A Chain A, Crystal Structure Of Aminotransferase Class I And Ii From Veillonella Parvula Length = 418 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 0.0
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 0.0
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 0.0
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 0.0
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 0.0
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 0.0
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 0.0
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 0.0
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 0.0
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 1e-180
3rq1_A418 Aminotransferase class I and II; structural genomi 1e-164
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 1e-154
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 1e-103
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
 Score =  525 bits (1355), Expect = 0.0
 Identities = 91/316 (28%), Positives = 162/316 (51%), Gaps = 2/316 (0%)

Query: 23  MSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIA 82
           M     ++E    D IL     F  D   +K+N+ +G   +D+G   + + V  A++ + 
Sbjct: 1   MDKLLSSLENIEVDNILKTAREFKEDTCEEKINLSIGVCCNDDGDLHIFDSVLNADKLVT 60

Query: 83  GT-ANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRF 141
                  YL   G+      T  L +G+NS++I+DK+I  +Q + GTGA  +  +F K  
Sbjct: 61  ENYKEKPYLLGNGTEDFSTLTQNLIFGNNSKYIEDKKICTIQCIGGTGAIFVLLEFLKML 120

Query: 142 HPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKGLDFAALMDDIKNAPNGSFFLL 201
           + ++ +Y+  P + NH N+        +  +++      +++   ++D++N PNGS  +L
Sbjct: 121 NVET-LYVTNPPYINHVNMIESRGFNLKYINFFDYNLIDINYDLFLNDLRNIPNGSSVIL 179

Query: 202 HACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDGH 261
               +NP  V+  E+ + EI   +  K H   FD+AYQGF   + E D   IR F +   
Sbjct: 180 QISCYNPCSVNIEEKYFDEIIEIVLHKKHVIIFDIAYQGFGHTNLEEDVLLIRKFEEKNI 239

Query: 262 LLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVST 321
              + QS++KNM LYG+R G L ++C+++++   V + L  + R  YS+P +H   I+  
Sbjct: 240 AFSVCQSFSKNMSLYGERAGALHIVCKNQEEKKIVFNNLCFIVRKFYSSPVIHTNRILCQ 299

Query: 322 ILGDAELKKLWLKEVQ 337
           +L +  LK  W+KE+ 
Sbjct: 300 LLNNQNLKLNWIKELS 315


>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 100.0
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 100.0
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 100.0
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 100.0
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 100.0
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 100.0
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 100.0
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 100.0
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 100.0
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 100.0
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 100.0
3rq1_A418 Aminotransferase class I and II; structural genomi 100.0
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 100.0
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 100.0
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 100.0
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 100.0
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 100.0
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 100.0
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 100.0
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 100.0
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 100.0
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 100.0
3ele_A398 Amino transferase; RER070207001803, structural gen 100.0
3aow_A 448 Putative uncharacterized protein PH0207; protein-P 100.0
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 100.0
2r2n_A 425 Kynurenine/alpha-aminoadipate aminotransferase mit 100.0
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 100.0
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 100.0
3ppl_A 427 Aspartate aminotransferase; dimer, PLP-dependent t 100.0
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 100.0
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 100.0
2x5d_A 412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 100.0
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 100.0
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 100.0
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 100.0
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 100.0
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 100.0
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 100.0
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 100.0
1iay_A 428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 100.0
3nra_A407 Aspartate aminotransferase; structural genomics, j 100.0
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 100.0
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 100.0
3d6k_A 422 Putative aminotransferase; APC82464, corynebacteri 100.0
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 100.0
1xi9_A406 Putative transaminase; alanine aminotransferase, s 100.0
1vp4_A 425 Aminotransferase, putative; structural genomics, j 100.0
2gb3_A 409 Aspartate aminotransferase; TM1698, structural gen 100.0
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 100.0
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 100.0
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 100.0
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 100.0
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 100.0
2z61_A370 Probable aspartate aminotransferase 2; amino acid 100.0
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 100.0
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 100.0
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 100.0
2zyj_A 397 Alpha-aminodipate aminotransferase; alpha-aminoadi 100.0
3g7q_A 417 Valine-pyruvate aminotransferase; NP_462565.1, str 100.0
3ez1_A 423 Aminotransferase MOCR family; YP_604413.1, struct 100.0
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 100.0
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 100.0
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 100.0
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 100.0
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 100.0
3if2_A 444 Aminotransferase; YP_265399.1, structura genomics, 100.0
3l8a_A421 METC, putative aminotransferase, probable beta-cys 100.0
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 100.0
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 100.0
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.98
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.97
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.97
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.97
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.95
3bwn_A 391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.97
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.97
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.97
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.97
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.97
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.96
2hox_A 427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.96
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.94
1e5e_A 404 MGL, methionine gamma-lyase; methionine biosynthes 99.94
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.93
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.91
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.91
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.91
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.91
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.9
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 99.9
2dr1_A 386 PH1308 protein, 386AA long hypothetical serine ami 99.9
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.89
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.89
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.89
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.89
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.89
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.88
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.88
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 99.88
1svv_A359 Threonine aldolase; structural genomics, structura 99.88
1ibj_A 464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.87
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.87
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.87
1elu_A 390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.87
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.87
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 99.87
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.87
2oga_A 399 Transaminase; PLP-dependent enzyme, desosamine, de 99.87
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 99.86
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 99.86
2aeu_A 374 Hypothetical protein MJ0158; selenocysteine syntha 99.86
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.86
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 99.86
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.85
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.85
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.85
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.85
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.85
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.85
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.85
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.85
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.85
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.85
2ch1_A 396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.85
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 99.84
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.84
3cog_A 403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.84
1m32_A 366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.84
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 99.84
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.84
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.84
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.84
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 99.84
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 99.83
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.83
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.83
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 99.83
1n8p_A 393 Cystathionine gamma-lyase; three open alpha/beta s 99.83
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.83
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.83
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 99.83
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 99.83
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.83
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 99.83
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.83
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.82
1zod_A 433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.82
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 99.82
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.82
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.82
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.82
2yrr_A 353 Aminotransferase, class V; structural genomics, NP 99.82
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 99.81
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.81
1o69_A 394 Aminotransferase; structural genomics, unknown fun 99.81
3kgw_A 393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.81
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 99.81
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.81
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 99.81
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 99.81
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.8
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.8
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.8
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.8
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.8
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.8
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 99.8
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 99.8
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.79
3f0h_A 376 Aminotransferase; RER070207000802, structural geno 99.79
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.79
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.78
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.78
2fnu_A 375 Aminotransferase; protein-product complex, structu 99.78
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.78
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 99.78
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 99.78
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.78
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.78
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 99.77
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.77
2epj_A 434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.77
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.77
3ffr_A 362 Phosphoserine aminotransferase SERC; structural ge 99.76
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 99.76
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 99.76
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 99.76
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.76
3hmu_A 472 Aminotransferase, class III; structural genomics, 99.76
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 99.75
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.75
3nmy_A 400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.75
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.74
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.74
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.73
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.73
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.73
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 99.73
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.72
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.71
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.71
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.71
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 99.68
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.68
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.68
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.67
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.66
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.65
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.64
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.64
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.64
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.63
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.62
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.62
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.61
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.6
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.56
2fyf_A 398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.55
2yky_A 465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.31
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.53
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 99.5
3ke3_A 379 Putative serine-pyruvate aminotransferase; structu 99.5
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.47
1wyu_A 438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.46
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.44
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.36
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 98.82
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 98.74
4ao9_A 454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 98.58
4atq_A 456 4-aminobutyrate transaminase; transferase; HET: PL 98.14
3e77_A 377 Phosphoserine aminotransferase; SERC, PLP, structu 97.85
3qm2_A386 Phosphoserine aminotransferase; structural genomic 97.82
3m5u_A 361 Phosphoserine aminotransferase; alpha-beta half sa 97.81
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 97.8
4e3q_A 473 Pyruvate transaminase; aminotransferase, transfera 97.65
3ou5_A 490 Serine hydroxymethyltransferase, mitochondrial; st 97.6
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
Probab=100.00  E-value=2.1e-58  Score=444.64  Aligned_cols=312  Identities=29%  Similarity=0.550  Sum_probs=271.3

Q ss_pred             cccccccCCCCCCCchhhHHHHHhcCCCCCeeEeeeeeeecCCCCcccchHHHHHHHHh--cCcCCCCCCCCCCCHHHHH
Q 047180           23 MSSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRI--AGTANMEYLPMGGSVKMVE  100 (337)
Q Consensus        23 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~G~~~~~~~~~~~~~~v~~a~~~~--~~~~~~~Y~~~~G~~~lr~  100 (337)
                      |.|+|++++..++++++++.+.++++..+++|||++|.|.++++++++++.+++|.+ +  +....++|+|..|.++||+
T Consensus         1 ~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~I~l~~G~~~d~~~~~~~~~~v~~a~~-~~~~~~~~~~Y~~~~G~~~lr~   79 (405)
T 3k7y_A            1 MDKLLSSLENIEVDNILKTAREFKEDTCEEKINLSIGVCCNDDGDLHIFDSVLNADK-LVTENYKEKPYLLGNGTEDFST   79 (405)
T ss_dssp             CCCGGGGCCCCCCCHHHHHHHHHTTSSCSSCEECSCSSCBCTTSSBCCCHHHHHHHH-HHHHHCCCCCCCTTSSCHHHHH
T ss_pred             CcchhhcCCCCCCChHHHHHHHHhcCCCcCcEEeeeeeeECCCCCCcccHHHHHHHH-HhcCCCCCCCCCCCCCcHHHHH
Confidence            668899999999999999999999888889999999998888887888999999876 5  3345679999999999999


Q ss_pred             HHHHHHhCCCCcccccCceeEEeeccchhHHHHHHHHHhhhCCCCeEEEcCCCCcchHHHHHhcCceeeEeeeccCCCCC
Q 047180          101 ETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTKG  180 (337)
Q Consensus       101 aia~~~~~~~~~~~~~~~i~~~~t~g~~~al~~~~~~l~~~~pgd~Vlv~~P~y~~y~~~~~~~G~~~~~~~~~~~~~~~  180 (337)
                      ++++|+++++.+.++++++++++|.|+++|+.++++++..+.| |+|++++|+|++|..+++.+|++++.+|+.++++++
T Consensus        80 aia~~~~~~~~~~~~~~~i~i~~t~G~~~al~~~~~~l~~~~~-d~Vlv~~P~y~~~~~~~~~~g~~~~~v~~~~~~~~~  158 (405)
T 3k7y_A           80 LTQNLIFGNNSKYIEDKKICTIQCIGGTGAIFVLLEFLKMLNV-ETLYVTNPPYINHVNMIESRGFNLKYINFFDYNLID  158 (405)
T ss_dssp             HHHHHHHCSSCTTTTTTCEEEEEEEHHHHHHHHHHHHHHTTTC-CEEEEESSCCHHHHHHHHTTTCEEEEECCEETTTTE
T ss_pred             HHHHHHcCCCCccccccceEEEEcCchHHHHHHHHHHHHhcCC-CEEEEeCCCCHhHHHHHHHcCCeEEEEeccccccCC
Confidence            9999998887666667777778999999999999988876557 999999999999999999999999999985555699


Q ss_pred             CChHHHHHHHHcCCCCeEEEEeCCCCCCCCCCCCHHHHHHHHHHHHhcCceeEEcccCCCCCCCCCccchHHHHHhhhcC
Q 047180          181 LDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKDG  260 (337)
Q Consensus       181 ~d~~~l~~~l~~~~~~~~ili~~~p~NPTG~~~s~~~~~~l~~~~~~~~~~ii~De~Y~~~~~~~~~~~~~~~~~~~~~~  260 (337)
                      +|++.+++++.+.+++++++++|+||||||.++|+++|++|+++|++|+++||+||+|.+|.+++...+..+++.+...+
T Consensus       159 ~d~~~l~~~l~~~~~~~~i~l~~~~~NPTG~~~s~~~~~~l~~~~~~~~~~vi~De~Y~~l~~~~~~~~~~~~~~~~~~~  238 (405)
T 3k7y_A          159 INYDLFLNDLRNIPNGSSVILQISCYNPCSVNIEEKYFDEIIEIVLHKKHVIIFDIAYQGFGHTNLEEDVLLIRKFEEKN  238 (405)
T ss_dssp             ECHHHHHHHHHHSCSSCEEEECCSSCTTTCCCCCHHHHHHHHHHHHHHCCEEEEEESCTTTSSSSTTGGGHHHHHHHTTT
T ss_pred             cCHHHHHHHHHhCCCCeEEEEeCCCCCCCCCCCCHHHHHHHHHHHHHCCeEEEEecCcccccCCCcccchHHHHHHHhcC
Confidence            99999999997644456778777779999999999999999999999999999999999998753323344555565556


