Citrus Sinensis ID: 047461


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
GTEKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIERIPESIIQLFVSGYLLLSYGIVEDTLRIQHTNHTPAVRWQEIWQEVWLNVCL
ccccEEEEEEEcccccEEcccHHHHcccccccEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEEEcccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccccccccccEEEccccc
cccEEEEEEEEcccccHccccHHHHHcccccEEEEEEcccccccccccccccccccHHHcEEEEccccccccccccccHHHHEEEEcccccHHHccccccccHcccEEEccccHHHHHcccccccHHHHHcccEEEccccccHccccccHHHHHHccEEEccccHHHcccccccHHHHHEEEccccccEcccccHHHHHcccEEEccccccHccccccHcccHcccEEEcccccHHHcccccHHcHHHHHEEEccccccccccccHHHHHcccEEEccccccccccccHHccccHHHHHHHHHHHccccccc
gtekiegmcldmskvkelhpnsntftkmpklRFLKFYSSLfngenkckmsylqdpgfaevkylhwhgyplkslpsnlsaeklmllevpdsdikRLWDCVKHYSKLNQIIHAACHKLIakipnptlmprLNKLVTLnlrgskslkslpsgifnlefltkldlsgcsklkrlpeissgnisWLFLRGIAIEELPSSIERLLRLgyldlsdckrlkslpsslyrlkslgvlslcgcsnlqrlpeclgqlsspitfnLAKTNIERIPESIIQLFVSGYLLLSYgivedtlriqhtnhtpavrWQEIWQEVWLNVCL
gtekiegmcldmskvkelhpnsntftkmpkLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLkrlpeissgnisWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIERIPESIIQLFVSGYLLLSYGIVEDTLRIQHTNHTPAVRWQEIWQEVWLNVCL
GTEKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIERIPESIIQLFVSGYLLLSYGIVEDTLRIQHTNHTPAVRWQEIWQEVWLNVCL
************************FTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIERIPESIIQLFVSGYLLLSYGIVEDTLRIQHTNHTPAVRWQEIWQEVWLNVC*
GTEKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENK*KMS***DPGFAEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIERIPESIIQLFVSGYLLLSYGIVEDTL*I*******AVRWQEIWQEVWLNVCL
GTEKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIERIPESIIQLFVSGYLLLSYGIVEDTLRIQHTNHTPAVRWQEIWQEVWLNVCL
*TEKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIERIPESIIQLFVSGYLLLSYGIVEDTLRIQHTNHTPAVRWQEIWQEVWLNVCL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GTEKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGFAEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIERIPESIIQLFVSGYLLLSYGIVEDTLRIQHTNHTPAVRWQEIWQEVWLNVCL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query312 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti no no 0.871 0.143 0.361 1e-35
Q40392 1144 TMV resistance protein N N/A no 0.634 0.173 0.352 2e-19
O82500 1095 Putative disease resistan no no 0.810 0.231 0.296 2e-19
O23530 1301 Protein SUPPRESSOR OF npr no no 0.628 0.150 0.356 8e-19
Q9FH83 1288 Probable WRKY transcripti no no 0.788 0.190 0.310 1e-17
Q9FL92 1372 Probable WRKY transcripti no no 0.788 0.179 0.303 5e-17
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.849 0.164 0.259 5e-14
P0CB16 1201 Putative disease resistan no no 0.435 0.113 0.364 2e-10
Q9RBS2 1024 Protein PopC OS=Ralstonia no no 0.391 0.119 0.368 8e-10
Q8BGI7337 Leucine-rich repeat-conta yes no 0.560 0.519 0.308 2e-07
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  150 bits (379), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 163/307 (53%), Gaps = 35/307 (11%)

Query: 1    GTEKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGF--A 58
            GT  IEG+ LDM  +K    N N F KM  LR LK Y S    E K  +S+ Q   +  +
Sbjct: 1149 GTSAIEGIFLDMLNLK-FDANPNVFEKMCNLRLLKLYCS--KAEEKHGVSFPQGLEYLPS 1205

