Citrus Sinensis ID: 047426
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| 224056160 | 491 | predicted protein [Populus trichocarpa] | 0.899 | 0.199 | 0.491 | 3e-22 | |
| 224103637 | 491 | predicted protein [Populus trichocarpa] | 0.899 | 0.199 | 0.491 | 7e-22 | |
| 387135132 | 496 | UDP-glycosyltransferase 1 [Linum usitati | 0.981 | 0.215 | 0.471 | 1e-21 | |
| 224056138 | 485 | predicted protein [Populus trichocarpa] | 0.899 | 0.202 | 0.468 | 1e-21 | |
| 255555373 | 479 | UDP-glucosyltransferase, putative [Ricin | 0.899 | 0.204 | 0.486 | 2e-21 | |
| 387135130 | 496 | UDP-glycosyltransferase 1 [Linum usitati | 0.981 | 0.215 | 0.462 | 4e-21 | |
| 216296854 | 475 | UGT3 [Pueraria montana var. lobata] | 0.917 | 0.210 | 0.456 | 5e-21 | |
| 319759266 | 475 | glycosyltransferase GT14A05 [Pueraria mo | 0.917 | 0.210 | 0.456 | 5e-21 | |
| 387135136 | 473 | UDP-glycosyltransferase 1 [Linum usitati | 0.926 | 0.213 | 0.486 | 6e-21 | |
| 356499771 | 475 | PREDICTED: UDP-glycosyltransferase 73B3- | 0.917 | 0.210 | 0.447 | 8e-21 |
| >gi|224056160|ref|XP_002298737.1| predicted protein [Populus trichocarpa] gi|222845995|gb|EEE83542.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 109 bits (272), Expect = 3e-22, Method: Composition-based stats.
Identities = 55/112 (49%), Positives = 74/112 (66%), Gaps = 14/112 (12%)
Query: 1 MTNYEWSSILESVAAGVPMATWPLYEEQFLKKKLVTDALRIGVG--------------VE 46
MT+ W+S LE+V AG+P+ TWPL+ EQF +KL+TD L+IG+G V
Sbjct: 367 MTHCGWNSTLEAVTAGLPLVTWPLFAEQFDNEKLITDVLKIGIGVGALEWSRYAKKILVM 426
Query: 47 KDDITKALAELMVSKSANNMRNKTKGPGKTARKAVEEGGSSFSDLNALLEDL 98
KDDI KA+ LMV + A +RN+ + + AR A+EEGGSS+SDL ALLE+L
Sbjct: 427 KDDIEKAIVHLMVGEEAEEIRNRARELQEMARNAMEEGGSSYSDLTALLEEL 478
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224103637|ref|XP_002313133.1| predicted protein [Populus trichocarpa] gi|222849541|gb|EEE87088.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|387135132|gb|AFJ52947.1| UDP-glycosyltransferase 1 [Linum usitatissimum] | Back alignment and taxonomy information |
|---|
| >gi|224056138|ref|XP_002298734.1| predicted protein [Populus trichocarpa] gi|222845992|gb|EEE83539.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255555373|ref|XP_002518723.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223542104|gb|EEF43648.1| UDP-glucosyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|387135130|gb|AFJ52946.1| UDP-glycosyltransferase 1 [Linum usitatissimum] | Back alignment and taxonomy information |
|---|
| >gi|216296854|gb|ACJ72160.1| UGT3 [Pueraria montana var. lobata] | Back alignment and taxonomy information |
|---|
| >gi|319759266|gb|ADV71369.1| glycosyltransferase GT14A05 [Pueraria montana var. lobata] | Back alignment and taxonomy information |
|---|
| >gi|387135136|gb|AFJ52949.1| UDP-glycosyltransferase 1 [Linum usitatissimum] | Back alignment and taxonomy information |
|---|
| >gi|356499771|ref|XP_003518710.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| UNIPROTKB|Q9AT54 | 476 | togt1 "Phenylpropanoid:glucosy | 0.944 | 0.216 | 0.431 | 4.3e-19 | |
| TAIR|locus:2040590 | 491 | UGT73C1 "UDP-glucosyl transfer | 0.568 | 0.126 | 0.460 | 9.9e-18 | |
| TAIR|locus:505006555 | 483 | UGT73B2 "UDP-glucosyltransfera | 0.917 | 0.207 | 0.412 | 1.5e-16 | |
| TAIR|locus:2831352 | 481 | UGT73B3 "UDP-glucosyl transfer | 0.908 | 0.205 | 0.415 | 3.1e-16 | |
| TAIR|locus:2053669 | 484 | UGT73B4 "UDP-glycosyltransfera | 0.899 | 0.202 | 0.409 | 8.6e-16 | |
| TAIR|locus:2053618 | 484 | UGT73B5 "UDP-glucosyl transfer | 0.899 | 0.202 | 0.4 | 5e-15 | |
| TAIR|locus:505006556 | 488 | UGT73B1 "UDP-glucosyl transfer | 0.944 | 0.211 | 0.394 | 5.8e-13 | |
| TAIR|locus:2185495 | 492 | AT5G14860 [Arabidopsis thalian | 0.853 | 0.189 | 0.361 | 4.1e-11 | |
| TAIR|locus:2153614 | 464 | UGT76C1 "UDP-glucosyl transfer | 0.917 | 0.215 | 0.342 | 6.1e-11 | |
| TAIR|locus:2166444 | 450 | UGT76C2 "UDP-glucosyl transfer | 0.908 | 0.22 | 0.349 | 2e-10 |
| UNIPROTKB|Q9AT54 togt1 "Phenylpropanoid:glucosyltransferase 1" [Nicotiana tabacum (taxid:4097)] | Back alignment and assigned GO terms |
|---|
Score = 235 (87.8 bits), Expect = 4.3e-19, P = 4.3e-19
Identities = 50/116 (43%), Positives = 73/116 (62%)
Query: 1 MTNYEWSSILESVAAGVPMATWPLYEEQFLKKKLVTDALRIGVGV-------------EK 47
+T+ W+S LE V+ GVPM TWP++ EQF +KLVT+ L+ G GV ++
Sbjct: 358 VTHCGWNSTLEGVSGGVPMVTWPVFAEQFFNEKLVTEVLKTGAGVGSIQWKRSASEGVKR 417
Query: 48 DDITKALAELMVSKSANNMRNKTKGPGKTARKAVEEGGSSFSDLNALLEDLISICS 103
+ I KA+ +MVS+ A+ RN+ K + ARKA+EEGGSS++ L LLED+ + S
Sbjct: 418 EAIAKAIKRVMVSEEADGFRNRAKAYKEMARKAIEEGGSSYTGLTTLLEDISTYSS 473
|
|
| TAIR|locus:2040590 UGT73C1 "UDP-glucosyl transferase 73C1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006555 UGT73B2 "UDP-glucosyltransferase 73B2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2831352 UGT73B3 "UDP-glucosyl transferase 73B3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053669 UGT73B4 "UDP-glycosyltransferase 73B4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053618 UGT73B5 "UDP-glucosyl transferase 73B5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006556 UGT73B1 "UDP-glucosyl transferase 73B1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2185495 AT5G14860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153614 UGT76C1 "UDP-glucosyl transferase 76C1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166444 UGT76C2 "UDP-glucosyl transferase 76C2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 109 | |||
| PLN03007 | 482 | PLN03007, PLN03007, UDP-glucosyltransferase family | 2e-25 | |
| PLN02534 | 491 | PLN02534, PLN02534, UDP-glycosyltransferase | 1e-21 | |
| PLN02448 | 459 | PLN02448, PLN02448, UDP-glycosyltransferase family | 4e-19 | |
| PLN00164 | 480 | PLN00164, PLN00164, glucosyltransferase; Provision | 1e-15 | |
| PLN02863 | 477 | PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl | 2e-15 | |
| PLN02167 | 475 | PLN02167, PLN02167, UDP-glycosyltransferase family | 3e-14 | |
| PLN02992 | 481 | PLN02992, PLN02992, coniferyl-alcohol glucosyltran | 6e-14 | |
| PLN02207 | 468 | PLN02207, PLN02207, UDP-glycosyltransferase | 9e-14 | |
| PLN02554 | 481 | PLN02554, PLN02554, UDP-glycosyltransferase family | 2e-12 | |
| PLN03004 | 451 | PLN03004, PLN03004, UDP-glycosyltransferase | 5e-10 | |
| PLN02152 | 455 | PLN02152, PLN02152, indole-3-acetate beta-glucosyl | 2e-09 | |
| PLN02210 | 456 | PLN02210, PLN02210, UDP-glucosyl transferase | 2e-09 | |
| PLN03015 | 470 | PLN03015, PLN03015, UDP-glucosyl transferase | 5e-09 | |
| PLN02410 | 451 | PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl | 6e-09 | |
| PLN02173 | 449 | PLN02173, PLN02173, UDP-glucosyl transferase famil | 3e-08 | |
| PLN02555 | 480 | PLN02555, PLN02555, limonoid glucosyltransferase | 1e-07 | |
| cd03784 | 401 | cd03784, GT1_Gtf_like, This family includes the Gt | 6e-04 |
| >gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein | Back alignment and domain information |
|---|
Score = 98.0 bits (244), Expect = 2e-25
Identities = 49/114 (42%), Positives = 69/114 (60%), Gaps = 13/114 (11%)
Query: 1 MTNYEWSSILESVAAGVPMATWPLYEEQFLKKKLVTDALRIGVGV-------------EK 47
+T+ W+S+LE VAAG+PM TWP+ EQF +KLVT LR GV V +
Sbjct: 368 VTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSVGAKKLVKVKGDFISR 427
Query: 48 DDITKALAELMVSKSANNMRNKTKGPGKTARKAVEEGGSSFSDLNALLEDLISI 101
+ + KA+ E++V + A R + K + A+ AVEEGGSSF+DLN +E+L S
Sbjct: 428 EKVEKAVREVIVGEEAEERRLRAKKLAEMAKAAVEEGGSSFNDLNKFMEELNSR 481
|
Length = 482 |
| >gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215112 PLN02167, PLN02167, UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|178589 PLN03015, PLN03015, UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| PLN02555 | 480 | limonoid glucosyltransferase | 99.97 | |
| PLN02410 | 451 | UDP-glucoronosyl/UDP-glucosyl transferase family p | 99.97 | |
| PLN02210 | 456 | UDP-glucosyl transferase | 99.97 | |
| PLN02207 | 468 | UDP-glycosyltransferase | 99.97 | |
| PLN02173 | 449 | UDP-glucosyl transferase family protein | 99.97 | |
| PLN02534 | 491 | UDP-glycosyltransferase | 99.96 | |
| PLN00164 | 480 | glucosyltransferase; Provisional | 99.96 | |
| PLN03007 | 482 | UDP-glucosyltransferase family protein | 99.96 | |
| PLN03015 | 470 | UDP-glucosyl transferase | 99.96 | |
| PLN02448 | 459 | UDP-glycosyltransferase family protein | 99.96 | |
| PLN02992 | 481 | coniferyl-alcohol glucosyltransferase | 99.96 | |
| PLN02863 | 477 | UDP-glucoronosyl/UDP-glucosyl transferase family p | 99.96 | |
| PLN02554 | 481 | UDP-glycosyltransferase family protein | 99.96 | |
| PLN02167 | 475 | UDP-glycosyltransferase family protein | 99.96 | |
| PLN02152 | 455 | indole-3-acetate beta-glucosyltransferase | 99.96 | |
| PLN02562 | 448 | UDP-glycosyltransferase | 99.95 | |
| PLN02208 | 442 | glycosyltransferase family protein | 99.95 | |
| PLN02764 | 453 | glycosyltransferase family protein | 99.95 | |
| PLN00414 | 446 | glycosyltransferase family protein | 99.94 | |
| PLN03004 | 451 | UDP-glycosyltransferase | 99.94 | |
| PLN02670 | 472 | transferase, transferring glycosyl groups | 99.92 | |
| PF00201 | 500 | UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera | 99.87 | |
| KOG1192 | 496 | consensus UDP-glucuronosyl and UDP-glucosyl transf | 99.83 | |
| PHA03392 | 507 | egt ecdysteroid UDP-glucosyltransferase; Provision | 99.82 | |
| COG1819 | 406 | Glycosyl transferases, related to UDP-glucuronosyl | 99.7 | |
| TIGR01426 | 392 | MGT glycosyltransferase, MGT family. This model de | 99.62 | |
| cd03784 | 401 | GT1_Gtf_like This family includes the Gtfs, a grou | 99.6 | |
| PRK12446 | 352 | undecaprenyldiphospho-muramoylpentapeptide beta-N- | 98.98 | |
| PF04101 | 167 | Glyco_tran_28_C: Glycosyltransferase family 28 C-t | 98.95 | |
| PF13528 | 318 | Glyco_trans_1_3: Glycosyl transferase family 1 | 98.91 | |
| TIGR00661 | 321 | MJ1255 conserved hypothetical protein. This model | 98.83 | |
| PRK00726 | 357 | murG undecaprenyldiphospho-muramoylpentapeptide be | 98.65 | |
| COG0707 | 357 | MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami | 98.42 | |
| PRK13608 | 391 | diacylglycerol glucosyltransferase; Provisional | 98.24 | |
| cd03785 | 350 | GT1_MurG MurG is an N-acetylglucosaminyltransferas | 98.14 | |
| TIGR01133 | 348 | murG undecaprenyldiphospho-muramoylpentapeptide be | 98.04 | |
| PRK13609 | 380 | diacylglycerol glucosyltransferase; Provisional | 97.99 | |
| PLN02605 | 382 | monogalactosyldiacylglycerol synthase | 97.98 | |
| TIGR00215 | 385 | lpxB lipid-A-disaccharide synthase. Lipid-A precur | 97.53 | |
| PRK05749 | 425 | 3-deoxy-D-manno-octulosonic-acid transferase; Revi | 97.44 | |
| PRK00025 | 380 | lpxB lipid-A-disaccharide synthase; Reviewed | 97.07 | |
| TIGR03492 | 396 | conserved hypothetical protein. This protein famil | 97.0 | |
| PRK09814 | 333 | beta-1,6-galactofuranosyltransferase; Provisional | 96.77 | |
| cd03814 | 364 | GT1_like_2 This family is most closely related to | 96.69 | |
| cd03801 | 374 | GT1_YqgM_like This family is most closely related | 96.51 | |
| cd05844 | 367 | GT1_like_7 Glycosyltransferases catalyze the trans | 96.4 | |
| cd03807 | 365 | GT1_WbnK_like This family is most closely related | 96.28 | |
| cd04946 | 407 | GT1_AmsK_like This family is most closely related | 96.23 | |
| cd03820 | 348 | GT1_amsD_like This family is most closely related | 96.22 | |
| COG4671 | 400 | Predicted glycosyl transferase [General function p | 96.18 | |
| KOG3349 | 170 | consensus Predicted glycosyltransferase [General f | 96.17 | |
| cd03798 | 377 | GT1_wlbH_like This family is most closely related | 96.11 | |
| PF13524 | 92 | Glyco_trans_1_2: Glycosyl transferases group 1 | 95.93 | |
| cd03823 | 359 | GT1_ExpE7_like This family is most closely related | 95.79 | |
| TIGR03088 | 374 | stp2 sugar transferase, PEP-CTERM/EpsH1 system ass | 95.79 | |
| cd03795 | 357 | GT1_like_4 This family is most closely related to | 95.77 | |
| PF00534 | 172 | Glycos_transf_1: Glycosyl transferases group 1; In | 95.77 | |
| PRK15427 | 406 | colanic acid biosynthesis glycosyltransferase WcaL | 95.75 | |
| cd03825 | 365 | GT1_wcfI_like This family is most closely related | 95.71 | |
| PRK09922 | 359 | UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D | 95.68 | |
| TIGR00236 | 365 | wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras | 95.64 | |
| cd04962 | 371 | GT1_like_5 This family is most closely related to | 95.61 | |
| cd03794 | 394 | GT1_wbuB_like This family is most closely related | 95.6 | |
| cd03808 | 359 | GT1_cap1E_like This family is most closely related | 95.54 | |
| cd03822 | 366 | GT1_ecORF704_like This family is most closely rela | 95.49 | |
| cd03800 | 398 | GT1_Sucrose_synthase This family is most closely r | 95.46 | |
| PF13844 | 468 | Glyco_transf_41: Glycosyl transferase family 41; P | 95.42 | |
| TIGR03087 | 397 | stp1 sugar transferase, PEP-CTERM/EpsH1 system ass | 95.35 | |
| TIGR02149 | 388 | glgA_Coryne glycogen synthase, Corynebacterium fam | 95.27 | |
| cd03816 | 415 | GT1_ALG1_like This family is most closely related | 95.25 | |
| cd04949 | 372 | GT1_gtfA_like This family is most closely related | 95.22 | |
| PRK15484 | 380 | lipopolysaccharide 1,2-N-acetylglucosaminetransfer | 95.15 | |
| cd03818 | 396 | GT1_ExpC_like This family is most closely related | 95.15 | |
| cd03821 | 375 | GT1_Bme6_like This family is most closely related | 94.96 | |
| cd03817 | 374 | GT1_UGDG_like This family is most closely related | 94.93 | |
| cd04951 | 360 | GT1_WbdM_like This family is most closely related | 94.86 | |
| COG1519 | 419 | KdtA 3-deoxy-D-manno-octulosonic-acid transferase | 94.83 | |
| TIGR02472 | 439 | sucr_P_syn_N sucrose-phosphate synthase, putative, | 94.8 | |
| COG5017 | 161 | Uncharacterized conserved protein [Function unknow | 94.79 | |
| PRK10307 | 412 | putative glycosyl transferase; Provisional | 94.63 | |
| TIGR02918 | 500 | accessory Sec system glycosylation protein GtfA. M | 94.14 | |
| cd03804 | 351 | GT1_wbaZ_like This family is most closely related | 94.13 | |
| cd03799 | 355 | GT1_amsK_like This is a family of GT1 glycosyltran | 94.1 | |
| cd03809 | 365 | GT1_mtfB_like This family is most closely related | 93.95 | |
| cd03819 | 355 | GT1_WavL_like This family is most closely related | 93.73 | |
| cd03792 | 372 | GT1_Trehalose_phosphorylase Trehalose phosphorylas | 93.35 | |
| cd03811 | 353 | GT1_WabH_like This family is most closely related | 93.17 | |
| TIGR03449 | 405 | mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino | 93.05 | |
| cd03813 | 475 | GT1_like_3 This family is most closely related to | 93.05 | |
| cd04955 | 363 | GT1_like_6 This family is most closely related to | 92.83 | |
| PRK14089 | 347 | ipid-A-disaccharide synthase; Provisional | 92.78 | |
| cd03796 | 398 | GT1_PIG-A_like This family is most closely related | 92.72 | |
| cd03805 | 392 | GT1_ALG2_like This family is most closely related | 92.68 | |
| PHA01633 | 335 | putative glycosyl transferase group 1 | 92.58 | |
| cd03812 | 358 | GT1_CapH_like This family is most closely related | 92.43 | |
| PLN02871 | 465 | UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | 92.32 | |
| PF02684 | 373 | LpxB: Lipid-A-disaccharide synthetase; InterPro: I | 91.79 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 91.67 | |
| PHA01630 | 331 | putative group 1 glycosyl transferase | 91.14 | |
| PLN02949 | 463 | transferase, transferring glycosyl groups | 90.98 | |
| PF13692 | 135 | Glyco_trans_1_4: Glycosyl transferases group 1; PD | 90.39 | |
| cd04950 | 373 | GT1_like_1 Glycosyltransferases catalyze the trans | 90.09 | |
| cd03786 | 363 | GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th | 90.01 | |
| PRK10017 | 426 | colanic acid biosynthesis protein; Provisional | 89.23 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 88.89 | |
| COG0763 | 381 | LpxB Lipid A disaccharide synthetase [Cell envelop | 88.86 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 88.16 | |
| COG3980 | 318 | spsG Spore coat polysaccharide biosynthesis protei | 88.06 | |
| PLN02275 | 371 | transferase, transferring glycosyl groups | 87.55 | |
| PRK14098 | 489 | glycogen synthase; Provisional | 86.34 | |
| cd03802 | 335 | GT1_AviGT4_like This family is most closely relate | 86.0 | |
| PRK15490 | 578 | Vi polysaccharide biosynthesis protein TviE; Provi | 85.17 | |
| TIGR03713 | 519 | acc_sec_asp1 accessory Sec system protein Asp1. Th | 84.65 | |
| TIGR02400 | 456 | trehalose_OtsA alpha,alpha-trehalose-phosphate syn | 84.22 | |
| PF04558 | 164 | tRNA_synt_1c_R1: Glutaminyl-tRNA synthetase, non-s | 83.94 | |
| PLN00142 | 815 | sucrose synthase | 83.69 | |
| TIGR02470 | 784 | sucr_synth sucrose synthase. This model represents | 83.47 | |
| cd03791 | 476 | GT1_Glycogen_synthase_DULL1_like This family is mo | 83.05 | |
| TIGR02095 | 473 | glgA glycogen/starch synthases, ADP-glucose type. | 82.7 | |
| PLN02846 | 462 | digalactosyldiacylglycerol synthase | 82.19 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 81.11 | |
| PRK00654 | 466 | glgA glycogen synthase; Provisional | 80.05 |
| >PLN02555 limonoid glucosyltransferase | Back alignment and domain information |
|---|
Probab=99.97 E-value=4.4e-31 Score=208.64 Aligned_cols=102 Identities=25% Similarity=0.507 Sum_probs=97.0
Q ss_pred CccCChhhHHHHHHcCCCeEecCCcchhhhHHHHHHHHhcccccc----------CHHHHHHHHHHhhcccchHHHHHHH
Q 047426 1 MTNYEWSSILESVAAGVPMATWPLYEEQFLKKKLVTDALRIGVGV----------EKDDITKALAELMVSKSANNMRNKT 70 (109)
Q Consensus 1 vtHgG~~s~~Eal~~GvP~i~~P~~~DQ~~na~~~~~~~g~g~~~----------~~~~i~~ai~~vl~~~~~~~~r~~a 70 (109)
||||||||++||+++|||||+||+++||+.|++++++.||+|+++ ++++|.++|+++|++++|+++|+||
T Consensus 360 vtH~G~nS~~Eai~~GVP~l~~P~~~DQ~~Na~~~~~~~gvGv~l~~~~~~~~~v~~~~v~~~v~~vm~~~~g~~~r~ra 439 (480)
T PLN02555 360 VTHCGWNSTMEALSSGVPVVCFPQWGDQVTDAVYLVDVFKTGVRLCRGEAENKLITREEVAECLLEATVGEKAAELKQNA 439 (480)
T ss_pred EecCCcchHHHHHHcCCCEEeCCCccccHHHHHHHHHHhCceEEccCCccccCcCcHHHHHHHHHHHhcCchHHHHHHHH
Confidence 699999999999999999999999999999999999999999773 6899999999999888899999999
Q ss_pred HHHHHHHHHhHHcCCChHHHHHHHHHHHHhcc
Q 047426 71 KGPGKTARKAVEEGGSSFSDLNALLEDLISIC 102 (109)
Q Consensus 71 ~~l~~~~~~a~~~gGss~~~l~~~v~~l~~~~ 102 (109)
++|++.+++++.+||||+.||++||+++...+
T Consensus 440 ~~l~~~a~~A~~egGSS~~~l~~~v~~i~~~~ 471 (480)
T PLN02555 440 LKWKEEAEAAVAEGGSSDRNFQEFVDKLVRKS 471 (480)
T ss_pred HHHHHHHHHHhcCCCcHHHHHHHHHHHHHhcc
Confidence 99999999999999999999999999998763
|
|
| >PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02210 UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >PLN02207 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN02173 UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02534 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN00164 glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03007 UDP-glucosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN03015 UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >PLN02448 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02992 coniferyl-alcohol glucosyltransferase | Back alignment and domain information |
|---|
| >PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02554 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02167 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02152 indole-3-acetate beta-glucosyltransferase | Back alignment and domain information |
|---|
| >PLN02562 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN02208 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02764 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN00414 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN03004 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN02670 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule | Back alignment and domain information |
|---|
| >KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01426 MGT glycosyltransferase, MGT family | Back alignment and domain information |
|---|
| >cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin | Back alignment and domain information |
|---|
| >PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 | Back alignment and domain information |
|---|
| >TIGR00661 MJ1255 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK13608 diacylglycerol glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis | Back alignment and domain information |
|---|
| >TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >PRK13609 diacylglycerol glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02605 monogalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >TIGR00215 lpxB lipid-A-disaccharide synthase | Back alignment and domain information |
|---|
| >PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03492 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK09814 beta-1,6-galactofuranosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known | Back alignment and domain information |
|---|
| >cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >COG4671 Predicted glycosyl transferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3349 consensus Predicted glycosyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 | Back alignment and domain information |
|---|
| >cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional | Back alignment and domain information |
|---|
| >cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase | Back alignment and domain information |
|---|
| >cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A | Back alignment and domain information |
|---|
| >TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family | Back alignment and domain information |
|---|
| >cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding | Back alignment and domain information |
|---|
| >PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional | Back alignment and domain information |
|---|
| >cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli | Back alignment and domain information |
|---|
| >COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain | Back alignment and domain information |
|---|
| >COG5017 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10307 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02918 accessory Sec system glycosylation protein GtfA | Back alignment and domain information |
|---|
| >cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria | Back alignment and domain information |
|---|
| >cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose | Back alignment and domain information |
|---|
| >cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK14089 ipid-A-disaccharide synthase; Provisional | Back alignment and domain information |
|---|
| >cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PHA01633 putative glycosyl transferase group 1 | Back alignment and domain information |
|---|
| >cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | Back alignment and domain information |
|---|
| >PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >PHA01630 putative group 1 glycosyl transferase | Back alignment and domain information |
|---|
| >PLN02949 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A | Back alignment and domain information |
|---|
| >cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) | Back alignment and domain information |
|---|
| >PRK10017 colanic acid biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02275 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PRK14098 glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 | Back alignment and domain information |
|---|
| >TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PF04558 tRNA_synt_1c_R1: Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1 ; InterPro: IPR007639 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PLN00142 sucrose synthase | Back alignment and domain information |
|---|
| >TIGR02470 sucr_synth sucrose synthase | Back alignment and domain information |
|---|
| >cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR02095 glgA glycogen/starch synthases, ADP-glucose type | Back alignment and domain information |
|---|
| >PLN02846 digalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK00654 glgA glycogen synthase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 109 | ||||
| 3hbf_A | 454 | Structure Of Ugt78g1 Complexed With Myricetin And U | 1e-11 | ||
| 2pq6_A | 482 | Crystal Structure Of Medicago Truncatula Ugt85h2- I | 3e-10 | ||
| 2acv_A | 463 | Crystal Structure Of Medicago Truncatula Ugt71g1 Le | 4e-09 | ||
| 2acw_A | 465 | Crystal Structure Of Medicago Truncatula Ugt71g1 Co | 4e-09 | ||
| 2c1x_A | 456 | Structure And Activity Of A Flavonoid 3-O Glucosylt | 7e-09 | ||
| 2vce_A | 480 | Characterization And Engineering Of The Bifunctiona | 7e-09 |
| >pdb|3HBF|A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp Length = 454 | Back alignment and structure |
|
| >pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 | Back alignment and structure |
| >pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 | Back alignment and structure |
| >pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 | Back alignment and structure |
| >pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 | Back alignment and structure |
| >pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 109 | |||
| 2vch_A | 480 | Hydroquinone glucosyltransferase; glycosyltransfer | 2e-33 | |
| 3hbf_A | 454 | Flavonoid 3-O-glucosyltransferase; glycosyltransfe | 2e-32 | |
| 2acv_A | 463 | Triterpene UDP-glucosyl transferase UGT71G1; glyco | 1e-31 | |
| 2c1x_A | 456 | UDP-glucose flavonoid 3-O glycosyltransferase; WIN | 5e-31 | |
| 2pq6_A | 482 | UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl | 1e-28 | |
| 2iyf_A | 430 | OLED, oleandomycin glycosyltransferase; antibiotic | 7e-04 |
| >2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 | Back alignment and structure |
|---|
Score = 119 bits (300), Expect = 2e-33
Identities = 28/109 (25%), Positives = 55/109 (50%), Gaps = 8/109 (7%)
Query: 6 WSSILESVAAGVPMATWPLYEEQFLKKKLVTDALRIGVG--------VEKDDITKALAEL 57
W+S LESV +G+P+ WPLY EQ + L+++ +R + V ++++ + + L
Sbjct: 367 WNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGL 426
Query: 58 MVSKSANNMRNKTKGPGKTARKAVEEGGSSFSDLNALLEDLISICSRNE 106
M + +RNK K + A + +++ G+S L+ + + E
Sbjct: 427 MEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKAHKKELE 475
|
| >3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 | Back alignment and structure |
|---|
| >2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 | Back alignment and structure |
|---|
| >2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 | Back alignment and structure |
|---|
| >2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 | Back alignment and structure |
|---|
| >2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| 3hbf_A | 454 | Flavonoid 3-O-glucosyltransferase; glycosyltransfe | 99.96 | |
| 2vch_A | 480 | Hydroquinone glucosyltransferase; glycosyltransfer | 99.95 | |
| 2c1x_A | 456 | UDP-glucose flavonoid 3-O glycosyltransferase; WIN | 99.95 | |
| 2pq6_A | 482 | UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl | 99.95 | |
| 2acv_A | 463 | Triterpene UDP-glucosyl transferase UGT71G1; glyco | 99.94 | |
| 4amg_A | 400 | Snogd; transferase, polyketide biosynthesis, GT1 f | 99.78 | |
| 2iya_A | 424 | OLEI, oleandomycin glycosyltransferase; carbohydra | 99.69 | |
| 2o6l_A | 170 | UDP-glucuronosyltransferase 2B7; drug metabolism, | 99.68 | |
| 1iir_A | 415 | Glycosyltransferase GTFB; rossmann fold; 1.80A {Am | 99.66 | |
| 1rrv_A | 416 | Glycosyltransferase GTFD; GT-B, glycosyltransferas | 99.63 | |
| 2p6p_A | 384 | Glycosyl transferase; X-RAY-diffraction,urdamycina | 99.63 | |
| 2yjn_A | 441 | ERYCIII, glycosyltransferase; transferase, cytochr | 99.59 | |
| 3h4t_A | 404 | Glycosyltransferase GTFA, glycosyltransferase; van | 99.58 | |
| 3rsc_A | 415 | CALG2; TDP, enediyne, structural genomics, PSI-2, | 99.57 | |
| 2iyf_A | 430 | OLED, oleandomycin glycosyltransferase; antibiotic | 99.51 | |
| 3ia7_A | 402 | CALG4; glycosysltransferase, calicheamicin, enediy | 99.51 | |
| 4fzr_A | 398 | SSFS6; structural genomics, PSI-biology, protein s | 99.47 | |
| 3tsa_A | 391 | SPNG, NDP-rhamnosyltransferase; glycosyltransferas | 99.44 | |
| 3oti_A | 398 | CALG3; calicheamicin, TDP, structural genomics, PS | 99.34 | |
| 3otg_A | 412 | CALG1; calicheamicin, TDP, structural genomics, PS | 99.31 | |
| 3s2u_A | 365 | UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape | 99.06 | |
| 2jzc_A | 224 | UDP-N-acetylglucosamine transferase subunit ALG13; | 98.95 | |
| 1f0k_A | 364 | MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe | 98.4 | |
| 3hbm_A | 282 | UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je | 97.94 | |
| 2xci_A | 374 | KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci | 97.35 | |
| 1v4v_A | 376 | UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t | 96.68 | |
| 2gek_A | 406 | Phosphatidylinositol mannosyltransferase (PIMA); G | 96.6 | |
| 2f9f_A | 177 | First mannosyl transferase (WBAZ-1); alpha-beta pr | 96.44 | |
| 3rhz_A | 339 | GTF3, nucleotide sugar synthetase-like protein; gl | 96.27 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 96.26 | |
| 3okp_A | 394 | GDP-mannose-dependent alpha-(1-6)-phosphatidylino | 96.11 | |
| 2iw1_A | 374 | Lipopolysaccharide core biosynthesis protein RFAG; | 96.06 | |
| 2jjm_A | 394 | Glycosyl transferase, group 1 family protein; anth | 95.99 | |
| 3ot5_A | 403 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 95.99 | |
| 3oy2_A | 413 | Glycosyltransferase B736L; rossmann fold, GDP-mann | 95.96 | |
| 2x6q_A | 416 | Trehalose-synthase TRET; biosynthetic protein; 2.2 | 95.96 | |
| 3c48_A | 438 | Predicted glycosyltransferases; retaining glycosyl | 95.95 | |
| 2bfw_A | 200 | GLGA glycogen synthase; glycosyltransferase family | 95.66 | |
| 1vgv_A | 384 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 95.61 | |
| 2r60_A | 499 | Glycosyl transferase, group 1; rossmann-fold; 1.80 | 95.51 | |
| 3fro_A | 439 | GLGA glycogen synthase; glycosyltransferase family | 95.46 | |
| 3qhp_A | 166 | Type 1 capsular polysaccharide biosynthesis prote | 95.21 | |
| 3beo_A | 375 | UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a | 94.38 | |
| 3dzc_A | 396 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 94.24 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 94.23 | |
| 2iuy_A | 342 | Avigt4, glycosyltransferase; antibiotics, family G | 94.08 | |
| 3q3e_A | 631 | HMW1C-like glycosyltransferase; N-glycosylation; 2 | 93.11 | |
| 1rzu_A | 485 | Glycogen synthase 1; glycosyl-transferase, GT-B fo | 92.71 | |
| 2qzs_A | 485 | Glycogen synthase; glycosyl-transferase, GT-B fold | 92.59 | |
| 4hwg_A | 385 | UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc | 92.29 | |
| 3s28_A | 816 | Sucrose synthase 1; glycosyltransferase, sucrose m | 90.67 | |
| 3tl4_X | 187 | Glutaminyl-tRNA synthetase; glutamine, appended do | 90.01 | |
| 3vue_A | 536 | GBSS-I, granule-bound starch synthase 1, chloropla | 89.41 | |
| 2x0d_A | 413 | WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge | 81.36 |
| >3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* | Back alignment and structure |
|---|
Probab=99.96 E-value=8.9e-30 Score=198.72 Aligned_cols=99 Identities=37% Similarity=0.568 Sum_probs=94.5
Q ss_pred CccCChhhHHHHHHcCCCeEecCCcchhhhHHHHHHHHhccccc-----cCHHHHHHHHHHhhcccchHHHHHHHHHHHH
Q 047426 1 MTNYEWSSILESVAAGVPMATWPLYEEQFLKKKLVTDALRIGVG-----VEKDDITKALAELMVSKSANNMRNKTKGPGK 75 (109)
Q Consensus 1 vtHgG~~s~~Eal~~GvP~i~~P~~~DQ~~na~~~~~~~g~g~~-----~~~~~i~~ai~~vl~~~~~~~~r~~a~~l~~ 75 (109)
||||||||++|++++|||||+||+++||+.||+++++.||+|+. +++++|.++|+++|+++++++||++|++|++
T Consensus 350 vtH~G~~S~~Eal~~GvP~i~~P~~~DQ~~Na~~v~~~~g~Gv~l~~~~~~~~~l~~av~~ll~~~~~~~~r~~a~~l~~ 429 (454)
T 3hbf_A 350 LTHSGWNSVLECIVGGVPMISRPFFGDQGLNTILTESVLEIGVGVDNGVLTKESIKKALELTMSSEKGGIMRQKIVKLKE 429 (454)
T ss_dssp EECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHTTSCSEEECGGGSCCHHHHHHHHHHHHSSHHHHHHHHHHHHHHH
T ss_pred EecCCcchHHHHHHcCCCEecCcccccHHHHHHHHHHhhCeeEEecCCCCCHHHHHHHHHHHHCCChHHHHHHHHHHHHH
Confidence 69999999999999999999999999999999999887899987 7899999999999998778899999999999
Q ss_pred HHHHhHHcCCChHHHHHHHHHHHH
Q 047426 76 TARKAVEEGGSSFSDLNALLEDLI 99 (109)
Q Consensus 76 ~~~~a~~~gGss~~~l~~~v~~l~ 99 (109)
.+++++.+||||+.||++||+.|.
T Consensus 430 ~~~~a~~~gGsS~~~l~~~v~~i~ 453 (454)
T 3hbf_A 430 SAFKAVEQNGTSAMDFTTLIQIVT 453 (454)
T ss_dssp HHHHHTSTTSHHHHHHHHHHHHHT
T ss_pred HHHHhhccCCCHHHHHHHHHHHHh
Confidence 999999999999999999999874
|
| >2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* | Back alignment and structure |
|---|
| >2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* | Back alignment and structure |
|---|
| >2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 | Back alignment and structure |
|---|
| >2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* | Back alignment and structure |
|---|
| >4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* | Back alignment and structure |
|---|
| >2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 | Back alignment and structure |
|---|
| >1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 | Back alignment and structure |
|---|
| >2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* | Back alignment and structure |
|---|
| >3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* | Back alignment and structure |
|---|
| >2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* | Back alignment and structure |
|---|
| >3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* | Back alignment and structure |
|---|
| >3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* | Back alignment and structure |
|---|
| >3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* | Back alignment and structure |
|---|
| >3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A | Back alignment and structure |
|---|
| >1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* | Back alignment and structure |
|---|
| >3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* | Back alignment and structure |
|---|
| >2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* | Back alignment and structure |
|---|
| >1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 | Back alignment and structure |
|---|
| >2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* | Back alignment and structure |
|---|
| >2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* | Back alignment and structure |
|---|
| >2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* | Back alignment and structure |
|---|
| >2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* | Back alignment and structure |
|---|
| >3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* | Back alignment and structure |
|---|
| >2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* | Back alignment and structure |
|---|
| >3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* | Back alignment and structure |
|---|
| >2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* | Back alignment and structure |
|---|
| >2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* | Back alignment and structure |
|---|
| >3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* | Back alignment and structure |
|---|
| >3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A | Back alignment and structure |
|---|
| >3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* | Back alignment and structure |
|---|
| >3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A | Back alignment and structure |
|---|
| >1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A | Back alignment and structure |
|---|
| >2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A | Back alignment and structure |
|---|
| >4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} | Back alignment and structure |
|---|
| >3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* | Back alignment and structure |
|---|
| >3tl4_X Glutaminyl-tRNA synthetase; glutamine, appended domain, hinge, tRNA LIG amidotransferase, ligase; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* | Back alignment and structure |
|---|
| >2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 109 | ||||
| d2pq6a1 | 473 | c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe | 4e-29 | |
| d2vcha1 | 471 | c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera | 2e-28 | |
| d2c1xa1 | 450 | c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc | 2e-26 | |
| d2acva1 | 461 | c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf | 5e-25 | |
| d1rrva_ | 401 | c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am | 7e-12 | |
| d1iira_ | 401 | c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol | 3e-11 | |
| d1pn3a_ | 391 | c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA | 2e-06 |
| >d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: UDP-Glycosyltransferase/glycogen phosphorylase superfamily: UDP-Glycosyltransferase/glycogen phosphorylase family: UDPGT-like domain: (Iso)flavonoid glycosyltransferase species: Medicago truncatula [TaxId: 3880]
Score = 106 bits (264), Expect = 4e-29
Identities = 28/103 (27%), Positives = 55/103 (53%), Gaps = 4/103 (3%)
Query: 1 MTNYEWSSILESVAAGVPMATWPLYEEQFLKKKLVTDALRIGV----GVEKDDITKALAE 56
+T+ W+S ES+ AGVPM WP + +Q + + + IG+ V+++++ K + E
Sbjct: 369 LTHCGWNSTTESICAGVPMLCWPFFADQPTDCRFICNEWEIGMEIDTNVKREELAKLINE 428
Query: 57 LMVSKSANNMRNKTKGPGKTARKAVEEGGSSFSDLNALLEDLI 99
++ M+ K K A + GG S+ +LN +++D++
Sbjct: 429 VIAGDKGKKMKQKAMELKKKAEENTRPGGCSYMNLNKVIKDVL 471
|
| >d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 | Back information, alignment and structure |
|---|
| >d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 | Back information, alignment and structure |
|---|
| >d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 | Back information, alignment and structure |
|---|
| >d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 | Back information, alignment and structure |
|---|
| >d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 | Back information, alignment and structure |
|---|
| >d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| d2vcha1 | 471 | Hydroquinone glucosyltransferase {Thale cress (Ara | 100.0 | |
| d2pq6a1 | 473 | (Iso)flavonoid glycosyltransferase {Medicago trunc | 99.97 | |
| d2acva1 | 461 | Triterpene UDP-glucosyl transferase UGT71G1 {Medic | 99.97 | |
| d2c1xa1 | 450 | UDP glucose:flavonoid 3-o-glucosyltransferase {Gra | 99.95 | |
| d1iira_ | 401 | UDP-glucosyltransferase GtfB {Amycolatopsis orient | 99.82 | |
| d1rrva_ | 401 | TDP-vancosaminyltransferase GftD {Amycolatopsis or | 99.78 | |
| d1pn3a_ | 391 | TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi | 99.77 | |
| d1f0ka_ | 351 | Peptidoglycan biosynthesis glycosyltransferase Mur | 99.36 | |
| d2iw1a1 | 370 | Lipopolysaccharide core biosynthesis protein RfaG | 96.79 | |
| d2f9fa1 | 166 | First mannosyl transferase WbaZ {Archaeoglobus ful | 96.43 | |
| d2bisa1 | 437 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 94.83 | |
| d2bfwa1 | 196 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 94.71 | |
| d1rzua_ | 477 | Glycogen synthase 1, GlgA {Agrobacterium tumefacie | 91.43 | |
| d1uqta_ | 456 | Trehalose-6-phosphate synthase, OtsA {Escherichia | 84.45 | |
| d1v4va_ | 373 | UDP-N-acetylglucosamine 2-epimerase {Thermus therm | 82.26 |
| >d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: UDP-Glycosyltransferase/glycogen phosphorylase superfamily: UDP-Glycosyltransferase/glycogen phosphorylase family: UDPGT-like domain: Hydroquinone glucosyltransferase species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=100.00 E-value=1.3e-33 Score=210.33 Aligned_cols=104 Identities=27% Similarity=0.536 Sum_probs=98.8
Q ss_pred CccCChhhHHHHHHcCCCeEecCCcchhhhHHHHHHHHhccccc--------cCHHHHHHHHHHhhcccchHHHHHHHHH
Q 047426 1 MTNYEWSSILESVAAGVPMATWPLYEEQFLKKKLVTDALRIGVG--------VEKDDITKALAELMVSKSANNMRNKTKG 72 (109)
Q Consensus 1 vtHgG~~s~~Eal~~GvP~i~~P~~~DQ~~na~~~~~~~g~g~~--------~~~~~i~~ai~~vl~~~~~~~~r~~a~~ 72 (109)
|||||+||++||+++|||||++|+++||+.||+++++.+|+|+. +++++|.++|+++|++++|+.||+||++
T Consensus 357 VtHGG~gS~~EAl~~GvP~v~~P~~~DQ~~nA~rv~e~lG~Gv~l~~~~~~~~t~~~l~~ai~~vl~~~~~~~~r~ra~~ 436 (471)
T d2vcha1 357 LTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGLMEGEEGKGVRNKMKE 436 (471)
T ss_dssp EECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTTCCEECCCCCTTSCCCHHHHHHHHHHHHTSTHHHHHHHHHHH
T ss_pred EecCCccHHHHHHHcCCCEEEcccccccHHHHHHHHHHheeEEEEecCCCCcCCHHHHHHHHHHHhCCcHHHHHHHHHHH
Confidence 69999999999999999999999999999999999887899986 5899999999999999988899999999
Q ss_pred HHHHHHHhHHcCCChHHHHHHHHHHHHhcccc
Q 047426 73 PGKTARKAVEEGGSSFSDLNALLEDLISICSR 104 (109)
Q Consensus 73 l~~~~~~a~~~gGss~~~l~~~v~~l~~~~~~ 104 (109)
|++++++|+++||||+.+++.||+.++...++
T Consensus 437 l~e~~~~a~~~gG~s~~~~~~~~~~~~~~~~~ 468 (471)
T d2vcha1 437 LKEAACRVLKDDGTSTKALSLVALKWKAHKKE 468 (471)
T ss_dssp HHHHHHHHTSTTSHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHhCCCCHHHHHHHHHHHHHHhhHh
Confidence 99999999999999999999999999987654
|
| >d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} | Back information, alignment and structure |
|---|
| >d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} | Back information, alignment and structure |
|---|
| >d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} | Back information, alignment and structure |
|---|
| >d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|