Q ss_pred             CeEEEEecccccccccccccceeEeeeCCHHHHHHHHHHHHhhhcccccCCChhHHHHHHHHhCCHHHHHHHHhhh
Q 047180          261 HLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEV  336 (337)
Q Consensus       261 ~~~i~~~S~SK~~~~~G~RvG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~w~~el  336 (337)
                      +++++++||||+|||+|||+||++++.+++++++++.+++..+.+..|++++.++|.++..+|+++++.++|.+++
T Consensus       239 ~~~i~~~S~SK~~~l~GlRiG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~q~~~~~~l~~~~l~~~~~~~l  314 (405)
T 3k7y_A          239 IAFSVCQSFSKNMSLYGERAGALHIVCKNQEEKKIVFNNLCFIVRKFYSSPVIHTNRILCQLLNNQNLKLNWIKEL  314 (405)
T ss_dssp             CCEEEEEECTTTSCCTTTTEEEEEEECSSHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHCHHHHHHHHHHH
T ss_pred             CcEEEEeeCCccCCCccccceEEEEEeCCHHHHHHHHHHHHHHHhcccCCCcHHHHHHHHHHhCCHHHHHHHHHHH
Confidence            7999999999999999999999987778899888888888877777888899999999999999988888887665



>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 337
d1ajsa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 5e-70
d7aata_401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 7e-66
d3tata_397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 1e-63
d1yaaa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 8e-62
d2q7wa1396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 4e-59
d2ay1a_394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 4e-58
d1j32a_388 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pho 2e-10
d1gdea_388 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 6e-09
d1b5pa_382 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 2e-07
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Pig (Sus scrofa), cytosolic form [TaxId: 9823]
 Score =  222 bits (565), Expect = 5e-70
 Identities = 141/321 (43%), Positives = 198/321 (61%), Gaps = 8/321 (2%)

Query: 25  SWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRIAG- 83
           S +  V  A    +  +   F  DP P KVN+GVGAYR D+ +P VL  VR+ E+RIA  
Sbjct: 4   SVFAEVPQAQPVLVFKLIADFREDPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQRIANN 63

Query: 84  -TANMEYLPMGGSVKMVEETLKLAYGDNSEFIKDKRIAAVQSLSGTGACRLFADFQKRFH 142
            + N EYLP+ G  +      +LA GD+S  +++KR+  VQSL GTGA R+ A+F  R++
Sbjct: 64  SSLNHEYLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFLARWY 123

Query: 143 -----PDSQIYIPVPTWSNHHNIWRDAHVTQRTFH-YYHPGTKGLDFAALMDDIKNAPNG 196
                 D+ +Y+  PTW NH+ ++  A       + Y+    +GLD    + D++NAP  
Sbjct: 124 NGTNNKDTPVYVSSPTWENHNGVFTTAGFKDIRSYRYWDTEKRGLDLQGFLSDLENAPEF 183

Query: 197 SFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIF 256
           S F+LHACAHNPTG DP+ EQWK+I+  +K +  FPFFD AYQGFASG+ E+DA AIR F
Sbjct: 184 SIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNLEKDAWAIRYF 243

Query: 257 LKDGHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGA 316
           + +G  L  AQS++KN GLY +RVG L+V+ ++    + V SQ+Q++ R  +SNPP  GA
Sbjct: 244 VSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGA 303

Query: 317 LIVSTILGDAELKKLWLKEVQ 337
            IV+  L D EL   W   V+
Sbjct: 304 RIVARTLSDPELFHEWTGNVK 324


>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Length = 388 Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 388 Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Length = 382 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 100.0
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 100.0
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d2r5ea1 418 Kynurenine--oxoglutarate transaminase I {Yellowfev 100.0
d1w7la_ 418 Kynurenine--oxoglutarate transaminase I {Human (Ho 100.0
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 100.0
d2gb3a1 389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 100.0
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 100.0
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 100.0
d1iaya_ 428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1wsta1 403 Multiple substrate aminotransferase, MSAT {Thermoc 100.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 100.0
d1vp4a_ 420 Putative aminotransferase TM1131 {Thermotoga marit 100.0
d1m7ya_ 431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 100.0
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 100.0
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 100.0
d2hoxa1 425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.95
d2aeua1 366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.85
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.81
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.65
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.4
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.4
d1elua_ 381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.29
d1eg5a_ 376 NifS-like protein/selenocysteine lyase {Thermotoga 99.28
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.27
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.26
d1mdoa_ 376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.23
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.18
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.14
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.14
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.13
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.1
d1gc0a_ 392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.07
d1ibja_ 380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.07
d1b9ha_ 384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.06
d1jf9a_ 405 NifS-like protein/selenocysteine lyase {Escherichi 99.05
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.03
d1y4ia1 397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.01
d1o69a_ 374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 98.96
d1cs1a_ 384 Cystathionine gamma-synthase, CGS {Escherichia col 98.96
d1qgna_ 398 Cystathionine gamma-synthase, CGS {Common tobacco 98.88
d1pffa_ 331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 98.79
d2ctza1 421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 98.72
d1cl1a_ 391 Cystathionine beta-lyase, CBL {Escherichia coli [T 98.71
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 98.7
d1pmma_ 450 Glutamate decarboxylase beta, GadB {Escherichia co 98.62
d1e5ea_ 394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 98.62
d1n8pa_ 393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 98.56
d1t3ia_ 408 Probable cysteine desulfurase SufS {Synechocystis 98.54
d2fnua1 371 Spore coat polysaccharide biosynthesis protein C { 98.53
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 98.44
d2bkwa1 382 Alanine-glyoxylate aminotransferase {Baker's yeast 98.4
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 98.29
d1qz9a_ 404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 98.23
d1js3a_ 476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 98.21
d1h0ca_ 388 Alanine-glyoxylate aminotransferase {Human (Homo s 98.19
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 98.16
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 98.15
d1m32a_ 361 2-aminoethylphosphonate transaminase {Salmonella t 98.14
d1kl1a_ 405 Serine hydroxymethyltransferase {Bacillus stearoth 98.1
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 98.08
d1dfoa_ 416 Serine hydroxymethyltransferase {Escherichia coli 97.96
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 97.87
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 97.82
d2ch1a1 388 3-hydroxykynurenine transaminase {Malaria mosquito 97.78
d1vjoa_ 377 Alanine-glyoxylate aminotransferase {Cyanobacteria 97.66
d2a7va1 463 Serine hydroxymethyltransferase {Human (Homo sapie 97.58
d1rv3a_ 470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 97.49
d1iuga_ 348 Subgroup IV putative aspartate aminotransferase {T 97.24
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 97.24
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 97.05
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 96.27
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 92.23
d1wyua1 437 Glycine dehydrogenase (decarboxylating) subunit 1 91.09
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 90.69
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Chicken (Gallus gallus), mitochondria [TaxId: 9031]
Probab=100.00  E-value=1.4e-54  Score=414.84  Aligned_cols=311  Identities=53%  Similarity=0.905  Sum_probs=260.9

Q ss_pred             ccccccCCCCCCCchhhHHHHHhcCCCCCeeEeeeeeeecCCCCcccchHHHHHHHHh-cCcCCCCCCCCCCCHHHHHHH
Q 047180           24 SSWWRNVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDNGKPVVLECVREAERRI-AGTANMEYLPMGGSVKMVEET  102 (337)
Q Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~G~~~~~~~~~~~~~~v~~a~~~~-~~~~~~~Y~~~~G~~~lr~ai  102 (337)
                      .|+|++++..|+|+|+++++.++++.++++|||++|.+.+++++++++++|++|.+.+ ..+..++|+|..|+++||+++
T Consensus         1 ~~~~~~~~~~p~d~i~~~~~~~~~d~~~~~InL~iG~~~d~~~~~~~~~~V~~a~~~~~~~~~~~~Y~~~~G~~~lr~ai   80 (401)
T d7aata_           1 SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRAS   80 (401)
T ss_dssp             CCSSTTCCCCCCCHHHHHHHHHHHCCCTTCEECCCCSCCCTTSCCCCCHHHHHHHHHHHHTTCCCCCCCTTCCHHHHHHH
T ss_pred             CCccccCCCCCCChHHHHHHHHhCCCCCCcEEccCCCCcCCCCCCCCCHHHHHHHHHHhhCCCCCCCCCCCCCHHHHHHH
Confidence            3779999999999999999999999999999999999999999998999999998876 445567899999999999999


Q ss_pred             HHHHhCCCCcccccCceeEEeeccchhHHHHH---HHHHhhhCCCCeEEEcCCCCcchHHHHHhcCceeeEeeeccCCCC
Q 047180          103 LKLAYGDNSEFIKDKRIAAVQSLSGTGACRLF---ADFQKRFHPDSQIYIPVPTWSNHHNIWRDAHVTQRTFHYYHPGTK  179 (337)
Q Consensus       103 a~~~~~~~~~~~~~~~i~~~~t~g~~~al~~~---~~~l~~~~pgd~Vlv~~P~y~~y~~~~~~~G~~~~~~~~~~~~~~  179 (337)
                      ++|++++++...+++++....+.++++++..+   ++.+.+  |||+|++++|+|++|..+++.+|++++++|+.+++++
T Consensus        81 a~~~~~~~~~~~~~~~i~~~~~~~~~g~~~~~~~~~~~l~~--pGd~Vlv~~P~y~~y~~~~~~~g~~~~~~~~~~~~~~  158 (401)
T d7aata_          81 AELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFK--FSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTC  158 (401)
T ss_dssp             HHHHHCTTCHHHHTTCEEEEEEEHHHHHHHHHHHHHHHHCT--TCCEEEEEESCCTTHHHHHHHTTCEEEEEECEETTTT
T ss_pred             HHHHhccCCcccCcCceEEeccchHHHHHHHHHHhhHhhcC--CCceEEEecCCCcchhhHHHHcCCeEEEEeccccccc
Confidence            99999988777777776444444555555444   344444  9999999999999999999999999999999777678


Q ss_pred             CCChHHHHHHHHcCCCCeEEEEeCCCCCCCCCCCCHHHHHHHHHHHHhcCceeEEcccCCCCCCCCCccchHHHHHhhhc
Q 047180          180 GLDFAALMDDIKNAPNGSFFLLHACAHNPTGVDPSEEQWKEISYQIKAKGHFPFFDMAYQGFASGDPERDAKAIRIFLKD  259 (337)
Q Consensus       180 ~~d~~~l~~~l~~~~~~~~ili~~~p~NPTG~~~s~~~~~~l~~~~~~~~~~ii~De~Y~~~~~~~~~~~~~~~~~~~~~  259 (337)
                      ..|++.+.+.+....++++++++||||||||.++|++++++|+++|++|+++||+||+|.+|.+++..........+...
T Consensus       159 ~~~~~~~~~~~~~~~~~~~~iii~~p~NPTG~~~s~e~~~~l~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~  238 (401)
T d7aata_         159 SLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQ  238 (401)
T ss_dssp             EECHHHHHHHHTTSCTTCEEEEESSSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEEESCTTTTTSCHHHHTHHHHHHHHT
T ss_pred             cccHHHHHHHHhcCCCceEEEEecCCCCCccccCCHHHHHHHHHHHhcceEEEEEeccchhhhcCCcccchhhhhhhhhh
Confidence            88999998888765556677777999999999999999999999999999999999999999875321111222223344


Q ss_pred             CCeEEEEecccccccccccccceeEeeeCCHHHHHHHHHHHHhhhcccccCCChhHHHHHHHHhCCHHHHHHHHhhh
Q 047180          260 GHLLGLAQSYAKNMGLYGQRVGCLSVLCEDEKQAVAVKSQLQQLARPMYSNPPVHGALIVSTILGDAELKKLWLKEV  336 (337)
Q Consensus       260 ~~~~i~~~S~SK~~~~~G~RvG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~w~~el  336 (337)
                      ..+++++.|+||.|+++|||+||++++....+...++...+....+..+.+++.+.|.++..++.++.+.++|.+++
T Consensus       239 ~~~~~~~~s~sk~~~~~G~RiG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~~~~~~  315 (401)
T d7aata_         239 GIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEV  315 (401)
T ss_dssp             TCCCEEEEECTTTSCCGGGCEEEEEEECSSHHHHHHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHCHHHHHHHHHHH
T ss_pred             hcccceeEeccccceeeccccceeecchHHHHHHHHHHHHHHHHhhccccccchHHHHHHHHhcCCHHHHHHHHHHH
Confidence            57899999999999999999999999877777777777777777777888999999999999999998877776543



>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure