Citrus Sinensis ID: 047191
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 341 | ||||||
| 296086764 | 348 | unnamed protein product [Vitis vinifera] | 0.923 | 0.905 | 0.289 | 8e-21 | |
| 147812093 | 607 | hypothetical protein VITISV_040899 [Viti | 0.941 | 0.528 | 0.280 | 1e-19 | |
| 22328947 | 419 | F-box/FBD/LRR-repeat protein [Arabidopsi | 0.888 | 0.723 | 0.282 | 8e-15 | |
| 15219960 | 434 | F-box/RNI-like/FBD-like domains-containi | 0.862 | 0.677 | 0.292 | 1e-14 | |
| 297819758 | 426 | F-box family protein [Arabidopsis lyrata | 0.903 | 0.723 | 0.273 | 7e-14 | |
| 296086770 | 411 | unnamed protein product [Vitis vinifera] | 0.862 | 0.715 | 0.266 | 1e-13 | |
| 297844624 | 452 | F-box family protein [Arabidopsis lyrata | 0.926 | 0.699 | 0.265 | 2e-13 | |
| 4539430 | 374 | putative protein [Arabidopsis thaliana] | 0.697 | 0.636 | 0.286 | 2e-13 | |
| 297812929 | 457 | hypothetical protein ARALYDRAFT_489554 [ | 0.958 | 0.715 | 0.266 | 3e-13 | |
| 297844280 | 455 | F16A14.1 [Arabidopsis lyrata subsp. lyra | 0.917 | 0.687 | 0.255 | 3e-13 |
| >gi|296086764|emb|CBI32913.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 107 bits (267), Expect = 8e-21, Method: Compositional matrix adjust.
Identities = 101/349 (28%), Positives = 166/349 (47%), Gaps = 34/349 (9%)
Query: 7 INALPDSVLCHILSYLPTKNVVATSILARRWKLVWTSLQKLYFDDRQSRRLPGM--MGDP 64
I+ LPD +LCHILS+LPTK V TSIL++RW+ +W S+ L FDD + + +
Sbjct: 12 ISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNPSTLVELEER 71
Query: 65 MPGFEDFIERVLTGTQPMNITIFFMHCSKLLGVMLGRLNYILTRITALSCLCQIELYASP 124
+ F++F++ VL ++ I F LG L+ + + +C+
Sbjct: 72 IIMFQNFVDGVLRHSEVSCIKKF------RLGYRDNNLDNWGVELPPMFFICK------- 118
Query: 125 SVEVLKLMSDFLLKVPAGGTCFPNVKILTMQ-LESPDNILTEKLFCSCPSLEELSIQAYL 183
++ V+KL L +P P++K L ++ +E D+ +KL CP LEEL I+
Sbjct: 119 TLVVVKLSCALFLDIPT-TVWLPSLKALHLKSVEYSDDDSIQKLLSGCPVLEELVIEREE 177
Query: 184 NDEGPTTKFVISSSTLKQCTLWVETEG--EMFTQA--EYKVRITAPSLERLHIMSDIFGK 239
D +S+ +LK ++ T+G + Q +YKV + AP+LE L I +
Sbjct: 178 RDNQWVVN--VSNPSLKILRIFFFTDGFAHPYEQEDQDYKVVVDAPNLEYLSITDYLSKD 235
Query: 240 FVVHDLNSLTDVILDIVYG--EWSRVDPNRSI-------QLLQQLNNTTSLTVSYGVLCA 290
+ V DL SL +D+ E+ N I +LL +++N L+++ GV
Sbjct: 236 YFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPIYELLGRISNVKCLSLT-GVTLD 294
Query: 291 LDHAYHKWFPALSYLQHLE-VAVGAIGWAVLPVILSSSVHLQSLVLRKV 338
+ P + LE + +G W LP L SS +L++LV+ V
Sbjct: 295 VSFLCPPILPTFHNMTCLEFLFIGGFNWDFLPNFLHSSPNLEALVIETV 343
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|22328947|ref|NP_194364.2| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75244651|sp|Q8H1R7.1|FDL27_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At4g26340 gi|23296372|gb|AAN13055.1| unknown protein [Arabidopsis thaliana] gi|332659787|gb|AEE85187.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15219960|ref|NP_173138.1| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana] gi|75263253|sp|Q9FZ53.1|FDL4_ARATH RecName: Full=Putative F-box/FBD/LRR-repeat protein At1g16940 gi|9802770|gb|AAF99839.1|AC051629_6 Hypothetical protein [Arabidopsis thaliana] gi|332191403|gb|AEE29524.1| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297819758|ref|XP_002877762.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297323600|gb|EFH54021.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|296086770|emb|CBI32919.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297844624|ref|XP_002890193.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297336035|gb|EFH66452.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|4539430|emb|CAB38963.1| putative protein [Arabidopsis thaliana] gi|7269486|emb|CAB79489.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297812929|ref|XP_002874348.1| hypothetical protein ARALYDRAFT_489554 [Arabidopsis lyrata subsp. lyrata] gi|297320185|gb|EFH50607.1| hypothetical protein ARALYDRAFT_489554 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297844280|ref|XP_002890021.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata] gi|297335863|gb|EFH66280.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 341 | ||||||
| TAIR|locus:2136834 | 419 | AT4G26340 "AT4G26340" [Arabido | 0.697 | 0.568 | 0.286 | 2e-17 | |
| TAIR|locus:2101674 | 427 | AT3G50710 "AT3G50710" [Arabido | 0.706 | 0.564 | 0.285 | 8e-16 | |
| TAIR|locus:2161053 | 422 | AT5G56420 "AT5G56420" [Arabido | 0.697 | 0.563 | 0.271 | 6.8e-14 | |
| TAIR|locus:2055993 | 448 | AT2G04230 "AT2G04230" [Arabido | 0.648 | 0.493 | 0.297 | 1.4e-13 | |
| TAIR|locus:2165071 | 435 | AT5G56810 [Arabidopsis thalian | 0.692 | 0.542 | 0.294 | 2.1e-12 | |
| TAIR|locus:2081157 | 520 | AT3G59200 "AT3G59200" [Arabido | 0.692 | 0.453 | 0.286 | 2.4e-12 | |
| TAIR|locus:2089566 | 442 | AT3G14710 "AT3G14710" [Arabido | 0.721 | 0.556 | 0.278 | 3.8e-12 | |
| TAIR|locus:2015571 | 434 | AT1G16940 "AT1G16940" [Arabido | 0.680 | 0.534 | 0.322 | 6.3e-12 | |
| TAIR|locus:2014859 | 456 | AT1G13780 "AT1G13780" [Arabido | 0.392 | 0.293 | 0.314 | 9.8e-12 | |
| TAIR|locus:2015681 | 449 | AT1G16930 "AT1G16930" [Arabido | 0.217 | 0.164 | 0.378 | 1.9e-11 |
| TAIR|locus:2136834 AT4G26340 "AT4G26340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 226 (84.6 bits), Expect = 2.0e-17, P = 2.0e-17
Identities = 77/269 (28%), Positives = 132/269 (49%)
Query: 6 RINALPDSVLCHILSYLPTKNVVATSILARRWKLVWTSLQKLYFDDRQSRRLPGMMGDPM 65
RI+ L D +L ILS++P K+VVATS+L++RW+ +W + +L +DD GD
Sbjct: 3 RISQLSDDLLLQILSFIPGKDVVATSLLSKRWQSLWMLVSELEYDDSYHT------GD-Y 55
Query: 66 PGFEDFIERVLTGTQPMNITIFFMH----CSKL-LGVMLG-----RLNYILTRITALSCL 115
F F+ R L I ++ C + +G+ +G RL + I S
Sbjct: 56 KSFSQFVYRSLLSNNAPVIKHLHLNLGPDCPAIDIGLWIGFALTRRLRQLKINIRTSSND 115
Query: 116 CQIEL----YASPSVEVLKLMSDFLLKVPAGGTCFPNVKILTMQ-LESPDNILTEKLFCS 170
L Y S ++E L+L++ LL VP+ C P++K+L ++ ++ D+ L
Sbjct: 116 ASFSLPSSLYTSDTLETLRLINFVLLDVPSS-VCLPSLKVLHLKTVDYEDDASLPSLLFG 174
Query: 171 CPSLEELSIQAYLNDEGPTTKFVISSSTLKQCTLWVETEGEMFTQAEYKVRITAPSLERL 230
CP+LEEL ++ + D FV+ S L++ ++ + G Q + V I PSL+ L
Sbjct: 175 CPNLEELFVERHDQDLEMDVTFVVPS--LRRLSMIDKNYG----QCDRYV-IDVPSLKYL 227
Query: 231 HIMSD-IFGKFVVHDLNSLTDVILDIVYG 258
+I D ++ + ++ L + +DI G
Sbjct: 228 NITDDAVYDVRQIENMPELVEAHVDITQG 256
|
|
| TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161053 AT5G56420 "AT5G56420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2055993 AT2G04230 "AT2G04230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2165071 AT5G56810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081157 AT3G59200 "AT3G59200" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089566 AT3G14710 "AT3G14710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015571 AT1G16940 "AT1G16940" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014859 AT1G13780 "AT1G13780" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00000972001 | SubName- Full=Chromosome chr19 scaffold_111, whole genome shotgun sequence; (360 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 341 | |||
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 6e-04 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Score = 36.8 bits (86), Expect = 6e-04
Identities = 14/47 (29%), Positives = 26/47 (55%)
Query: 6 RINALPDSVLCHILSYLPTKNVVATSILARRWKLVWTSLQKLYFDDR 52
+ LPD +L ILS L K+++ S++++RW+ + SL+
Sbjct: 2 SLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVDSLKLWKKRLL 48
|
This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 341 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.61 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.25 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.84 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.48 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.29 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.14 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.02 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.87 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.82 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.75 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.62 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.61 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.6 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.5 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.4 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.18 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.16 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.09 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.92 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.72 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.59 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.71 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.53 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.47 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.42 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 95.38 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 95.21 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.02 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.99 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 94.9 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.48 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 94.21 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 94.02 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 93.54 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 93.53 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 93.05 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 92.16 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 91.79 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 90.43 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 90.23 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 90.14 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 88.29 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 87.99 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 87.69 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 87.55 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 87.39 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 87.23 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 86.31 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 84.96 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 84.64 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 83.55 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 82.78 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 82.73 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 82.27 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 81.67 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 81.5 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 81.26 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 80.18 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.61 E-value=6.9e-17 Score=137.91 Aligned_cols=275 Identities=19% Similarity=0.144 Sum_probs=169.4
Q ss_pred cCCCChHHHHHHHcCCChhhhhhhhccccchHHhhcc---CceeEeecCCCCCCCCCCCCCcchHHHHHHHHhcCCCCE-
Q 047191 7 INALPDSVLCHILSYLPTKNVVATSILARRWKLVWTS---LQKLYFDDRQSRRLPGMMGDPMPGFEDFIERVLTGTQPM- 82 (341)
Q Consensus 7 is~LPd~iL~~Ils~Lp~~~~~~~s~vskrWr~lw~~---~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~i- 82 (341)
...|||||+..|||.|+.||+.+.+.|||||+++-+- ...++...+... +. ...+.+.++--+
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~---------p~----~l~~l~~rgV~v~ 164 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIH---------PD----VLGRLLSRGVIVF 164 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccC---------hh----HHHHHHhCCeEEE
Confidence 4579999999999999999999999999999976432 112333333321 11 222222233333
Q ss_pred EEEEEEeecCCCchhHHHHHHHHhcccccccccc--------cccccccCcceEEEEeeeeeeccCCC--cccCCchhhh
Q 047191 83 NITIFFMHCSKLLGVMLGRLNYILTRITALSCLC--------QIELYASPSVEVLKLMSDFLLKVPAG--GTCFPNVKIL 152 (341)
Q Consensus 83 ~l~l~~~~~~~~~~~~~~wl~~~~~~l~~L~~~~--------p~~~~~~~~L~~L~L~~~~~l~~~~~--~~~~~~L~~L 152 (341)
++.-.+ ...+... .-..-...++|.++..- ...+..|..|+.|+| .+..+.++.. ...-.+|+.|
T Consensus 165 Rlar~~---~~~prla-e~~~~frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSl-Eg~~LdD~I~~~iAkN~~L~~l 239 (419)
T KOG2120|consen 165 RLARSF---MDQPRLA-EHFSPFRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSL-EGLRLDDPIVNTIAKNSNLVRL 239 (419)
T ss_pred Ecchhh---hcCchhh-hhhhhhhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccc-cccccCcHHHHHHhccccceee
Confidence 443222 1111111 11111122266664322 233456999999999 8888876531 2234899999
Q ss_pred hhhccC---CCcchHHHHHhcCCccceeEEeeeecCCCCce-eEEEeCCCcceEEEeeecCccccccCceeEEEecCCce
Q 047191 153 TMQLES---PDNILTEKLFCSCPSLEELSIQAYLNDEGPTT-KFVISSSTLKQCTLWVETEGEMFTQAEYKVRITAPSLE 228 (341)
Q Consensus 153 ~~~L~~---~~~~~l~~ll~~cp~Le~L~L~~c~~~~~~~~-~l~i~~~sL~~L~i~~c~~~~~~~~~~~~~~~~~p~L~ 228 (341)
+|.. +++.+++-++++|..|.+|+|..|....-.++ .+.--+++|+.|++++|. ..+..+....++-.+|+|.
T Consensus 240 --nlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~r-rnl~~sh~~tL~~rcp~l~ 316 (419)
T KOG2120|consen 240 --NLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYR-RNLQKSHLSTLVRRCPNLV 316 (419)
T ss_pred --ccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhH-hhhhhhHHHHHHHhCCcee
Confidence 8888 99999999999999999999999966421110 122246889999999963 2322234555666789999
Q ss_pred EEEeeccccCceeecCCCCeeEEEEEEEeCccccCCCccchHHhhcCCCceEEEEecch-hhhccccccCCCCCCCcccE
Q 047191 229 RLHIMSDIFGKFVVHDLNSLTDVILDIVYGEWSRVDPNRSIQLLQQLNNTTSLTVSYGV-LCALDHAYHKWFPALSYLQH 307 (341)
Q Consensus 229 ~l~~~~~~~~~~~~~~~~~L~~~~l~~~~~~~~~~~~~~~~~~l~~~~~l~~L~l~~~~-~~~~~~~~~~~~~~f~~L~~ 307 (341)
.|+++++..-+.. ..+.+-.++-+++|.++-.. +..- ....+..-|.|+.
T Consensus 317 ~LDLSD~v~l~~~--------------------------~~~~~~kf~~L~~lSlsRCY~i~p~---~~~~l~s~psl~y 367 (419)
T KOG2120|consen 317 HLDLSDSVMLKND--------------------------CFQEFFKFNYLQHLSLSRCYDIIPE---TLLELNSKPSLVY 367 (419)
T ss_pred eeccccccccCch--------------------------HHHHHHhcchheeeehhhhcCCChH---HeeeeccCcceEE
Confidence 9999876542110 04444456677777775422 1000 0111224567999
Q ss_pred EEEEEcCCChhHHHHHHhcCCCCCc
Q 047191 308 LEVAVGAIGWAVLPVILSSSVHLQS 332 (341)
Q Consensus 308 L~l~~~~~~~~~l~~ll~~cp~L~~ 332 (341)
|++..+ ..+..+..+.+.||+|+.
