Citrus Sinensis ID: 047378


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFLVPETKGRTLEEIQISITK
cccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcc
cccccEEEEHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcc
maglpsviMAEIfpinikgsAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFlvpetkgrtlEEIQISITK
MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFLvpetkgrtleeiqisitk
MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFLVPETKGRTLEEIQISITK
*****SVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFLVPETKGRTL*********
MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFLVPETKGRTLEEIQISI**
MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFLVPETKGRTLEEIQISITK
*AGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFLVPETKGRTLEEIQISIT*
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFLVPETKGRTLEEIQISITK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q3ECP7470 Sugar transporter ERD6-li yes no 0.977 0.180 0.611 1e-23
Q0WQ63470 Sugar transporter ERD6-li no no 0.942 0.174 0.548 1e-20
Q94KE0470 Sugar transporter ERD6-li no no 1.0 0.185 0.528 2e-20
O04036496 Sugar transporter ERD6 OS no no 0.942 0.165 0.560 5e-20
Q8LBI9482 Sugar transporter ERD6-li no no 1.0 0.180 0.528 8e-20
Q4F7G0462 Sugar transporter ERD6-li no no 1.0 0.188 0.517 3e-19
Q9LTP6488 Putative sugar transporte no no 1.0 0.178 0.505 1e-18
Q93Z80458 Sugar transporter ERD6-li no no 0.988 0.187 0.534 2e-18
P93051463 Sugar transporter ERD6-li no no 0.942 0.177 0.524 4e-18
Q94AF9467 Sugar transporter ERD6-li no no 0.988 0.184 0.523 6e-18
>sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 Back     alignment and function desciption
 Score =  107 bits (268), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (77%)

Query: 1   MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICI 60
           M G+P VIM+EIFPI+IKGSAGSLV ++   G+WI++ TF+F+M W+  G F +F  +C 
Sbjct: 381 MGGIPWVIMSEIFPIDIKGSAGSLVTVVSWVGSWIISFTFNFLMNWNPAGTFYVFATVCG 440

Query: 61  VAVLFVAFLVPETKGRTLEEIQISI 85
             V+FVA LVPETKGRTLEEIQ SI
Sbjct: 441 ATVIFVAKLVPETKGRTLEEIQYSI 465




Sugar transporter.
Arabidopsis thaliana (taxid: 3702)
>sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 Back     alignment and function description
>sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 Back     alignment and function description
>sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 Back     alignment and function description
>sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 Back     alignment and function description
>sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 Back     alignment and function description
>sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 Back     alignment and function description
>sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 Back     alignment and function description
>sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
359487967 1179 PREDICTED: uncharacterized protein LOC10 0.988 0.072 0.651 2e-23
298205021 490 unnamed protein product [Vitis vinifera] 0.988 0.175 0.651 3e-23
224130930 478 predicted protein [Populus trichocarpa] 0.988 0.179 0.639 9e-23
225451069 488 PREDICTED: putative ERD6-like transporte 0.988 0.176 0.639 1e-22
298205031 517 unnamed protein product [Vitis vinifera] 0.988 0.166 0.639 2e-22
224125374 442 predicted protein [Populus trichocarpa] 0.988 0.194 0.627 3e-22
255542520 488 sugar transporter, putative [Ricinus com 0.988 0.176 0.627 4e-22
3776581 483 Similar to Beta integral membrane protei 0.977 0.175 0.611 4e-22
30695810 470 sugar transporter ERD6-like 5 [Arabidops 0.977 0.180 0.611 6e-22
255542516 476 sugar transporter, putative [Ricinus com 0.988 0.180 0.604 8e-22
>gi|359487967|ref|XP_002263811.2| PREDICTED: uncharacterized protein LOC100264207 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (76%)

Query: 1    MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICI 60
            M G+P +IM+EIFPINIKG AGSLV  +   G+W+V CTF+F+ EWS  G F IF  IC 
Sbjct: 1090 MGGIPWIIMSEIFPINIKGPAGSLVTFVCWFGSWLVACTFYFLFEWSSAGTFFIFSSICG 1149

Query: 61   VAVLFVAFLVPETKGRTLEEIQISIT 86
            + VLF+A LVPETKGRTLEEIQ SIT
Sbjct: 1150 LGVLFIAKLVPETKGRTLEEIQASIT 1175




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|298205021|emb|CBI34328.3| unnamed protein product [Vitis vinifera] gi|310877870|gb|ADP37166.1| putative ERD6-like transporter [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130930|ref|XP_002328411.1| predicted protein [Populus trichocarpa] gi|222838126|gb|EEE76491.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225451069|ref|XP_002263418.1| PREDICTED: putative ERD6-like transporter [Vitis vinifera] gi|310877850|gb|ADP37156.1| putative ERD6-like transporter [Vitis vinifera] Back     alignment and taxonomy information
>gi|298205031|emb|CBI34338.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125374|ref|XP_002319570.1| predicted protein [Populus trichocarpa] gi|222857946|gb|EEE95493.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542520|ref|XP_002512323.1| sugar transporter, putative [Ricinus communis] gi|223548284|gb|EEF49775.1| sugar transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|3776581|gb|AAC64898.1| Similar to Beta integral membrane protein homolog gb|U43629 from A. thaliana [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30695810|ref|NP_850964.1| sugar transporter ERD6-like 5 [Arabidopsis thaliana] gi|117940128|sp|Q3ECP7.2|ERDL5_ARATH RecName: Full=Sugar transporter ERD6-like 5 gi|332195018|gb|AEE33139.1| sugar transporter ERD6-like 5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255542516|ref|XP_002512321.1| sugar transporter, putative [Ricinus communis] gi|223548282|gb|EEF49773.1| sugar transporter, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
TAIR|locus:2199539470 AT1G54730 [Arabidopsis thalian 0.977 0.180 0.611 5.6e-23
TAIR|locus:2096219470 AT3G05150 [Arabidopsis thalian 0.942 0.174 0.548 7.2e-21
TAIR|locus:2036084496 ERD6 "EARLY RESPONSE TO DEHYDR 0.942 0.165 0.560 3.1e-20
TAIR|locus:2144975482 AT5G18840 "AT5G18840" [Arabido 1.0 0.180 0.528 9.9e-20
TAIR|locus:2036009462 AT1G08900 [Arabidopsis thalian 1.0 0.188 0.517 1.1e-19
TAIR|locus:2096234458 AT3G05160 [Arabidopsis thalian 0.988 0.187 0.534 2.3e-18
TAIR|locus:2092379488 AT3G20460 [Arabidopsis thalian 1.0 0.178 0.505 2.7e-18
TAIR|locus:2066400463 AT2G48020 [Arabidopsis thalian 0.942 0.177 0.524 5e-18
TAIR|locus:505006329467 AT3G05165 [Arabidopsis thalian 0.988 0.184 0.523 5.1e-18
TAIR|locus:2146350474 SFP1 [Arabidopsis thaliana (ta 0.977 0.179 0.564 8.9e-18
TAIR|locus:2199539 AT1G54730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 270 (100.1 bits), Expect = 5.6e-23, P = 5.6e-23
 Identities = 52/85 (61%), Positives = 66/85 (77%)

Query:     1 MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICI 60
             M G+P VIM+EIFPI+IKGSAGSLV ++   G+WI++ TF+F+M W+  G F +F  +C 
Sbjct:   381 MGGIPWVIMSEIFPIDIKGSAGSLVTVVSWVGSWIISFTFNFLMNWNPAGTFYVFATVCG 440

Query:    61 VAVLFVAFLVPETKGRTLEEIQISI 85
               V+FVA LVPETKGRTLEEIQ SI
Sbjct:   441 ATVIFVAKLVPETKGRTLEEIQYSI 465




GO:0005215 "transporter activity" evidence=IEA
GO:0005351 "sugar:hydrogen symporter activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0015144 "carbohydrate transmembrane transporter activity" evidence=ISS
GO:0016020 "membrane" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0022857 "transmembrane transporter activity" evidence=IEA
GO:0022891 "substrate-specific transmembrane transporter activity" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
TAIR|locus:2096219 AT3G05150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036084 ERD6 "EARLY RESPONSE TO DEHYDRATION 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144975 AT5G18840 "AT5G18840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036009 AT1G08900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096234 AT3G05160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092379 AT3G20460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066400 AT2G48020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006329 AT3G05165 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146350 SFP1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 4e-13
PRK10077479 PRK10077, xylE, D-xylose transporter XylE; Provisi 1e-12
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 5e-11
TIGR00887502 TIGR00887, 2A0109, phosphate:H+ symporter 0.002
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
 Score = 62.4 bits (152), Expect = 4e-13
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   AGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFW-VICI 60
             +P VI++EIFP++++    S+ +  +   N+IV   F  M+E    G   IF+  + +
Sbjct: 401 GPVPWVIVSEIFPLSLRPKGISIAVAANWLANFIVGFLFPTMLESIGVGGVFIFFGGLNV 460

Query: 61  VAVLFVAFLVPETKGRTLEEI 81
           + ++FV F +PETKGRTLEEI
Sbjct: 461 LGLIFVYFFLPETKGRTLEEI 481


This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 481

>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|129965 TIGR00887, 2A0109, phosphate:H+ symporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
KOG0569485 consensus Permease of the major facilitator superf 99.75
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.61
KOG0254513 consensus Predicted transporter (major facilitator 99.58
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.53
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.47
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 99.26
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 99.22
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.11
TIGR00898505 2A0119 cation transport protein. 99.02
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.02
PRK10489417 enterobactin exporter EntS; Provisional 98.84
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.67
PRK10642490 proline/glycine betaine transporter; Provisional 98.67
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 98.55
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.55
TIGR00893 399 2A0114 d-galactonate transporter. 98.52
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 98.46
PRK03545 390 putative arabinose transporter; Provisional 98.45
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 98.44
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.43
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 98.42
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.4
PRK10213 394 nepI ribonucleoside transporter; Reviewed 98.4
PRK15403 413 multidrug efflux system protein MdtM; Provisional 98.39
PRK10473 392 multidrug efflux system protein MdtL; Provisional 98.37
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 98.37
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.33
PRK11663434 regulatory protein UhpC; Provisional 98.32
TIGR00895 398 2A0115 benzoate transport. 98.3
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.29
PRK10054 395 putative transporter; Provisional 98.26
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 98.25
PRK11663 434 regulatory protein UhpC; Provisional 98.23
PRK10091 382 MFS transport protein AraJ; Provisional 98.23
PRK14995 495 methyl viologen resistance protein SmvA; Provision 98.22
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.22
TIGR00901 356 2A0125 AmpG-related permease. 98.21
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.19
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 98.18
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.16
PRK10406432 alpha-ketoglutarate transporter; Provisional 98.16
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 98.14
PRK09952438 shikimate transporter; Provisional 98.13
PRK09874 408 drug efflux system protein MdtG; Provisional 98.12
TIGR00900 365 2A0121 H+ Antiporter protein. 98.11
PRK10077 479 xylE D-xylose transporter XylE; Provisional 98.1
PRK11646 400 multidrug resistance protein MdtH; Provisional 98.1
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.09
PRK12307426 putative sialic acid transporter; Provisional 98.07
TIGR00893399 2A0114 d-galactonate transporter. 98.04
PLN00028 476 nitrate transmembrane transporter; Provisional 98.01
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 97.99
PRK05122399 major facilitator superfamily transporter; Provisi 97.98
KOG2532 466 consensus Permease of the major facilitator superf 97.97
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.97
TIGR00891 405 2A0112 putative sialic acid transporter. 97.97
PRK10504 471 putative transporter; Provisional 97.96
TIGR00898 505 2A0119 cation transport protein. 97.94
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 97.91
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 97.91
PRK12307 426 putative sialic acid transporter; Provisional 97.91
PRK11195 393 lysophospholipid transporter LplT; Provisional 97.88
PRK15462 493 dipeptide/tripeptide permease D; Provisional 97.87
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 97.86
PRK15075434 citrate-proton symporter; Provisional 97.85
PRK10406 432 alpha-ketoglutarate transporter; Provisional 97.84
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.82
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 97.82
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 97.82
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 97.82
PRK11652 394 emrD multidrug resistance protein D; Provisional 97.81
PRK09705393 cynX putative cyanate transporter; Provisional 97.8
PRK12382392 putative transporter; Provisional 97.79
PRK11010 491 ampG muropeptide transporter; Validated 97.78
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 97.77
PRK10642 490 proline/glycine betaine transporter; Provisional 97.75
PRK11043 401 putative transporter; Provisional 97.75
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.75
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 97.71
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 97.7
PRK11902 402 ampG muropeptide transporter; Reviewed 97.69
PRK15075 434 citrate-proton symporter; Provisional 97.67
PRK03893 496 putative sialic acid transporter; Provisional 97.65
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.57
PRK03699 394 putative transporter; Provisional 97.56
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.56
PRK09528420 lacY galactoside permease; Reviewed 97.56
PRK10207 489 dipeptide/tripeptide permease B; Provisional 97.56
KOG0569 485 consensus Permease of the major facilitator superf 97.55
TIGR00805 633 oat sodium-independent organic anion transporter. 97.55
PRK09952 438 shikimate transporter; Provisional 97.54
TIGR00892 455 2A0113 monocarboxylate transporter 1. 97.52
PRK03893496 putative sialic acid transporter; Provisional 97.5
PRK15011393 sugar efflux transporter B; Provisional 97.5
PRK10489 417 enterobactin exporter EntS; Provisional 97.48
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 97.48
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 97.47
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.44
PRK03545390 putative arabinose transporter; Provisional 97.42
KOG1330 493 consensus Sugar transporter/spinster transmembrane 97.41
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 97.4
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.39
PRK15011 393 sugar efflux transporter B; Provisional 97.37
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.36
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 97.35
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 97.32
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 97.31
TIGR00892455 2A0113 monocarboxylate transporter 1. 97.27
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.18
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 97.18
PRK09584 500 tppB putative tripeptide transporter permease; Rev 97.16
KOG2816 463 consensus Predicted transporter ADD1 (major facili 97.11
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 97.09
KOG0254 513 consensus Predicted transporter (major facilitator 97.08
PRK09705 393 cynX putative cyanate transporter; Provisional 97.03
TIGR00897402 2A0118 polyol permease family. This family of prot 97.03
KOG2533 495 consensus Permease of the major facilitator superf 97.03
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.02
PRK09874408 drug efflux system protein MdtG; Provisional 97.01
TIGR00897 402 2A0118 polyol permease family. This family of prot 97.0
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.0
PRK12382 392 putative transporter; Provisional 96.97
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 96.95
PRK05122 399 major facilitator superfamily transporter; Provisi 96.93
KOG3764 464 consensus Vesicular amine transporter [Intracellul 96.92
KOG2615 451 consensus Permease of the major facilitator superf 96.91
PTZ00207 591 hypothetical protein; Provisional 96.85
TIGR00891405 2A0112 putative sialic acid transporter. 96.83
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 96.78
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.78
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.7
PRK03633381 putative MFS family transporter protein; Provision 96.68
PRK11646400 multidrug resistance protein MdtH; Provisional 96.67
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 96.63
TIGR00881379 2A0104 phosphoglycerate transporter family protein 96.63
TIGR00896 355 CynX cyanate transporter. This family of proteins 96.58
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 96.52
PRK11010491 ampG muropeptide transporter; Validated 96.42
PRK10054395 putative transporter; Provisional 96.4
PRK10504471 putative transporter; Provisional 96.39
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 96.35
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 96.02
TIGR00788468 fbt folate/biopterin transporter. The only functio 96.01
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 96.0
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 95.96
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 95.96
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 95.87
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 95.87
PRK03633 381 putative MFS family transporter protein; Provision 95.83
TIGR00902382 2A0127 phenyl proprionate permease family protein. 95.83
PF13347 428 MFS_2: MFS/sugar transport protein 95.82
TIGR00895398 2A0115 benzoate transport. 95.81
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 95.8
PRK11462 460 putative transporter; Provisional 95.68
PRK09584500 tppB putative tripeptide transporter permease; Rev 95.65
TIGR00900365 2A0121 H+ Antiporter protein. 95.63
PRK03699394 putative transporter; Provisional 95.59
PRK09528 420 lacY galactoside permease; Reviewed 95.47
PRK09669 444 putative symporter YagG; Provisional 95.42
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 95.31
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 95.18
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 95.17
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 95.04
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 94.84
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 94.8
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 94.77
PLN00028476 nitrate transmembrane transporter; Provisional 94.76
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 94.69
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 94.68
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 94.56
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 94.44
COG2270438 Permeases of the major facilitator superfamily [Ge 94.36
PRK09669444 putative symporter YagG; Provisional 94.23
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 94.23
PRK11902402 ampG muropeptide transporter; Reviewed 93.81
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 93.79
PRK15402406 multidrug efflux system translocase MdfA; Provisio 93.24
TIGR00788 468 fbt folate/biopterin transporter. The only functio 93.17
PRK10133 438 L-fucose transporter; Provisional 93.1
KOG3762618 consensus Predicted transporter [General function 92.96
PRK15462493 dipeptide/tripeptide permease D; Provisional 92.68
PRK10091382 MFS transport protein AraJ; Provisional 92.66
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 92.61
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 92.53
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 92.4
PRK10207489 dipeptide/tripeptide permease B; Provisional 92.08
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 91.93
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 91.83
PRK10473392 multidrug efflux system protein MdtL; Provisional 91.41
KOG0253 528 consensus Synaptic vesicle transporter SV2 (major 91.2
PRK11043401 putative transporter; Provisional 90.41
COG2211 467 MelB Na+/melibiose symporter and related transport 90.29
PRK11195393 lysophospholipid transporter LplT; Provisional 90.26
PRK09848448 glucuronide transporter; Provisional 90.25
PRK10429 473 melibiose:sodium symporter; Provisional 89.91
KOG2325 488 consensus Predicted transporter/transmembrane prot 89.61
TIGR01272310 gluP glucose/galactose transporter. Disruption of 88.75
PRK10213394 nepI ribonucleoside transporter; Reviewed 88.71
PTZ00207591 hypothetical protein; Provisional 86.25
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 86.01
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 85.48
PRK11652394 emrD multidrug resistance protein D; Provisional 85.43
PRK15403413 multidrug efflux system protein MdtM; Provisional 84.99
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 84.7
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 83.71
TIGR00926654 2A1704 Peptide:H+ symporter (also transports b-lac 82.83
KOG2563 480 consensus Permease of the major facilitator superf 82.79
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 82.58
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 82.03
PRK10429473 melibiose:sodium symporter; Provisional 81.45
COG2807395 CynX Cyanate permease [Inorganic ion transport and 81.16
COG0738422 FucP Fucose permease [Carbohydrate transport and m 80.36
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=99.75  E-value=1.6e-17  Score=108.46  Aligned_cols=86  Identities=27%  Similarity=0.358  Sum_probs=80.8

Q ss_pred             CCccchhhhcccCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchHHHHHHHHHHHHHHHHHHhhcccCCCCCHHH
Q 047378            1 MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWSRTGAFSIFWVICIVAVLFVAFLVPETKGRTLEE   80 (87)
Q Consensus         1 ~~~~~~~~~~E~fp~~~R~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~pet~~~~~~~   80 (87)
                      .||++|.+.+|++|++.|+.++++...++|+.+++..+.++.+.+..+...|+++.+.+++..++.++++||||||+..|
T Consensus       385 ~gpi~~fi~aELf~~~~R~aa~s~~~~~~w~~~fiv~~~fp~l~~~~g~~~filF~i~~~~~~i~~~~~lPETkgr~~~e  464 (485)
T KOG0569|consen  385 PGPIPWFIGAELFPQSARSAAQSVATAVNWLSNFIVGFAFPPLQNVIGPYVFILFVIPLAIFLIYLYRYLPETKGRTPYE  464 (485)
T ss_pred             CCchhHHHHHHhCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhhHHHHHHHHHHHHHHHHhCcccCCCCHHH
Confidence            48999999999999999999999999999999999999999999955559999999999999999999999999999999


Q ss_pred             HHHHhh
Q 047378           81 IQISIT   86 (87)
Q Consensus        81 ~~~~~~   86 (87)
                      +.+.++
T Consensus       465 I~~~~~  470 (485)
T KOG0569|consen  465 IIEELE  470 (485)
T ss_pred             HHHHHH
Confidence            987665



>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
4gby_A491 The Structure Of The Mfs (Major Facilitator Superfa 3e-06
>pdb|4GBY|A Chain A, The Structure Of The Mfs (Major Facilitator Superfamily) Proton:xylose Symporter Xyle Bound To D-Xylose Length = 491 Back     alignment and structure

Iteration: 1

Score = 46.6 bits (109), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 7/83 (8%) Query: 7 VIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMMEWS------RTG-AFSIFWVIC 59 V+++EIFP I+G A ++ + N+ V+ TF M + S G ++ I+ + Sbjct: 393 VLLSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMG 452 Query: 60 IVAVLFVAFLVPETKGRTLEEIQ 82 ++A LF+ VPETKG+TLEE++ Sbjct: 453 VLAALFMWKFVPETKGKTLEELE 475 Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.82
2cfq_A417 Lactose permease; transport, transport mechanism, 98.43
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 98.42
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.39
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 98.38
2xut_A524 Proton/peptide symporter family protein; transport 98.22
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 98.09
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 98.06
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 97.95
2xut_A 524 Proton/peptide symporter family protein; transport 97.79
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 97.64
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 97.14
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 96.34
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.82  E-value=5.3e-20  Score=117.55  Aligned_cols=87  Identities=31%  Similarity=0.476  Sum_probs=77.1

Q ss_pred             CCccchhhhcccCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------hhchHHHHHHHHHHHHHHHHHHhhcccC
Q 047378            1 MAGLPSVIMAEIFPINIKGSAGSLVILLHNCGNWIVTCTFHFMME-------WSRTGAFSIFWVICIVAVLFVAFLVPET   73 (87)
Q Consensus         1 ~~~~~~~~~~E~fp~~~R~~~~~~~~~~~~~~~~~~~~~~~~l~~-------~~~~~~~~~~~~~~~~~~~~~~~~~pet   73 (87)
                      ++|++|.+.+|+||++.|++++|++..++++++++++.++|.+.+       .+....|++++++++++.++.++++|||
T Consensus       387 ~~~~~~~~~~E~fPt~~R~~~~g~~~~~~~~~~~i~~~~~p~l~~~~~~~~~~~~~~~~~i~~~~~~~~~i~~~~~~PET  466 (491)
T 4gc0_A          387 WGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPET  466 (491)
T ss_dssp             TTHHHHHHHHHSSCTTTHHHHHHHHHHHHHHHHHHHHTHHHHHCHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHCCCC
T ss_pred             HHHHHHHHHHHhCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHheecCC
Confidence            367889999999999999999999999999999999999987754       2345678999999999999999999999


Q ss_pred             CCCCHHHHHHHhhC
Q 047378           74 KGRTLEEIQISITK   87 (87)
Q Consensus        74 ~~~~~~~~~~~~~~   87 (87)
                      ||+++||+|+.+++
T Consensus       467 kg~tLeei~~~f~~  480 (491)
T 4gc0_A          467 KGKTLEELEALWEP  480 (491)
T ss_dssp             TTCCHHHHGGGTC-
T ss_pred             CCCCHHHHHHHhCC
Confidence            99999999988753



>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.73
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.44
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 98.18
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 94.16
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: LacY-like proton/sugar symporter
domain: Lactose permease
species: Escherichia coli [TaxId: 562]
Probab=98.73  E-value=4.2e-08  Score=58.62  Aligned_cols=79  Identities=10%  Similarity=0.057  Sum_probs=66.0

Q ss_pred             ccchhhhcccCCcchHHHHHHHHHHH-HHHHHHHHHHHHHHHHH-hhchHHHHHHHHHHHHHHHHHHhhcccCCCCCHHH
Q 047378            3 GLPSVIMAEIFPINIKGSAGSLVILL-HNCGNWIVTCTFHFMME-WSRTGAFSIFWVICIVAVLFVAFLVPETKGRTLEE   80 (87)
Q Consensus         3 ~~~~~~~~E~fp~~~R~~~~~~~~~~-~~~~~~~~~~~~~~l~~-~~~~~~~~~~~~~~~~~~~~~~~~~pet~~~~~~~   80 (87)
                      +....+++|.+|++.|+++.|+.... ..++..+++.+.+.+.+ .+....+++.+++.++..++..+.+++.+..+.++
T Consensus       331 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~~~G~l~~~~g~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~r  410 (417)
T d1pv7a_         331 VGCFKYITSQFEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFTLSGPGPLSLLR  410 (417)
T ss_dssp             HHHHHHHHHHSCGGGHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHSCCSSCTTHHH
T ss_pred             HHHHHHHHHHCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHhhcCCCccchhH
Confidence            34567899999999999999987654 56889999999999998 77788899999999988888888888888777755


Q ss_pred             H
Q 047378           81 I   81 (87)
Q Consensus        81 ~   81 (87)
                      .
T Consensus       411 ~  411 (417)
T d1pv7a_         411 R  411 (417)
T ss_dssp             H
T ss_pred             h
Confidence            3



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure