Citrus Sinensis ID: 047283
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| 147667132 | 337 | beta-1,3-glucanase [Citrus unshiu] | 0.990 | 0.296 | 0.940 | 2e-49 | |
| 2274915 | 336 | beta-1,3-glucanase [Citrus sinensis] | 1.0 | 0.300 | 0.871 | 5e-47 | |
| 63333659 | 336 | beta-1,3-glucanase class III [Citrus cle | 0.980 | 0.294 | 0.871 | 1e-44 | |
| 117938450 | 309 | beta-1,3-glucanase [Manihot esculenta] | 0.980 | 0.320 | 0.732 | 2e-37 | |
| 313600351 | 346 | beta-1,3-glucanase [Malus hupehensis] | 0.970 | 0.283 | 0.722 | 7e-37 | |
| 16903144 | 343 | beta-1,3-glucanase [Prunus persica] | 0.970 | 0.285 | 0.722 | 3e-36 | |
| 256372804 | 346 | beta-1,3-glucanase [Malus hupehensis] | 0.970 | 0.283 | 0.702 | 5e-36 | |
| 224139886 | 204 | predicted protein [Populus trichocarpa] | 0.960 | 0.475 | 0.72 | 6e-36 | |
| 6960214 | 343 | beta-1,3 glucanase [Populus tremula x Po | 0.960 | 0.282 | 0.71 | 9e-36 | |
| 320090193 | 343 | 1,3-beta-D-glucanase GH17_101 [Populus t | 0.960 | 0.282 | 0.71 | 9e-36 |
| >gi|147667132|gb|ABQ45848.1| beta-1,3-glucanase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
Score = 199 bits (507), Expect = 2e-49, Method: Compositional matrix adjust.
Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 1/101 (0%)
Query: 1 LDATYAALEKAGGGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKPD 60
LDATYAALEKAGGGSLDIVISE GWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKP
Sbjct: 238 LDATYAALEKAGGGSLDIVISERGWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKP- 296
Query: 61 RPIETYIFAMFDEKDKQGAEIERHWGLFAPDKQSKYQVNFN 101
RPIETYIFAMFDEKDK+G EIERHWGLF+PDKQ+KYQVNFN
Sbjct: 297 RPIETYIFAMFDEKDKKGDEIERHWGLFSPDKQTKYQVNFN 337
|
Source: Citrus unshiu Species: Citrus unshiu Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|2274915|emb|CAA03908.1| beta-1,3-glucanase [Citrus sinensis] | Back alignment and taxonomy information |
|---|
| >gi|63333659|gb|AAY40462.1| beta-1,3-glucanase class III [Citrus clementina x Citrus reticulata] | Back alignment and taxonomy information |
|---|
| >gi|117938450|gb|ABK58141.1| beta-1,3-glucanase [Manihot esculenta] | Back alignment and taxonomy information |
|---|
| >gi|313600351|gb|ADR71671.1| beta-1,3-glucanase [Malus hupehensis] | Back alignment and taxonomy information |
|---|
| >gi|16903144|gb|AAL30426.1|AF435089_1 beta-1,3-glucanase [Prunus persica] | Back alignment and taxonomy information |
|---|
| >gi|256372804|gb|ACU78080.1| beta-1,3-glucanase [Malus hupehensis] | Back alignment and taxonomy information |
|---|
| >gi|224139886|ref|XP_002323325.1| predicted protein [Populus trichocarpa] gi|222867955|gb|EEF05086.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|6960214|gb|AAF33405.1|AF230109_1 beta-1,3 glucanase [Populus tremula x Populus alba] | Back alignment and taxonomy information |
|---|
| >gi|320090193|gb|ADW08746.1| 1,3-beta-D-glucanase GH17_101 [Populus tremula x Populus tremuloides] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| TAIR|locus:2082518 | 341 | BG3 ""beta-1,3-glucanase 3"" [ | 0.980 | 0.290 | 0.722 | 1.1e-34 | |
| TAIR|locus:2082543 | 339 | BGL2 ""beta-1,3-glucanase 2"" | 0.970 | 0.289 | 0.673 | 4.1e-33 | |
| TAIR|locus:2082568 | 340 | BG1 ""beta-1,3-glucanase 1"" [ | 0.970 | 0.288 | 0.594 | 3e-30 | |
| TAIR|locus:2130329 | 344 | AT4G16260 [Arabidopsis thalian | 0.970 | 0.284 | 0.514 | 1.2e-24 | |
| TAIR|locus:2164991 | 506 | AT5G56590 [Arabidopsis thalian | 0.990 | 0.197 | 0.451 | 4.2e-20 | |
| TAIR|locus:2093232 | 399 | AT3G15800 [Arabidopsis thalian | 0.970 | 0.245 | 0.435 | 2.3e-18 | |
| TAIR|locus:2165432 | 438 | AT5G42720 [Arabidopsis thalian | 0.970 | 0.223 | 0.455 | 5.4e-18 | |
| TAIR|locus:2066215 | 388 | AT2G26600 [Arabidopsis thalian | 1.0 | 0.260 | 0.413 | 7.4e-18 | |
| TAIR|locus:2075205 | 356 | AT3G46570 [Arabidopsis thalian | 0.960 | 0.272 | 0.435 | 1.4e-17 | |
| TAIR|locus:2039742 | 549 | AT2G39640 [Arabidopsis thalian | 0.960 | 0.176 | 0.434 | 2.1e-17 |
| TAIR|locus:2082518 BG3 ""beta-1,3-glucanase 3"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 376 (137.4 bits), Expect = 1.1e-34, P = 1.1e-34
Identities = 73/101 (72%), Positives = 80/101 (79%)
Query: 1 LDATYAALEKAGGGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKPD 60
LD YA+LEKAGGGSL+IV+SESGWPTAGG A T VDNARTY NNLIQ VK GSP++P
Sbjct: 243 LDTVYASLEKAGGGSLEIVVSESGWPTAGG--AATGVDNARTYVNNLIQTVKNGSPRRPG 300
Query: 61 RPIETYIFAMFDEKDKQGAEIERHWGLFAPDKQSKYQVNFN 101
R ETYIFAMFDE KQG E E+ WGLF P+ Q KY VNFN
Sbjct: 301 RATETYIFAMFDENSKQGPETEKFWGLFLPNLQPKYVVNFN 341
|
|
| TAIR|locus:2082543 BGL2 ""beta-1,3-glucanase 2"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082568 BG1 ""beta-1,3-glucanase 1"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130329 AT4G16260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2164991 AT5G56590 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093232 AT3G15800 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2165432 AT5G42720 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2066215 AT2G26600 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075205 AT3G46570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039742 AT2G39640 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_XVI1825 | hypothetical protein (204 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| pfam00332 | 310 | pfam00332, Glyco_hydro_17, Glycosyl hydrolases fam | 2e-51 | |
| COG5309 | 305 | COG5309, COG5309, Exo-beta-1,3-glucanase [Carbohyd | 5e-05 |
| >gnl|CDD|215863 pfam00332, Glyco_hydro_17, Glycosyl hydrolases family 17 | Back alignment and domain information |
|---|
Score = 163 bits (414), Expect = 2e-51
Identities = 61/100 (61%), Positives = 79/100 (79%), Gaps = 2/100 (2%)
Query: 1 LDATYAALEKAGGGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKPD 60
+DA YAALEKAGG S+++V+SESGWP+ GG A ++NARTYN NLI HVK+G+PK+P
Sbjct: 213 VDAVYAALEKAGGPSVEVVVSESGWPSDGGFAA--TIENARTYNQNLINHVKKGTPKRPG 270
Query: 61 RPIETYIFAMFDEKDKQGAEIERHWGLFAPDKQSKYQVNF 100
IETY+FAMFDE K G +E+H+GLF P+KQ KY ++F
Sbjct: 271 WAIETYVFAMFDENQKPGESVEKHFGLFYPNKQPKYPIDF 310
|
Length = 310 |
| >gnl|CDD|227625 COG5309, COG5309, Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| PF00332 | 310 | Glyco_hydro_17: Glycosyl hydrolases family 17; Int | 100.0 | |
| COG5309 | 305 | Exo-beta-1,3-glucanase [Carbohydrate transport and | 99.87 | |
| smart00633 | 254 | Glyco_10 Glycosyl hydrolase family 10. | 97.73 | |
| PF07745 | 332 | Glyco_hydro_53: Glycosyl hydrolase family 53; Inte | 97.45 | |
| PF11790 | 239 | Glyco_hydro_cc: Glycosyl hydrolase catalytic core; | 97.41 | |
| PRK10150 | 604 | beta-D-glucuronidase; Provisional | 96.27 | |
| PF00232 | 455 | Glyco_hydro_1: Glycosyl hydrolase family 1; InterP | 95.98 | |
| TIGR03356 | 427 | BGL beta-galactosidase. | 95.36 | |
| PRK13511 | 469 | 6-phospho-beta-galactosidase; Provisional | 94.77 | |
| PLN02814 | 504 | beta-glucosidase | 94.46 | |
| PLN02998 | 497 | beta-glucosidase | 94.33 | |
| PF00331 | 320 | Glyco_hydro_10: Glycosyl hydrolase family 10; Inte | 93.41 | |
| PLN02849 | 503 | beta-glucosidase | 93.4 | |
| TIGR01233 | 467 | lacG 6-phospho-beta-galactosidase. This enzyme is | 92.88 | |
| PF00150 | 281 | Cellulase: Cellulase (glycosyl hydrolase family 5) | 89.79 | |
| PRK09589 | 476 | celA 6-phospho-beta-glucosidase; Reviewed | 89.42 | |
| PRK09852 | 474 | cryptic 6-phospho-beta-glucosidase; Provisional | 88.71 | |
| PRK15014 | 477 | 6-phospho-beta-glucosidase BglA; Provisional | 88.47 | |
| PRK09593 | 478 | arb 6-phospho-beta-glucosidase; Reviewed | 88.39 | |
| KOG0626 | 524 | consensus Beta-glucosidase, lactase phlorizinhydro | 86.73 | |
| COG4782 | 377 | Uncharacterized protein conserved in bacteria [Fun | 81.02 | |
| COG3867 | 403 | Arabinogalactan endo-1,4-beta-galactosidase [Carbo | 81.0 |
| >PF00332 Glyco_hydro_17: Glycosyl hydrolases family 17; InterPro: IPR000490 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-36 Score=227.96 Aligned_cols=98 Identities=51% Similarity=0.985 Sum_probs=75.6
Q ss_pred ChHHHHHHHHcCCCCCcEEEcccccCCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCCCCCCCceEEEEEeecCCCCCCCC
Q 047283 1 LDATYAALEKAGGGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKPDRPIETYIFAMFDEKDKQGAE 80 (101)
Q Consensus 1 ~Da~~~al~~~g~~~~~i~itEtGWPs~g~~~~~as~~na~~y~~~~~~~~~~gtp~~~~~~~~~~~f~~fDe~~k~~~~ 80 (101)
||++++||+++|+++++|+|+||||||.|+.. ++++||+.|++++++++.+|||++|+.++++|||+||||+||++..
T Consensus 213 ~da~~~a~~~~g~~~~~vvv~ETGWPs~G~~~--a~~~nA~~~~~nl~~~~~~gt~~~~~~~~~~y~F~~FdE~~K~~~~ 290 (310)
T PF00332_consen 213 VDAVYAAMEKLGFPNVPVVVGETGWPSAGDPG--ATPENAQAYNQNLIKHVLKGTPLRPGNGIDVYIFEAFDENWKPGPE 290 (310)
T ss_dssp HHHHHHHHHTTT-TT--EEEEEE---SSSSTT--CSHHHHHHHHHHHHHHCCGBBSSSBSS---EEES-SB--TTSSSSG
T ss_pred HHHHHHHHHHhCCCCceeEEeccccccCCCCC--CCcchhHHHHHHHHHHHhCCCcccCCCCCeEEEEEEecCcCCCCCc
Confidence 59999999999999999999999999999854 8999999999999999999999999889999999999999999777
Q ss_pred cCCceEeecCCCCeeeeecc
Q 047283 81 IERHWGLFAPDKQSKYQVNF 100 (101)
Q Consensus 81 ~E~~~Gl~~~d~~~K~~~~~ 100 (101)
.|+|||||++|++|||+|+|
T Consensus 291 ~E~~wGlf~~d~~~ky~~~f 310 (310)
T PF00332_consen 291 VERHWGLFYPDGTPKYDLDF 310 (310)
T ss_dssp GGGG--SB-TTSSBSS----
T ss_pred ccceeeeECCCCCeecCCCC
Confidence 99999999999999999998
|
2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 17 GH17 from CAZY comprises enzymes with several known activities; endo-1,3-beta-glucosidase (3.2.1.39 from EC); lichenase (3.2.1.73 from EC); exo-1,3-glucanase (3.2.1.58 from EC). Currently these enzymes have only been found in plants and in fungi. ; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1AQ0_B 1GHR_A 1GHS_B 2CYG_A 3UR8_A 3UR7_B 3EM5_C 3F55_D. |
| >COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00633 Glyco_10 Glycosyl hydrolase family 10 | Back alignment and domain information |
|---|
| >PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK10150 beta-D-glucuronidase; Provisional | Back alignment and domain information |
|---|
| >PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >TIGR03356 BGL beta-galactosidase | Back alignment and domain information |
|---|
| >PRK13511 6-phospho-beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >PLN02814 beta-glucosidase | Back alignment and domain information |
|---|
| >PLN02998 beta-glucosidase | Back alignment and domain information |
|---|
| >PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PLN02849 beta-glucosidase | Back alignment and domain information |
|---|
| >TIGR01233 lacG 6-phospho-beta-galactosidase | Back alignment and domain information |
|---|
| >PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK09589 celA 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional | Back alignment and domain information |
|---|
| >PRK15014 6-phospho-beta-glucosidase BglA; Provisional | Back alignment and domain information |
|---|
| >PRK09593 arb 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4782 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 101 | ||||
| 3em5_A | 316 | Crystal Structure Of A Native Endo Beta-1,3-Glucana | 2e-32 | ||
| 3ur7_A | 323 | Higher-density Crystal Structure Of Potato Endo-1,3 | 2e-28 | ||
| 4gzi_A | 323 | Active-site Mutant Of Potato Endo-1,3-beta-glucanas | 1e-27 | ||
| 1ghs_A | 306 | The Three-Dimensional Structures Of Two Plant Beta- | 1e-25 | ||
| 2cyg_A | 312 | Crystal Structure At 1.45- Resolution Of The Major | 2e-23 | ||
| 1aq0_A | 306 | Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space G | 3e-22 |
| >pdb|3EM5|A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis Length = 316 | Back alignment and structure |
|
| >pdb|3UR7|A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase Length = 323 | Back alignment and structure |
| >pdb|4GZI|A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose Length = 323 | Back alignment and structure |
| >pdb|1GHS|A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities Length = 306 | Back alignment and structure |
| >pdb|2CYG|A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome Length = 312 | Back alignment and structure |
| >pdb|1AQ0|A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group Length = 306 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| 1aq0_A | 306 | 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl | 1e-36 | |
| 3em5_A | 316 | Beta-1,3-glucanase; glycoprotein, rossmann fold, ( | 1e-35 | |
| 1ghs_A | 306 | 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg | 9e-35 | |
| 2cyg_A | 312 | Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be | 1e-34 | |
| 3ur8_A | 323 | Glucan endo-1,3-beta-D-glucosidase; glucoside hydr | 2e-34 |
| >1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Length = 306 | Back alignment and structure |
|---|
Score = 124 bits (312), Expect = 1e-36
Identities = 51/100 (51%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
Query: 1 LDATYAALEKAGGGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKPD 60
+DA Y A+ K GG S+ +V+SESGWP+ GG A NAR YN +LI HV +G+P+ P
Sbjct: 211 VDAFYTAMGKHGGSSVKLVVSESGWPSGGGTAA--TPANARFYNQHLINHVGRGTPRHPG 268
Query: 61 RPIETYIFAMFDEKDKQGAEIERHWGLFAPDKQSKYQVNF 100
IETYIFAMF+E K +E++WGLF P+ Q Y +NF
Sbjct: 269 -AIETYIFAMFNENQKDS-GVEQNWGLFYPNMQHVYPINF 306
|
| >3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} PDB: 3f55_A* Length = 316 | Back alignment and structure |
|---|
| >1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Length = 306 | Back alignment and structure |
|---|
| >2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Length = 312 | Back alignment and structure |
|---|
| >3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Length = 323 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| 3ur8_A | 323 | Glucan endo-1,3-beta-D-glucosidase; glucoside hydr | 100.0 | |
| 3em5_A | 316 | Beta-1,3-glucanase; glycoprotein, rossmann fold, ( | 100.0 | |
| 2cyg_A | 312 | Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be | 100.0 | |
| 1ghs_A | 306 | 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg | 100.0 | |
| 1aq0_A | 306 | 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl | 100.0 | |
| 1hjs_A | 332 | Beta-1,4-galactanase; 4-galactanases, family 53 gl | 98.91 | |
| 1fob_A | 334 | Beta-1,4-galactanase; B/A barrel, glycosyl hydrola | 98.79 | |
| 1ur4_A | 399 | Galactanase; hydrolase, beta-1, glycoside hydrolas | 98.35 | |
| 4ekj_A | 500 | Beta-xylosidase; TIM-barrel fold, hemicellulase, h | 98.22 | |
| 2w61_A | 555 | GAS2P, glycolipid-anchored surface protein 2; glyc | 98.17 | |
| 1uhv_A | 500 | Beta-xylosidase; family 39 glycoside hydrolase, xy | 97.93 | |
| 3civ_A | 343 | Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. | 97.8 | |
| 1w91_A | 503 | Beta-xylosidase; MAD, seMet, tetramer, hydrolase; | 97.7 | |
| 3cui_A | 315 | EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine | 97.62 | |
| 1n82_A | 331 | Xylanase, intra-cellular xylanase; hydrolase; 1.45 | 97.57 | |
| 1nq6_A | 302 | XYS1; glycoside hydrolase family 10, xylanase, xyl | 97.49 | |
| 1xyz_A | 347 | 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola | 97.24 | |
| 3lpf_A | 605 | Beta-glucuronidase; alpha/beta barrel, sugar-bindi | 97.13 | |
| 1ur1_A | 378 | Endoxylanase; hydrolase, family 10, glycoside hydr | 97.09 | |
| 1v0l_A | 313 | Endo-1,4-beta-xylanase A; glycoside hydrolase fami | 97.01 | |
| 1i1w_A | 303 | Endo-1,4-beta-xylanase; xylan degradation, hydrola | 97.01 | |
| 3hn3_A | 613 | Beta-G1, beta-glucuronidase; lysosomal enzyme, aci | 96.82 | |
| 1ta3_B | 303 | Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), | 96.78 | |
| 2dep_A | 356 | Xylanase B, thermostable celloxylanase; glycosidas | 96.67 | |
| 1w32_A | 348 | Endo-1,4-beta-xylanase A precursor; mutant, calciu | 96.5 | |
| 3u7b_A | 327 | Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET | 96.48 | |
| 1r85_A | 379 | Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A | 96.14 | |
| 3niy_A | 341 | Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 | 96.12 | |
| 2uwf_A | 356 | Endoxylanase, alkaline active endoxylanase; hydrol | 96.0 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 95.83 | |
| 2w5f_A | 540 | Endo-1,4-beta-xylanase Y; cellulosome, glycosidase | 95.78 | |
| 1us2_A | 530 | Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca | 95.63 | |
| 4b3l_A | 479 | Beta-glucosidase; hydrolase, glycosidase, carbohyd | 95.38 | |
| 3vii_A | 487 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 95.24 | |
| 3cmg_A | 667 | Putative beta-galactosidase; structural genomics, | 95.0 | |
| 2j78_A | 468 | Beta-glucosidase A; family 1, hydrolase, inhibitor | 94.95 | |
| 4f8x_A | 335 | Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET | 94.87 | |
| 1gnx_A | 479 | Beta-glucosidase; hydrolase, glycosyltransferase, | 94.85 | |
| 3ta9_A | 458 | Glycoside hydrolase family 1; TIM barrel, glucosid | 94.84 | |
| 3fj0_A | 465 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase | 94.81 | |
| 1qvb_A | 481 | Beta-glycosidase; TIM-barrel, thermostable, hydrol | 94.8 | |
| 1vff_A | 423 | Beta-glucosidase; glycosyl hydrolase, membrane-bou | 94.8 | |
| 2o9p_A | 454 | Beta-glucosidase B; family 1 glycoside hydrolase; | 94.72 | |
| 1e4i_A | 447 | Beta-glucosidase; hydrolase, family 1 glycosyl hyd | 94.45 | |
| 3emz_A | 331 | Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba | 94.39 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 94.37 | |
| 1uuq_A | 440 | Mannosyl-oligosaccharide glucosidase; hydrolase, m | 94.06 | |
| 1qox_A | 449 | Beta-glucosidase; hydrolase, cellulose degradation | 94.03 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 93.85 | |
| 3apg_A | 473 | Beta-glucosidase; TIM barrel, hydrolase, sugar bin | 93.77 | |
| 3ahx_A | 453 | Beta-glucosidase A; cellulases, glycosyl hydrolase | 93.6 | |
| 4ha4_A | 489 | Beta-galactosidase; TIM barrel, beta-glycosidase, | 93.53 | |
| 1pbg_A | 468 | PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g | 93.18 | |
| 1uwi_A | 489 | Beta-galactosidase; hydrolase, beta-glycosidase, g | 93.11 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 93.08 | |
| 1edg_A | 380 | Endoglucanase A; family A, cellulases, xylanases, | 93.03 | |
| 3icg_A | 515 | Endoglucanase D; cellulase, xylanase, carbohydrate | 92.99 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 92.8 | |
| 1ug6_A | 431 | Beta-glycosidase; glucosidase, atomic resolution, | 92.71 | |
| 2xhy_A | 479 | BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, | 92.18 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 91.67 | |
| 4hz8_A | 444 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba | 91.49 | |
| 4hty_A | 359 | Cellulase; (alpha/beta)8 barrel, family 5 endogluc | 91.33 | |
| 1wcg_A | 464 | Thioglucosidase, myrosinase; aphid, beta-glucosida | 91.17 | |
| 4awe_A | 387 | Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana | 91.08 | |
| 3ptm_A | 505 | Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly | 90.97 | |
| 4atd_A | 513 | Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr | 90.91 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 90.83 | |
| 3f5l_A | 481 | Beta-glucosidase; beta-alpha-barrels, glycosidase, | 90.52 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 90.47 | |
| 3ndz_A | 345 | Endoglucanase D; cellotriose, xylanase, carbohydra | 90.08 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 90.01 | |
| 2e9l_A | 469 | Cytosolic beta-glucosidase; novel cytosolic neutra | 90.01 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 89.66 | |
| 3qom_A | 481 | 6-phospho-beta-glucosidase; structural genomics, P | 89.55 | |
| 4dde_A | 480 | 6-phospho-beta-glucosidase; structural genomics, P | 89.23 | |
| 1v08_A | 512 | Beta-glucosidase; glycoside hydrolase, dimboa-gluc | 88.99 | |
| 2dga_A | 565 | Beta-glucosidase; alpha/beta barrel, hydrolase; 1. | 88.36 | |
| 1e4m_M | 501 | Myrosinase MA1; hydrolase, family 1 glycosyl hydro | 88.24 | |
| 3gnp_A | 488 | OS03G0212800 protein; beta-alpha barrel, glycosida | 87.47 | |
| 4a3y_A | 540 | Raucaffricine-O-beta-D-glucosidase; hydrolase, alk | 86.68 | |
| 2jf7_A | 532 | Strictosidine-O-beta-D-glucosidase; alkaloid, hydr | 86.24 | |
| 3fn9_A | 692 | Putative beta-galactosidase; structural genomics, | 86.07 | |
| 1v02_A | 565 | Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri | 86.05 | |
| 3ahy_A | 473 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 85.64 | |
| 1cbg_A | 490 | Cyanogenic beta-glucosidase; hydrolase (O-glycosyl | 85.52 | |
| 2e3z_A | 465 | Beta-glucosidase; TIM barrel, glycoside hydrolase | 85.43 | |
| 1qnr_A | 344 | Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt | 83.07 |
| >3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-38 Score=241.36 Aligned_cols=99 Identities=57% Similarity=1.053 Sum_probs=93.7
Q ss_pred ChHHHHHHHHcCCCCCcEEEcccccCCCCCCCCCCCHHHHHHHHHHHHHHHh--hCCCCCCCCCceEEEEEeecCCCCCC
Q 047283 1 LDATYAALEKAGGGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVK--QGSPKKPDRPIETYIFAMFDEKDKQG 78 (101)
Q Consensus 1 ~Da~~~al~~~g~~~~~i~itEtGWPs~g~~~~~as~~na~~y~~~~~~~~~--~gtp~~~~~~~~~~~f~~fDe~~k~~ 78 (101)
|||+++||+++|+++++|+|+||||||.|+ ++||++||++|+++++|++. +|||+||+.++++|||++|||+||++
T Consensus 215 ~Da~~~Al~~~g~~~~~v~vsEtGWPs~G~--~~as~~na~~y~~~li~~~~~~~GtP~rp~~~~~~y~F~lfde~~K~g 292 (323)
T 3ur8_A 215 VDSMYFATEKLGGQNIEIIVSESGWPSEGH--PAATLKNARTYYTNLINHVKRGAGTPKKPGKTIETYLFAMFDENEKKG 292 (323)
T ss_dssp HHHHHHHHHTTTCTTCCEEEEEECCCSSSB--TTBCHHHHHHHHHHHHHHHHHTCBCSSSBTCCCCEEEECSBCCTTCCS
T ss_pred HHHHHHHHHHcCCCCceEEeccccCCCCCC--CCCCHHHHHHHHHHHHHHHhcCCCCCCCCCCCceEEEEEeecCCCCCC
Confidence 589999999999999999999999999997 56999999999999999995 67999998789999999999999998
Q ss_pred CCcCCceEeecCCCCeeeeeccC
Q 047283 79 AEIERHWGLFAPDKQSKYQVNFN 101 (101)
Q Consensus 79 ~~~E~~~Gl~~~d~~~K~~~~~~ 101 (101)
+..|+|||||++|++|||+|+|+
T Consensus 293 ~~~E~~wGlf~~d~~~ky~~~~~ 315 (323)
T 3ur8_A 293 EASEKHFGLFNPDQRPKYQLNFN 315 (323)
T ss_dssp SGGGGCCCSBCTTSCBSSCCCCS
T ss_pred CCcCceeeEECCCCCEeecccee
Confidence 88999999999999999999985
|
| >3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} SCOP: c.1.8.3 PDB: 3f55_A* | Back alignment and structure |
|---|
| >2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A | Back alignment and structure |
|---|
| >1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* | Back alignment and structure |
|---|
| >1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A | Back alignment and structure |
|---|
| >1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* | Back alignment and structure |
|---|
| >4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* | Back alignment and structure |
|---|
| >1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A | Back alignment and structure |
|---|
| >3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* | Back alignment and structure |
|---|
| >3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* | Back alignment and structure |
|---|
| >1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A | Back alignment and structure |
|---|
| >1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A | Back alignment and structure |
|---|
| >1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* | Back alignment and structure |
|---|
| >1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A | Back alignment and structure |
|---|
| >1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A | Back alignment and structure |
|---|
| >3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* | Back alignment and structure |
|---|
| >1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} | Back alignment and structure |
|---|
| >1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A | Back alignment and structure |
|---|
| >3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} | Back alignment and structure |
|---|
| >1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A | Back alignment and structure |
|---|
| >3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A | Back alignment and structure |
|---|
| >2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* | Back alignment and structure |
|---|
| >1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A | Back alignment and structure |
|---|
| >4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A | Back alignment and structure |
|---|
| >3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* | Back alignment and structure |
|---|
| >3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... | Back alignment and structure |
|---|
| >4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} | Back alignment and structure |
|---|
| >1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A | Back alignment and structure |
|---|
| >3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} | Back alignment and structure |
|---|
| >1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* | Back alignment and structure |
|---|
| >1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* | Back alignment and structure |
|---|
| >3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* | Back alignment and structure |
|---|
| >1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* | Back alignment and structure |
|---|
| >3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} | Back alignment and structure |
|---|
| >4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A | Back alignment and structure |
|---|
| >1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* | Back alignment and structure |
|---|
| >1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A | Back alignment and structure |
|---|
| >1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A | Back alignment and structure |
|---|
| >2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* | Back alignment and structure |
|---|
| >4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* | Back alignment and structure |
|---|
| >4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* | Back alignment and structure |
|---|
| >1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} | Back alignment and structure |
|---|
| >3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* | Back alignment and structure |
|---|
| >4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* | Back alignment and structure |
|---|
| >3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* | Back alignment and structure |
|---|
| >2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A | Back alignment and structure |
|---|
| >3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A | Back alignment and structure |
|---|
| >1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A | Back alignment and structure |
|---|
| >2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* | Back alignment and structure |
|---|
| >1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* | Back alignment and structure |
|---|
| >3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* | Back alignment and structure |
|---|
| >4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* | Back alignment and structure |
|---|
| >2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A | Back alignment and structure |
|---|
| >3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* | Back alignment and structure |
|---|
| >3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} | Back alignment and structure |
|---|
| >1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* | Back alignment and structure |
|---|
| >1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 101 | ||||
| d1ghsa_ | 306 | c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeu | 1e-39 | |
| d2cyga1 | 312 | c.1.8.3 (A:29-340) Plant beta-glucanases {Banana ( | 2e-39 | |
| d1aq0a_ | 306 | c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeu | 5e-39 |
| >d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Length = 306 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: beta-glycanases domain: Plant beta-glucanases species: Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]
Score = 131 bits (330), Expect = 1e-39
Identities = 56/100 (56%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
Query: 1 LDATYAALEKAGGGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKPD 60
+DA YAALEKAG ++ +V+SESGWP+AGG A + NARTYN LI HV G+PKK
Sbjct: 210 VDAVYAALEKAGAPAVKVVVSESGWPSAGGFAA--SAGNARTYNQGLINHVGGGTPKKR- 266
Query: 61 RPIETYIFAMFDEKDKQGAEIERHWGLFAPDKQSKYQVNF 100
+ETYIFAMF+E K G ER +GLF PDK Y + F
Sbjct: 267 EALETYIFAMFNENQKTGDATERSFGLFNPDKSPAYNIQF 306
|
| >d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Length = 312 | Back information, alignment and structure |
|---|
| >d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Length = 306 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| d1ghsa_ | 306 | Plant beta-glucanases {Barley (Hordeum vulgare), 1 | 100.0 | |
| d2cyga1 | 312 | Plant beta-glucanases {Banana (Musa acuminata), 1, | 100.0 | |
| d1aq0a_ | 306 | Plant beta-glucanases {Barley (Hordeum vulgare), 1 | 100.0 | |
| d1xyza_ | 320 | Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 | 98.53 | |
| d1vbua1 | 324 | Xylanase {Thermotoga maritima [TaxId: 2336]} | 98.47 | |
| d1uhva2 | 346 | Beta-D-xylosidase, catalytic domain {Thermoanaerob | 98.41 | |
| d1fh9a_ | 312 | Xylanase A, catalytic core {Cellulomonas fimi [Tax | 98.25 | |
| d1nq6a_ | 302 | Xylanase A, catalytic core {Streptomyces halstedii | 98.07 | |
| d1hjsa_ | 332 | Beta-1,4-galactanase {Thielavia heterothallica, ak | 98.01 | |
| d1n82a_ | 330 | Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId | 97.76 | |
| d1v0la_ | 302 | Xylanase A, catalytic core {Streptomyces lividans | 97.71 | |
| d1us3a2 | 364 | Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] | 97.46 | |
| d1foba_ | 334 | Beta-1,4-galactanase {Fungus (Aspergillus aculeatu | 97.4 | |
| d1bhga3 | 304 | beta-Glucuronidase, domain 3 {Human (Homo sapiens) | 96.98 | |
| d1qoxa_ | 449 | Beta-glucosidase A {Bacillus circulans, subsp. alk | 96.23 | |
| d1gnxa_ | 464 | Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] | 96.13 | |
| d1e4ia_ | 447 | Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 | 95.91 | |
| d1wcga1 | 462 | Thioglucosidase {Cabbage aphid (Brevicoryne brassi | 95.84 | |
| d1ug6a_ | 426 | Beta-glucosidase A {Thermus thermophilus [TaxId: 2 | 95.29 | |
| d2j78a1 | 443 | Beta-glucosidase A {Thermotoga maritima [TaxId: 23 | 95.23 | |
| d1qvba_ | 481 | beta-Glycosidase {Archaeon Thermosphaera aggregans | 95.04 | |
| d1pbga_ | 468 | 6-phospho-beta-D-galactosidase, PGAL {Lactococcus | 94.85 | |
| d1vffa1 | 423 | Beta-glucosidase A {Archaeon Pyrococcus horikoshii | 94.7 | |
| d1v02a_ | 484 | Plant beta-glucosidase (myrosinase) {Sorghum bicol | 93.92 | |
| d1uwsa_ | 489 | beta-Glycosidase {Archaeon Sulfolobus solfataricus | 93.5 | |
| d1ur1a_ | 350 | Xylanase {Cellvibrio mixtus [TaxId: 39650]} | 93.36 | |
| d1ta3b_ | 301 | Xylanase A, catalytic core {Emericella nidulans (A | 93.26 | |
| d1rh9a1 | 370 | Beta-mannanase {Tomato (Lycopersicon esculentum) [ | 93.15 | |
| d1w32a_ | 346 | Xylanase A, catalytic core {Pseudomonas fluorescen | 92.92 | |
| d1ceoa_ | 340 | Endoglucanase CelC {Clostridium thermocellum [TaxI | 92.91 | |
| d1ur4a_ | 387 | Beta-1,4-galactanase {Bacillus licheniformis [TaxI | 92.83 | |
| d1vjza_ | 325 | Endoglucanase homologue TM1752 {Thermotoga maritim | 92.71 | |
| d1kwga2 | 393 | A4 beta-galactosidase {Thermus thermophilus [TaxId | 91.99 | |
| d1cbga_ | 490 | Plant beta-glucosidase (myrosinase) {Creeping whit | 91.4 | |
| d1r85a_ | 371 | Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: | 91.21 | |
| d1e4mm_ | 499 | Plant beta-glucosidase (myrosinase) {White mustard | 91.02 | |
| d1i1wa_ | 303 | Xylanase A, catalytic core {Thermoascus aurantiacu | 90.47 | |
| d1uuqa_ | 410 | Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | 85.78 | |
| d1edga_ | 380 | Endoglucanase CelA {Clostridium cellulolyticum [Ta | 82.17 | |
| d2v3ga1 | 273 | Endoglucanase H N-terminal domain {Clostridium the | 81.99 | |
| d1yq2a5 | 297 | beta-Galactosidase, domain 3 {Arthrobacter sp. c2- | 81.06 |
| >d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: beta-glycanases domain: Plant beta-glucanases species: Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]
Probab=100.00 E-value=1.1e-38 Score=237.64 Aligned_cols=97 Identities=57% Similarity=1.004 Sum_probs=92.1
Q ss_pred ChHHHHHHHHcCCCCCcEEEcccccCCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCCCCCCCceEEEEEeecCCCCCCCC
Q 047283 1 LDATYAALEKAGGGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKPDRPIETYIFAMFDEKDKQGAE 80 (101)
Q Consensus 1 ~Da~~~al~~~g~~~~~i~itEtGWPs~g~~~~~as~~na~~y~~~~~~~~~~gtp~~~~~~~~~~~f~~fDe~~k~~~~ 80 (101)
+|+++.||+++|+++|+|+|+||||||+|+.. |+++||+.|++++++++++|||+|++ ++++|+|++|||+||++++
T Consensus 210 ~d~~~~A~~~~~~~~k~ivI~ETGWPS~G~~~--as~~na~~y~~~l~~~~~~gt~~r~~-~i~~f~FeaFDE~wK~~~~ 286 (306)
T d1ghsa_ 210 VDAVYAALEKAGAPAVKVVVSESGWPSAGGFA--ASAGNARTYNQGLINHVGGGTPKKRE-ALETYIFAMFNENQKTGDA 286 (306)
T ss_dssp HHHHHHHHHHHTCTTCCEEEEEECCCSSSSTT--CCHHHHHHHHHHHHTTGGGCCSSCCS-CCCEEEECSBCCTTCCSSG
T ss_pred HHHHHHHHHhcCCCCCceEEcccccccCCCCC--CCHHHHHHHHHHHHHHHhcCCCCCCC-CceEEEEeeeCcCCCCCCC
Confidence 48899999999999999999999999999765 99999999999999999999999875 8999999999999999889
Q ss_pred cCCceEeecCCCCeeeeecc
Q 047283 81 IERHWGLFAPDKQSKYQVNF 100 (101)
Q Consensus 81 ~E~~~Gl~~~d~~~K~~~~~ 100 (101)
+|+|||||++||+|||+|+|
T Consensus 287 ~E~~wGlf~~d~~~ky~~~f 306 (306)
T d1ghsa_ 287 TERSFGLFNPDKSPAYNIQF 306 (306)
T ss_dssp GGGGCCSBCTTSCBSSCCCC
T ss_pred ccCccccCCCCCCEecCCCC
Confidence 99999999999999999987
|
| >d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} | Back information, alignment and structure |
|---|
| >d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} | Back information, alignment and structure |
|---|
| >d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} | Back information, alignment and structure |
|---|
| >d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} | Back information, alignment and structure |
|---|
| >d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} | Back information, alignment and structure |
|---|
| >d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} | Back information, alignment and structure |
|---|
| >d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} | Back information, alignment and structure |
|---|
| >d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} | Back information, alignment and structure |
|---|
| >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} | Back information, alignment and structure |
|---|
| >d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} | Back information, alignment and structure |
|---|
| >d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} | Back information, alignment and structure |
|---|
| >d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} | Back information, alignment and structure |
|---|