T Consensus 368 Ldv~g~-vsdt~mel~~e~~~~lki 391 (419)
T KOG2120|consen 368 LDVFGC-VSDTTMELLKEMLSHLKI 391 (419)
T ss_pred EEeccc-cCchHHHHHHHhCccccc
Confidence 999887 333456778899999875
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 341 | |||
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 1e-04 |
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
Score = 38.4 bits (90), Expect = 1e-04
Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 6/48 (12%)
Query: 3 PAYRINALPDSVLCHILSYLPTKNVVATSILARRWKLV------WTSL 44
P ++LPD +L I S L ++ S + +RW + W +L
Sbjct: 5 PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTL 52
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 341 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.77 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.77 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.73 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.88 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.85 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.81 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.66 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.63 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.63 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.6 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.59 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.54 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.54 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.5 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.48 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.48 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.46 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.44 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.37 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.37 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.33 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.31 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.3 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.3 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.29 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.29 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.28 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.27 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.26 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.25 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.24 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.23 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.22 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.21 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.19 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.18 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.18 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.16 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.13 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.12 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.12 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.12 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.11 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.11 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.1 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.08 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.07 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.01 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.01 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.0 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.98 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.98 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.98 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.97 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.96 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.94 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.93 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.92 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.91 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.9 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.9 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.89 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.89 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.88 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.88 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.86 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.86 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.81 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.81 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.81 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.81 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.77 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.77 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.76 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.72 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.72 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.71 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.7 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.69 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.69 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.67 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.65 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.62 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.62 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.6 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.59 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.55 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.54 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.5 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.49 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.47 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.47 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.4 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.4 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.39 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.36 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.34 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.31 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.29 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.25 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.21 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.16 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.11 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.11 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.09 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.99 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.97 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.97 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.88 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 96.77 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 96.76 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.7 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.66 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 96.63 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.54 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.42 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.4 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.4 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.24 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.17 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.15 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.03 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 95.81 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.68 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 95.6 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 95.51 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 95.45 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 95.01 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 95.01 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 94.92 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 94.84 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 94.77 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 94.65 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 94.58 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 94.15 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.03 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 94.02 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 93.46 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 93.0 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 92.7 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 92.5 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 92.43 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 90.48 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 90.27 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 89.3 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 88.33 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 88.23 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 87.21 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 87.14 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 86.83 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 85.71 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 83.87 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 83.46 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 83.41 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 82.32 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=99.77 E-value=2.4e-20 Score=181.82 Aligned_cols=162 Identities=15% Similarity=0.173 Sum_probs=84.3
Q ss_pred CCCccCCCChHHHHHHHcCCC-hhhhhhhhccccchHHhhc-cCceeEeecCCCCCCCCCCCCCcchHHHHHHHHhcCCC
Q 047191 3 PAYRINALPDSVLCHILSYLP-TKNVVATSILARRWKLVWT-SLQKLYFDDRQSRRLPGMMGDPMPGFEDFIERVLTGTQ 80 (341)
Q Consensus 3 ~~d~is~LPd~iL~~Ils~Lp-~~~~~~~s~vskrWr~lw~-~~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~ 80 (341)
..|++++|||||+.+||+||| .+|+++++.|||||+++.. ....+.+..... ..-. ..+.+-+
T Consensus 2 ~~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~-----------~~~~----~~~~~~~ 66 (594)
T 2p1m_B 2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYA-----------VSPA----TVIRRFP 66 (594)
T ss_dssp --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTS-----------SCHH----HHHHHCT
T ss_pred cccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccc-----------cCHH----HHHhhCC
Confidence 358999999999999999999 9999999999999998832 222344332111 0011 1222335
Q ss_pred CE-EEEEEEeecC---------CCchhHHHHHHHHhcc---cccccccc-------ccccc-ccCcceEEEEeeee-eec
Q 047191 81 PM-NITIFFMHCS---------KLLGVMLGRLNYILTR---ITALSCLC-------QIELY-ASPSVEVLKLMSDF-LLK 138 (341)
Q Consensus 81 ~i-~l~l~~~~~~---------~~~~~~~~wl~~~~~~---l~~L~~~~-------p~~~~-~~~~L~~L~L~~~~-~l~ 138 (341)
.+ ++.+.. ... .+...+..|+..+... +++|+..+ +..+. .|++|++|+| .+| .+.
T Consensus 67 ~L~~L~L~~-~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~~l~~~~~~L~~L~L-~~~~~~~ 144 (594)
T 2p1m_B 67 KVRSVELKG-KPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVL-SSCEGFS 144 (594)
T ss_dssp TCCEEEEEC-SCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCHHHHHHHHHHCTTCCEEEE-ESCEEEE
T ss_pred CceEEeccC-CCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEcHHHHHHHHHhCCCCcEEeC-CCcCCCC
Confidence 57 887776 321 1234566788776543 44443211 11222 3566666666 443 332
Q ss_pred c--CCC-cccCCchhhhhhhccC--CCc---chHHHHHhcCCccceeEEeeee
Q 047191 139 V--PAG-GTCFPNVKILTMQLES--PDN---ILTEKLFCSCPSLEELSIQAYL 183 (341)
Q Consensus 139 ~--~~~-~~~~~~L~~L~~~L~~--~~~---~~l~~ll~~cp~Le~L~L~~c~ 183 (341)
. .+. ..++++|++| +|.+ +++ ..+..+...||+|+.|++.+|.
T Consensus 145 ~~~l~~~~~~~~~L~~L--~L~~~~i~~~~~~~l~~~~~~~~~L~~L~l~~~~ 195 (594)
T 2p1m_B 145 TDGLAAIAATCRNLKEL--DLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLA 195 (594)
T ss_dssp HHHHHHHHHHCTTCCEE--ECTTCEEECCCGGGGGGSCTTCCCCCEEECTTCC
T ss_pred HHHHHHHHHhCCCCCEE--eCcCCccCCcchHHHHHHhhcCCcCcEEEecccC
Confidence 1 101 1245666666 6655 222 2344444456666666666554
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 341 | ||||
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 2e-05 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 3e-05 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 0.002 |
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: F-box/WD repeat-containing protein 7, FBXW7 species: Human (Homo sapiens) [TaxId: 9606]
Score = 40.8 bits (95), Expect = 2e-05
Identities = 9/33 (27%), Positives = 19/33 (57%)
Query: 6 RINALPDSVLCHILSYLPTKNVVATSILARRWK 38
I+ LP + ++LS+L K+++ + R W+
Sbjct: 18 FISLLPKELALYVLSFLEPKDLLQAAQTCRYWR 50
|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 341 | |||
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.86 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.85 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.77 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.76 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.51 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.39 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.24 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.2 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.84 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.78 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.7 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.62 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.61 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.52 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.52 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.46 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.27 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.1 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.03 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 96.99 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.98 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.92 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.67 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.6 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.36 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 95.96 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 95.85 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 95.6 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 95.26 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.22 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.11 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 93.84 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 93.74 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 93.47 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 93.01 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 92.61 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 88.09 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 86.44 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 86.25 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 81.42 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 81.42 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 80.95 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 80.17 |
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.08 E-value=2.9e-11 Score=71.70 Aligned_cols=34 Identities=29% Similarity=0.481 Sum_probs=32.4
Q ss_pred CCCChHHHHHHHcCCChhhhhhhhccccchHHhh
Q 047191 8 NALPDSVLCHILSYLPTKNVVATSILARRWKLVW 41 (341)
Q Consensus 8 s~LPd~iL~~Ils~Lp~~~~~~~s~vskrWr~lw 41 (341)
+.||+|++.+||++||.+|+++++.|||+|+++-
T Consensus 2 ~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~ 35 (41)
T d1fs1a1 2 DSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLA 35 (41)
T ss_dssp CSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHH
T ss_pred CcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh
Confidence 6899999999999999999999999999999875
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|