Query: 59   EVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVK-HYSKLNQIIHAACHKLI 117
            +++ LHW  YPL SLP + + E L+ L +P S  K+LW   K  +   N  +       +
Sbjct: 1206 KLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRL 1265

Query: 118  AKIPNPTLMPRLN---------------------------KLVTLNLRGSKSLKSLPSGI 150
            +     T +PRL+                           KLV LNL+G   L+++PS +
Sbjct: 1266 SYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPS-M 1324

Query: 151  FNLEFLTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCK 210
             +LE L  L+LSGCSKL   PEIS  N+  L++ G  I+E+PSSI+ L+ L  LDL + +
Sbjct: 1325 VDLESLEVLNLSGCSKLGNFPEISP-NVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSR 1383

Query: 211  RLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIERIPESIIQLF 270
             LK+LP+S+Y+LK L  L+L GC +L+R P+   ++      +L++T+I+ +P SI  L 
Sbjct: 1384 HLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLT 1443

Query: 271  VSGYLLL 277
                LL 
Sbjct: 1444 ALDELLF 1450




Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
359486071 1261 PREDICTED: TMV resistance protein N-like 0.855 0.211 0.399 3e-41
359486073 1296 PREDICTED: TMV resistance protein N-like 0.875 0.210 0.405 4e-41
224127754 1125 tir-nbs-lrr resistance protein [Populus 0.887 0.246 0.360 4e-41
225460354 1174 PREDICTED: TMV resistance protein N-like 0.830 0.220 0.390 1e-40
359486075 1291 PREDICTED: TMV resistance protein N-like 0.875 0.211 0.398 3e-40
359496030 1195 PREDICTED: TMV resistance protein N-like 0.785 0.205 0.397 1e-39
359496026 1250 PREDICTED: TMV resistance protein N-like 0.948 0.236 0.366 1e-39
359493487 1162 PREDICTED: TMV resistance protein N-like 0.852 0.228 0.382 2e-39
359495221 1181 PREDICTED: TMV resistance protein N-like 0.871 0.230 0.402 5e-39
147822714 1254 hypothetical protein VITISV_015601 [Viti 0.871 0.216 0.402 5e-39
>gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  175 bits (443), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 166/308 (53%), Gaps = 41/308 (13%)

Query: 1   GTEKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGEN--------------K 46
           GTE +EGM L++S +KELH + N FTKM KLR L+FY +   G +              +
Sbjct: 530 GTEAVEGMVLNLSTLKELHFSVNVFTKMNKLRVLRFYDAQIWGSSWIGRHNDRYKSPYTE 589

Query: 47  CKMSYLQDPGF--AEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSK 104
           CK     D  F    ++ LHW GYPLKSLPSN   EKL+ L++  S +++LW+  K + K
Sbjct: 590 CKFHLSGDFKFLSNHLRSLHWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWEGNKSFQK 649

Query: 105 LNQIIHAACHKLIAKIPNPTLMPR---------------------LNKLVTLNLRGSKSL 143
           L  I  +    LI K P+ +  P+                     L KL+ LNL G K+L
Sbjct: 650 LKFIELSHSQHLI-KTPDFSGAPKLRRIILEGCTSLVKVHPSIGALKKLIFLNLEGCKNL 708

Query: 144 KSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSG--NISWLFLRGIAIEELPSSIERLLRL 201
           KS  S I +LE L  + LSGCSKLK+ PE+     N+  L L+G AI+ LP SIE L  L
Sbjct: 709 KSFSSSI-HLESLQTITLSGCSKLKKFPEVQGAMDNLPELSLKGTAIKGLPLSIEYLNGL 767

Query: 202 GYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIER 261
             L+L +CK L+SLP  +++LKSL  L L  CS L++LPE    + S     L  T +  
Sbjct: 768 SLLNLEECKSLESLPGCIFKLKSLKTLILSNCSRLKKLPEIQENMESLKKLFLDDTGLRE 827

Query: 262 IPESIIQL 269
           +P SI  L
Sbjct: 828 LPSSIEHL 835




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127754|ref|XP_002329169.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870950|gb|EEF08081.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496030|ref|XP_002277205.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495221|ref|XP_002274238.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147822714|emb|CAN68293.1| hypothetical protein VITISV_015601 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
TAIR|locus:2153207 1165 AT5G45060 [Arabidopsis thalian 0.814 0.218 0.362 2.4e-29
TAIR|locus:2081810 1226 AT3G51570 [Arabidopsis thalian 0.810 0.206 0.367 1.4e-28
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.810 0.200 0.350 1.5e-28
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.814 0.134 0.357 1.9e-27
TAIR|locus:2827629 1355 AT2G17050 [Arabidopsis thalian 0.820 0.188 0.354 4.1e-27
TAIR|locus:2155322 1170 LAZ5 "LAZARUS 5" [Arabidopsis 0.820 0.218 0.332 3.5e-25
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.823 0.198 0.300 5.2e-25
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.762 0.195 0.333 6.1e-25
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.852 0.216 0.308 1e-24
TAIR|locus:2175075 1068 AT5G41750 [Arabidopsis thalian 0.810 0.236 0.326 1.3e-24
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 338 (124.0 bits), Expect = 2.4e-29, P = 2.4e-29
 Identities = 98/270 (36%), Positives = 145/270 (53%)

Query:     1 GTEKIEGMCLDMSKVK-ELHPNSNTFTKMPKLRFLKFYSSLFNGE----NKCKM-SYLQD 54
             G   + G+ LD+S+VK E   +   F  M  LR+LK Y+S    E    NK  M   L+ 
Sbjct:   553 GAANVRGIFLDLSEVKVETSLDREHFKNMRNLRYLKLYNSHCPHECLTNNKINMPDGLEL 612

Query:    55 PGFAEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACH 114
             P   EV+ LHW  +PL+ LP++     L+ L++P S+I+RLWD VK    L  +     H
Sbjct:   613 P-LKEVRCLHWLKFPLEELPNDFDPINLVDLKLPYSEIERLWDGVKDTPVLKWV--DLNH 669

Query:   115 KLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEIS 174
                +K+ + + + +   L  LNL G  SL+SL     NL  L  L LS CS  K  P I 
Sbjct:   670 S--SKLCSLSGLSKAQNLQRLNLEGCTSLESLRD--VNLTSLKTLTLSNCSNFKEFPLIP 725

Query:   175 SGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCS 234
               N+  L+L G +I +LP ++  L RL  L++ DCK L+++P+ +  LK+L  L L GCS
Sbjct:   726 E-NLKALYLDGTSISQLPDNVGNLKRLVLLNMKDCKVLETIPTCVSELKTLQKLVLSGCS 784

Query:   235 NLQRLPECLGQLSSPITFNLAKTNIERIPE 264
              L+  PE + + S  I   L  T+I+ +P+
Sbjct:   785 KLKEFPE-INKSSLKILL-LDGTSIKTMPQ 812


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01250017
tir-nbs-lrr resistance protein (1125 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-29
PLN03210 1153 PLN03210, PLN03210, Resistant to P 7e-24
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  118 bits (298), Expect = 1e-29
 Identities = 89/272 (32%), Positives = 132/272 (48%), Gaps = 63/272 (23%)

Query: 1   GTEKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGF--- 57
           GT+K+ G+ LD+ ++ ELH + N F  M  L FLKFY+  +  + K ++ +    GF   
Sbjct: 530 GTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKW--DQKKEVRWHLPEGFDYL 587

Query: 58  -AEVKYLHWHGYPLKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKL 116
             +++ L W  YPL+ +PSN   E L+ L++  S +++LWD V                 
Sbjct: 588 PPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVH---------------- 631

Query: 117 IAKIPNPTLMPRLNKLVTLNLRGSKSLKSLP--SGIFNLEFLTKLDLSGCSKLKRLPEIS 174
                       L  L  ++LRGSK+LK +P  S   NLE    L LS CS L       
Sbjct: 632 -----------SLTGLRNIDLRGSKNLKEIPDLSMATNLE---TLKLSDCSSLV------ 671

Query: 175 SGNISWLFLRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCS 234
                          ELPSSI+ L +L  LD+S C+ L+ LP+ +  LKSL  L+L GCS
Sbjct: 672 ---------------ELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCS 715

Query: 235 NLQRLPECLGQLSSPITFNLAKTNIERIPESI 266
            L+  P+    +S     +L +T IE  P ++
Sbjct: 716 RLKSFPDISTNIS---WLDLDETAIEEFPSNL 744


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.81
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.75
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.68
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.65
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.49
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.48
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.25
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
PLN03150623 hypothetical protein; Provisional 98.95
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.93
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.91
PLN03150623 hypothetical protein; Provisional 98.77
KOG4341483 consensus F-box protein containing LRR [General fu 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.6
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.59
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.46
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.35
PRK15386 426 type III secretion protein GogB; Provisional 98.29
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.23
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.13
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.05
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.02
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.01
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.01
PRK15386 426 type III secretion protein GogB; Provisional 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.94
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.64
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.62
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.61
KOG4341483 consensus F-box protein containing LRR [General fu 97.55
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.22
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.83
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.83
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.59
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.56
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.7
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.31
KOG1947 482 consensus Leucine rich repeat proteins, some prote 94.85
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.77
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.31
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.07
smart0037026 LRR Leucine-rich repeats, outliers. 92.6
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.6
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.57
KOG4308 478 consensus LRR-containing protein [Function unknown 90.45
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.14
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.74
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.2
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.78
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.93  E-value=5.3e-25  Score=217.72  Aligned_cols=271  Identities=18%  Similarity=0.213  Sum_probs=140.0

Q ss_pred             cceEEEEeecCCccccCCCcchhcCCCCCcEEEeeccccccccccccccCCCCC-C-CCccEEeeCCCCCCCCCCccCcC
Q 047461            3 EKIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPG-F-AEVKYLHWHGYPLKSLPSNLSAE   80 (312)
Q Consensus         3 ~~i~~~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~-~-~~L~~L~l~~~~~~~~~~~~~l~   80 (312)
                      .+++.+++..++.  .+.....|..+++|++|++++|.+.      ...+..+. . .+|++|++++|.+....+...++
T Consensus        69 ~~v~~L~L~~~~i--~~~~~~~~~~l~~L~~L~Ls~n~~~------~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~  140 (968)
T PLN00113         69 SRVVSIDLSGKNI--SGKISSAIFRLPYIQTINLSNNQLS------GPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIP  140 (968)
T ss_pred             CcEEEEEecCCCc--cccCChHHhCCCCCCEEECCCCccC------CcCChHHhccCCCCCEEECcCCccccccCccccC
Confidence            3566666554433  2233567888999999999887652      22333332 2 66777777776654322223455


Q ss_pred             CccEEeCCCCccc-chhhhcccCCCchhcchhhcccccccCCCCCCcCCCcCCcEEEcCCCCcCccccccccCCCcCcEE
Q 047461           81 KLMLLEVPDSDIK-RLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKL  159 (312)
Q Consensus        81 ~L~~L~l~~~~~~-~~~~~~~~l~~L~~l~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L  159 (312)
                      +|++|++++|.+. .+|..+..+++|+.|...... +...+|.  .++.+++|++|++++|.+.+.+|..+..+++|++|
T Consensus       141 ~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~-l~~~~p~--~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  217 (968)
T PLN00113        141 NLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV-LVGKIPN--SLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWI  217 (968)
T ss_pred             CCCEEECcCCcccccCChHHhcCCCCCEEECccCc-ccccCCh--hhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEE
Confidence            6666666666655 345555666666633332210 1122333  45555555555555555545555555555555555


Q ss_pred             eccCCCCCCCCCccc--cCCCCeEEcCCcccc-cchHHHHh------------------------cCCCCEEecCCCCCC
Q 047461          160 DLSGCSKLKRLPEIS--SGNISWLFLRGIAIE-ELPSSIER------------------------LLRLGYLDLSDCKRL  212 (312)
Q Consensus       160 ~l~~~~~l~~~p~~~--~~~L~~L~l~~~~l~-~l~~~~~~------------------------l~~L~~L~l~~n~~~  212 (312)
                      ++++|...+.+|...  .++|+.|++++|.++ .+|..++.                        +++|++|++++|.+.
T Consensus       218 ~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~  297 (968)
T PLN00113        218 YLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLS  297 (968)
T ss_pred             ECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeec
Confidence            555544333333221  234455555544443 23444444                        444555555444444


Q ss_pred             CcCchhhhcCCCCCeEeccCCCCCCcchhhhhCCCCCcEEeccCCCCc-ccchHhhccCCCcEEEecCCcCCc
Q 047461          213 KSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIE-RIPESIIQLFVSGYLLLSYGIVED  284 (312)
Q Consensus       213 ~~~~~~l~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~l~~n~l~-~~~~~l~~~~~L~~L~l~~n~~~~  284 (312)
                      +.+|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.++ .+|..++.+++|+.|++++|.+.+
T Consensus       298 ~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~  370 (968)
T PLN00113        298 GEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTG  370 (968)
T ss_pred             cCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEe
Confidence            444444444555555555554444445555555555555555555554 444455555555555555555443



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 5e-08
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 55.1 bits (131), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 42/126 (33%), Positives = 59/126 (46%), Gaps = 22/126 (17%) Query: 123 PTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLPEISSGNISWLF 182 P + L L +L +R S L +L I +L L +LDL GC+ L+ P I G Sbjct: 199 PASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR----- 252 Query: 183 LRGIAIEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPEC 242 + ++RL+ L DC L +LP ++RL L L L GC NL RLP Sbjct: 253 ----------APLKRLI------LKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSL 296 Query: 243 LGQLSS 248 + QL + Sbjct: 297 IAQLPA 302
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-23
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-08
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-07
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  101 bits (254), Expect = 5e-25
 Identities = 41/211 (19%), Positives = 68/211 (32%), Gaps = 18/211 (8%)

Query: 70  LKSLPSNLSAEKLMLLEVPDSDIKRLWDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRL 129
           L+     LS  +       D +         + +     I     + +    +       
Sbjct: 25  LRPYHDVLS--QWQRHYNADRNRWHSAWRQANSNNPQ--IETRTGRALKATADLLEDATQ 80

Query: 130 NKLVTLNLRGSKSLKSLPSGIFNLEFLTKLDLSGCSKLKRLP-EISS-GNISWLFLRGIA 187
              V L LR    L   P   F L  L  + +     L  LP  +     +  L L    
Sbjct: 81  PGRVALELRSVP-LPQFPDQAFRLSHLQHMTIDAA-GLMELPDTMQQFAGLETLTLARNP 138

Query: 188 IEELPSSIERLLRLGYLDLSDCKRLKSLPSSLYR---------LKSLGVLSLCGCSNLQR 238
           +  LP+SI  L RL  L +  C  L  LP  L           L +L  L L   + ++ 
Sbjct: 139 LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRL-EWTGIRS 197

Query: 239 LPECLGQLSSPITFNLAKTNIERIPESIIQL 269
           LP  +  L +  +  +  + +  +  +I  L
Sbjct: 198 LPASIANLQNLKSLKIRNSPLSALGPAIHHL 228


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.88
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.71
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.28
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.18
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.68
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.53
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.46
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.44
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.41
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.29
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.99
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.74
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.57
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.48
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.85
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
Probab=99.96  E-value=7e-28  Score=218.10  Aligned_cols=297  Identities=16%  Similarity=0.165  Sum_probs=202.4

Q ss_pred             ceEEEEeecCCccccCCCcchhcCCCCCcEEEeeccccccccccccccCCCCCC-CCccEEeeCCCCCCCC-CCcc-CcC
Q 047461            4 KIEGMCLDMSKVKELHPNSNTFTKMPKLRFLKFYSSLFNGENKCKMSYLQDPGF-AEVKYLHWHGYPLKSL-PSNL-SAE   80 (312)
Q Consensus         4 ~i~~~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~-~~L~~L~l~~~~~~~~-~~~~-~l~   80 (312)
                      +++.+++..+...  +.....|.++++|++|++++|.+     .....+..+.. ++|++|++++|.+..+ +..+ .++
T Consensus        31 ~l~~L~Ls~n~i~--~~~~~~~~~l~~L~~L~L~~n~~-----~~~i~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~  103 (455)
T 3v47_A           31 HVNYVDLSLNSIA--ELNETSFSRLQDLQFLKVEQQTP-----GLVIRNNTFRGLSSLIILKLDYNQFLQLETGAFNGLA  103 (455)
T ss_dssp             TCCEEECCSSCCC--EECTTTTSSCTTCCEEECCCCST-----TCEECTTTTTTCTTCCEEECTTCTTCEECTTTTTTCT
T ss_pred             ccCEEEecCCccC--cCChhHhccCccccEEECcCCcc-----cceECcccccccccCCEEeCCCCccCccChhhccCcc
Confidence            4566666555443  33457788999999999998764     11222344555 8899999999988766 3344 788


Q ss_pred             CccEEeCCCCcccc-hhhh--cccCCCchhcchhhcccccccC-CCCCCcCCCcCCcEEEcCCCCcCccccccccC----
Q 047461           81 KLMLLEVPDSDIKR-LWDC--VKHYSKLNQIIHAACHKLIAKI-PNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFN----  152 (312)
Q Consensus        81 ~L~~L~l~~~~~~~-~~~~--~~~l~~L~~l~~~~~~~~~~~~-~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~----  152 (312)
                      +|++|++++|.++. .+..  +..+++|+.|......  +..+ +. ..++.+++|++|++++|.+.+..+..+..    
T Consensus       104 ~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~L~~n~--l~~~~~~-~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~~  180 (455)
T 3v47_A          104 NLEVLTLTQCNLDGAVLSGNFFKPLTSLEMLVLRDNN--IKKIQPA-SFFLNMRRFHVLDLTFNKVKSICEEDLLNFQGK  180 (455)
T ss_dssp             TCCEEECTTSCCBTHHHHSSTTTTCTTCCEEECCSSB--CCSCCCC-GGGGGCTTCCEEECTTCCBSCCCTTTSGGGTTC
T ss_pred             cCCEEeCCCCCCCccccCcccccCcccCCEEECCCCc--cCccCcc-cccCCCCcccEEeCCCCcccccChhhhhccccc
Confidence            99999999998875 3333  7788888844333211  2333 22 12678889999999998866555544433    


Q ss_pred             ------------------------------CCcCcEEeccCCCCCCCCC-------------------------------
Q 047461          153 ------------------------------LEFLTKLDLSGCSKLKRLP-------------------------------  171 (312)
Q Consensus       153 ------------------------------~~~L~~L~l~~~~~l~~~p-------------------------------  171 (312)
                                                    +++|++|++++|...+..|                               
T Consensus       181 ~L~~L~l~~n~l~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~  260 (455)
T 3v47_A          181 HFTLLRLSSITLQDMNEYWLGWEKCGNPFKNTSITTLDLSGNGFKESMAKRFFDAIAGTKIQSLILSNSYNMGSSFGHTN  260 (455)
T ss_dssp             EEEEEECTTCBCTTCSTTCTTHHHHCCTTTTCEEEEEECTTSCCCHHHHHHHHHHTTTCCEEEEECTTCTTTSCCTTCCS
T ss_pred             cccccccccCcccccchhhccccccccccccceeeeEecCCCcccccchhhhhccccccceeeEeeccccccccccchhh
Confidence                                          2567777777764221000                               


Q ss_pred             ----------ccccCCCCeEEcCCcccccc-hHHHHhcCCCCEEecCCCCCCCcCchhhhcCCCCCeEeccCCCCCCcch
Q 047461          172 ----------EISSGNISWLFLRGIAIEEL-PSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLP  240 (312)
Q Consensus       172 ----------~~~~~~L~~L~l~~~~l~~l-~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~p  240 (312)
                                .....+++.+++++|.++++ |..++.+++|++|++++|++.+..+..++.+++|++|++++|.+.+..|
T Consensus       261 ~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~  340 (455)
T 3v47_A          261 FKDPDNFTFKGLEASGVKTCDLSKSKIFALLKSVFSHFTDLEQLTLAQNEINKIDDNAFWGLTHLLKLNLSQNFLGSIDS  340 (455)
T ss_dssp             SCCCCTTTTGGGTTSCCCEEECCSSCCCEECTTTTTTCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCEECG
T ss_pred             hccCcccccccccccCceEEEecCccccccchhhcccCCCCCEEECCCCcccccChhHhcCcccCCEEECCCCccCCcCh
Confidence                      00014677888888877754 4567778888888888888877777778888888888888887766667


Q ss_pred             hhhhCCCCCcEEeccCCCCccc-chHhhccCCCcEEEecCCcCCccccccccCCCCchhHHHhhhcceeeec
Q 047461          241 ECLGQLSSPITFNLAKTNIERI-PESIIQLFVSGYLLLSYGIVEDTLRIQHTNHTPAVRWQEIWQEVWLNVC  311 (312)
Q Consensus       241 ~~~~~l~~L~~L~l~~n~l~~~-~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  311 (312)
                      ..+..+++|+.|++++|.++.+ |..+..+++|++|++++|++.+ .+...+..++.++.++...+.+.+.|
T Consensus       341 ~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~-~~~~~~~~l~~L~~L~l~~N~l~~~~  411 (455)
T 3v47_A          341 RMFENLDKLEVLDLSYNHIRALGDQSFLGLPNLKELALDTNQLKS-VPDGIFDRLTSLQKIWLHTNPWDCSC  411 (455)
T ss_dssp             GGGTTCTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSSCCSC-CCTTTTTTCTTCCEEECCSSCBCCCT
T ss_pred             hHhcCcccCCEEECCCCcccccChhhccccccccEEECCCCcccc-CCHhHhccCCcccEEEccCCCcccCC
Confidence            7788888888888888888844 6677888888888888888875 33334455666666665555555554



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 312
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 37.1 bits (84), Expect = 0.002
 Identities = 23/106 (21%), Positives = 39/106 (36%), Gaps = 6/106 (5%)

Query: 96  WDCVKHYSKLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEF 155
                 +S L+++     +   +     +L      L  LN+  +K L  LP+    LE 
Sbjct: 250 DVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNK-LIELPALPPRLE- 307

Query: 156 LTKLDLSGCSKLKRLPEISSGNISWLFLRGIAIEELPSSIERLLRL 201
             +L  S    L  +PE    N+  L +    + E P   E +  L
Sbjct: 308 --RLIASFN-HLAEVPE-LPQNLKQLHVEYNPLREFPDIPESVEDL 349


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.53
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.53
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.4
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.12
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.09
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.94
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.47
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.05
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.83
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.63
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.64
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.88  E-value=7.6e-23  Score=174.10  Aligned_cols=245  Identities=16%  Similarity=0.149  Sum_probs=168.3

Q ss_pred             CCCcEEEeeccccccccccccccCCCCCC-CCccEEeeCC-CCCC-CCCCcc-CcCCccEEeCCCCcccchh-hhcccCC
Q 047461           29 PKLRFLKFYSSLFNGENKCKMSYLQDPGF-AEVKYLHWHG-YPLK-SLPSNL-SAEKLMLLEVPDSDIKRLW-DCVKHYS  103 (312)
Q Consensus        29 ~~L~~L~l~~~~~~~~~~~~~~~~~~~~~-~~L~~L~l~~-~~~~-~~~~~~-~l~~L~~L~l~~~~~~~~~-~~~~~l~  103 (312)
                      .+++.|+++++.+.+.    ..+|..+.. ++|++|++++ |.+. .+|..+ ++++|++|++++|.+...+ ..+..++
T Consensus        50 ~~v~~L~L~~~~l~g~----~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~  125 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKP----YPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIK  125 (313)
T ss_dssp             CCEEEEEEECCCCSSC----EECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCT
T ss_pred             EEEEEEECCCCCCCCC----CCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchh
Confidence            4688888888764221    245566666 8889888876 5543 677655 8888999999988887644 4456666


Q ss_pred             CchhcchhhcccccccCCCCCCcCCCcCCcEEEcCCCCcCccccccccCCCcC-cEEeccCCCCCCCCCccc-cCCCCeE
Q 047461          104 KLNQIIHAACHKLIAKIPNPTLMPRLNKLVTLNLRGSKSLKSLPSGIFNLEFL-TKLDLSGCSKLKRLPEIS-SGNISWL  181 (312)
Q Consensus       104 ~L~~l~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L-~~L~l~~~~~l~~~p~~~-~~~L~~L  181 (312)
                      .|+.+...... ....+|.  .++.++.++++++++|.+.+.+|..+..+.++ +.++++.|...+..|... ......+
T Consensus       126 ~L~~l~l~~N~-~~~~~p~--~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l  202 (313)
T d1ogqa_         126 TLVTLDFSYNA-LSGTLPP--SISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFV  202 (313)
T ss_dssp             TCCEEECCSSE-EESCCCG--GGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEE
T ss_pred             hhccccccccc-ccccCch--hhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            77633222211 1333444  77788888888888888777788777776665 677777754433333322 2344567


Q ss_pred             EcCCcccc-cchHHHHhcCCCCEEecCCCCCCCcCchhhhcCCCCCeEeccCCCCCCcchhhhhCCCCCcEEeccCCCCc
Q 047461          182 FLRGIAIE-ELPSSIERLLRLGYLDLSDCKRLKSLPSSLYRLKSLGVLSLCGCSNLQRLPECLGQLSSPITFNLAKTNIE  260 (312)
Q Consensus       182 ~l~~~~l~-~l~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~l~~n~l~  260 (312)
                      ++..+... .+|...+.+.+++.+++++|.+.+.++ .++.+++|+.|++++|.+.+.+|+.++++++|+.|++++|+++
T Consensus       203 ~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~  281 (313)
T d1ogqa_         203 DLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC  281 (313)
T ss_dssp             ECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEE
T ss_pred             cccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCccc
Confidence            77766555 355666677788888888877666554 4677778888888888877788888888888888888888887


Q ss_pred             -ccchHhhccCCCcEEEecCCcC
Q 047461          261 -RIPESIIQLFVSGYLLLSYGIV  282 (312)
Q Consensus       261 -~~~~~l~~~~~L~~L~l~~n~~  282 (312)
                       .+|+ ++++++|+.+++++|+.
T Consensus       282 g~iP~-~~~L~~L~~l~l~~N~~  303 (313)
T d1ogqa_         282 GEIPQ-GGNLQRFDVSAYANNKC  303 (313)
T ss_dssp             EECCC-STTGGGSCGGGTCSSSE
T ss_pred             ccCCC-cccCCCCCHHHhCCCcc
Confidence             6664 46777888888888864



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure