Citrus Sinensis ID: 047511

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-
MIGETNLSVSIEMLVNKLASEAILLFSLQEQIQSDLKKWKKILVFIATADQPVNGTDELGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDPLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPLPNSFGDLKHLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVDASEEIPKGMGKLACLLTLCSFVVGKDIGSALQELKLLHLHGALEISKLENVRDVSEAREAQLNGKKNLKTLLLQWTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGGTKCRI
cccHHHHHHHHHHcccccccccEEEEEEEEccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHccccccEEEEEHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccHHHHHHccccccccHHHHHccccccccccEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEcHHHHHHHHHHcccccEEcccccccccccEEEccccccccccccccEEEccccccccccccccccccccEEEccccccHHHcHHHccccccccEEEEccccccccccccccccccccccccEEcccccccccccccccccccEEEEccccccccHHHHHHHHcccccccccEEEEEcccccccccccHHHHHHcccccccccccEEEEEEccccccc
cccHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHEEEEccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHcccHHHccHHHHHHHHHcccHcccHHHHHcccEEEEEEccccccccccccccccHcccEEEccccHHHHHccHHHHccccccEEEEcccccHHcccccccccccccEccEEEEcccccccHHHHHccccccEEEEccccccccHHHHHHHcHcccccccEEEEEEcccccccccHHHHHHHHHHccccccccEEEEEccccccccc
MIGETNLSVSIEMLVNKLASEAILLFSLQEQIQSDLKKWKKILVFIAtadqpvngtdELGLLQEKLKNQMSRKKFLLVLDDVwnenysdwdslslpfeagapgcqiiltkddCLQVFTQHClgmrdfsmqqslkDISEKIVIRcnglplpaktlvgllrgendplvscdiipalrlsyhylspnlkrCFAYCslfpknyefhEEEVTLLWMaegfpyhidtKEQIQDLGHKFLHElysrssfqqsssdpcRFLMHDLINDLAQWagdldgikmfepffefenlqtflplpnsfgdlkhlrhldlsetdiqiLPESVNTLYNLRTLMLQKCNQLAKMCSDMgnllklhhldnsdvdaseeipkGMGKLACLLTLCSFVVGKDIGSALQELKLLHLHGaleisklenvrDVSEAREAQLNGKKNLKTLLLQWTsnngdsrepeiETHVLDMLKPHQNLERfcisgyggtkcri
MIGETNLSVSIEMLVNKLASEAILLFSLQEQIQSDLKKWKKILVFIAtadqpvngtDELGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDPLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPLPNSFGDLKHLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVDASEEIPKGMGKLACLLTLCSFVVGKDIGSALQELKLLHLHGALEISKLENVRDVSEAREAqlngkknlktlLLQWTSNNGDSREPEIETHVLDmlkphqnlerfcisgyggtkcri
MIGETNLSVSIEMLVNKLASEAILLFSLQEQIQSDLKKWKKILVFIATADQPVNGTDELGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDPLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYsrssfqqsssDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPLPNSFGDLKHLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVDASEEIPKGMGKLACLLTLCSFVVGKDIGSALQELKLLHLHGALEISKLENVRDVSEAREAQlngkknlktlllQWTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGGTKCRI
*******SVSIEMLVNKLASEAILLFSLQEQIQSDLKKWKKILVFIATADQPVNGTDELGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDPLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYSR*********PCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPLPNSFGDLKHLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVD***EIPKGMGKLACLLTLCSFVVGKDIGSALQELKLLHLHGALEISKLENVR**************NLKTLLLQWT*************HVLDMLKPHQNLERFCISGYGG*****
MIGETNLSVSIEMLVNKLASEAILLFSLQEQIQSDLKKWKKILVF*************LGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDPLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDT**QIQDLGHKFLHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPLPNSFGDLKHLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVDASEEIPKGMGKLACLLTLCSFVVGKDI******LKLLHLHGALEISKLENVRDVSEAREAQLNGKKNLKTLLLQWTSNNG*****EIETHVLDMLKPHQNLERFCISGYGGTKC**
MIGETNLSVSIEMLVNKLASEAILLFSLQEQIQSDLKKWKKILVFIATADQPVNGTDELGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDPLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYSR********DPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPLPNSFGDLKHLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVDASEEIPKGMGKLACLLTLCSFVVGKDIGSALQELKLLHLHGALEISKLENVRDVSEAREAQLNGKKNLKTLLLQWTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGGTKCRI
*IGETNLSVSIEMLVNKLASEAILLFSLQEQIQSDLKKWKKILVFIATADQPVNGTDELGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDPLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPLPNSFGDLKHLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVDASEEIPKGMGKLACLLTLCSFVVGKDIGSALQELKLLHLHGALEISKLENVRDVSEAREAQLNGKKNLKTLLLQWTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGGTKC**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGETNLSVSIEMLVNKLASEAILLFSLQEQIQSDLKKWKKILVFIATADQPVNGTDELGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDPLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYSRSSFQQSSSDPCRFLMHDLINDLAQWAGDLDGIKMFEPFFEFENLQTFLPLPNSFGDLKHLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVDASEEIPKGMGKLACLLTLCSFVVGKDIGSALQELKLLHLHGALEISKLENVRDVSEAREAQLNGKKNLKTLLLQWTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGGTKCRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query471 2.2.26 [Sep-21-2011]
Q9LRR4 1054 Putative disease resistan yes no 0.891 0.398 0.338 2e-76
Q9LRR5 1424 Putative disease resistan no no 0.868 0.287 0.335 9e-63
Q7XA42 979 Putative disease resistan N/A no 0.851 0.409 0.353 4e-62
Q7XBQ9 970 Disease resistance protei N/A no 0.870 0.422 0.352 8e-62
Q7XA39 988 Putative disease resistan N/A no 0.917 0.437 0.332 3e-59
Q7XA40 992 Putative disease resistan N/A no 0.898 0.426 0.334 1e-58
O81825 919 Probable disease resistan no no 0.628 0.322 0.268 1e-22
Q39214 926 Disease resistance protei no no 0.653 0.332 0.263 2e-20
P60838 894 Probable disease resistan no no 0.673 0.354 0.264 6e-19
Q9SX38 857 Putative disease resistan no no 0.596 0.327 0.257 2e-17
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  286 bits (732), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 182/538 (33%), Positives = 278/538 (51%), Gaps = 118/538 (21%)

Query: 44  VFIATADQPVNGTDELGLLQEKLKNQMSRK--KFLLVLDDVWNENYSDWDSLSLPFEAGA 101
           V+ +   +P   TD L +LQ KLK +++     FLLVLDD+WNEN++DWD L  PF   A
Sbjct: 247 VYESVTSRPCEFTD-LDVLQVKLKERLTGTGLPFLLVLDDLWNENFADWDLLRQPFIHAA 305

Query: 102 PGCQIILTK----------------------DDCLQVFTQHCLGMRDFSMQQSLKDISEK 139
            G QI++T                        DC  +F +   G ++  + + + D++E+
Sbjct: 306 QGSQILVTTRSQRVASIMCAVHVHNLQPLSDGDCWSLFMKTVFGNQEPCLNREIGDLAER 365

Query: 140 IVIRCNGLPLPAKTLVGLLRGEND---------------PLVSCDIIPALRLSYHYLSPN 184
           IV +C GLPL  KTL G+LR E                 P    +++P LR+SY+YL  +
Sbjct: 366 IVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAH 425

Query: 185 LKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYSRSSFQQ 244
           LKRCFAYCS+FPK + F +++V LLWMAEGF     + + +++LG+++  EL SRS  Q+
Sbjct: 426 LKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQK 485

Query: 245 SSSDPCRFLMHDLINDLAQWA-GDL-----DGIKM---------------------FEPF 277
           + +   R++MHD IN+LAQ+A G+      DG K+                     FE  
Sbjct: 486 TKT---RYIMHDFINELAQFASGEFSSKFEDGCKLQVSERTRYLSYLRDNYAEPMEFEAL 542

Query: 278 FEFENLQTFLPL----------------------------------------PNSFGDLK 297
            E + L+TFLPL                                        P+ F ++ 
Sbjct: 543 REVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNIS 602

Query: 298 HLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVDAS 357
           H R LDLS T+++ LP+S+  +YNL+TL+L  C+ L ++ +D+ NL+ L +LD       
Sbjct: 603 HARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTKL- 661

Query: 358 EEIPKGMGKLACLLTLCSFVVGKDIGSALQELKLLH-LHGALEISKLENVRDVSEAREAQ 416
            ++P+  G+L  L TL +F V    GS + EL  LH LHG L+I +L+ V DV++A EA 
Sbjct: 662 RQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEAN 721

Query: 417 LNGKKNLKTLLLQW------TSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGGTK 468
           LN KK+L+ +   W      + NN +    + E  V + L+PH+++E+  I  Y G +
Sbjct: 722 LNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRR 779
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9SX38|DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana GN=At1g50180 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query471
147862409 1466 hypothetical protein VITISV_042289 [Viti 0.904 0.290 0.391 2e-93
359497792 843 PREDICTED: putative disease resistance R 0.872 0.487 0.4 5e-92
359495024 1390 PREDICTED: putative disease resistance p 0.912 0.309 0.395 1e-90
147860511 1406 hypothetical protein VITISV_014536 [Viti 0.912 0.305 0.395 4e-90
147775060 1330 hypothetical protein VITISV_014782 [Viti 0.904 0.320 0.387 1e-89
225449649 1418 PREDICTED: putative disease resistance p 0.878 0.291 0.404 2e-89
224059590 1381 cc-nbs-lrr resistance protein [Populus t 0.923 0.314 0.381 3e-89
224132258 880 cc-nbs-lrr resistance protein [Populus t 0.866 0.463 0.396 7e-89
359495026 2204 PREDICTED: uncharacterized protein LOC10 0.910 0.194 0.393 4e-88
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.893 0.295 0.400 5e-88
>gi|147862409|emb|CAN81911.1| hypothetical protein VITISV_042289 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  349 bits (896), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 210/537 (39%), Positives = 295/537 (54%), Gaps = 111/537 (20%)

Query: 40  KKILVFIATADQPVNGTDELGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFEA 99
           K IL  ++     VN   +L LLQ  LK ++S  KFLLVLDDVWNEN  +WD L  P  A
Sbjct: 250 KTILQSVSLDTHDVN---DLNLLQVMLKEKLSGNKFLLVLDDVWNENCEEWDILCSPMRA 306

Query: 100 GAPGCQIILTK----------------------DDCLQVFTQHCLGMRDFSMQQSLKDIS 137
           GAPG ++I+T                        DCL +FTQ  LG R F     LK++ 
Sbjct: 307 GAPGSKVIITTRNKGVASVAGTGSAYPLQELSHGDCLSLFTQQALGTRSFEAHPHLKELG 366

Query: 138 EKIVIRCNGLPLPAKTLVGLLRGEND---------------PLVSCDIIPALRLSYHYLS 182
           E+IV RC GLPL AK L G+LR E +               P     ++PAL+LSYH+L 
Sbjct: 367 EEIVRRCKGLPLAAKALGGMLRNEVNYDAWVNILKSKIWDLPQEKSSVLPALKLSYHHLP 426

Query: 183 PNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYSRSSF 242
            NLKRCFAYCS+FPK+YEF ++E+ LLWMAEGF      ++Q +DLG K+  +L SRS F
Sbjct: 427 SNLKRCFAYCSIFPKDYEFDKDELILLWMAEGFLQQTKGEDQPEDLGAKYFCDLLSRSFF 486

Query: 243 QQSSSDPCRFLMHDLINDLAQW-AGDL------------------------------DGI 271
           QQSS +  +F+MHDLINDLA + AG+L                              + +
Sbjct: 487 QQSSYNSSKFVMHDLINDLAHFVAGELCFNLDDKLENNEXFTSFEKARHSSFNRQSHEVL 546

Query: 272 KMFEPFFEFENLQTFLP---------------------------------------LPNS 292
           K FE F+  + L+T +                                        LPNS
Sbjct: 547 KKFETFYRVKFLRTLIALPINALSPSNFISPKVIHDLLIQKSCLRVLSLSGYRISELPNS 606

Query: 293 FGDLKHLRHLDLSETDIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNS 352
            GDL+HLR+L+LS + I+ LP+S+  LYNL+TL+L+ C +L ++  ++GNLL L HLD +
Sbjct: 607 IGDLRHLRYLNLSYSSIKRLPDSIVHLYNLQTLILRDCYRLTELPIEIGNLLNLRHLDIT 666

Query: 353 DVDASEEIPKGMGKLACLLTLCSFVVGKDIGSALQELK-LLHLHGALEISKLENVRDVSE 411
           D     E+P  +G L  L TL  F+VG      ++EL+ LL+L G L IS L NV +V +
Sbjct: 667 DTSQLLEMPSQIGSLTNLQTLSKFIVGSGSSLGIRELRNLLYLQGKLSISGLHNVVNVQD 726

Query: 412 AREAQLNGKKNLKTLLLQWTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYGGTK 468
           A++A L  K+N+K L ++W+++  ++R    E HVL+ L+PH+NL++  ++ YGG++
Sbjct: 727 AKDANLADKQNIKELTMEWSNDFRNARNETEEMHVLESLQPHRNLKKLMVAFYGGSQ 783

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359497792|ref|XP_003635643.1| PREDICTED: putative disease resistance RPP13-like protein 1-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495024|ref|XP_002267933.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860511|emb|CAN79726.1| hypothetical protein VITISV_014536 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147775060|emb|CAN77204.1| hypothetical protein VITISV_014782 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224059590|ref|XP_002299922.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222847180|gb|EEE84727.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132258|ref|XP_002328224.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222837739|gb|EEE76104.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495026|ref|XP_003634900.1| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera] Back     alignment and taxonomy information
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query471
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.329 0.147 0.375 5e-62
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.373 0.123 0.403 8.7e-54
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.498 0.130 0.283 2.3e-22
TAIR|locus:2034770 894 SUMM2 "AT1G12280" [Arabidopsis 0.513 0.270 0.279 4.8e-17
TAIR|locus:2036214 851 AT1G15890 [Arabidopsis thalian 0.498 0.276 0.298 2e-16
TAIR|locus:2078012 852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.118 0.065 0.339 3.3e-16
TAIR|locus:2011982 857 AT1G50180 [Arabidopsis thalian 0.460 0.253 0.276 1.1e-15
TAIR|locus:2171579 843 AT5G47250 [Arabidopsis thalian 0.503 0.281 0.296 1.2e-14
TAIR|locus:2201986 885 RFL1 "AT1G12210" [Arabidopsis 0.496 0.264 0.277 7.4e-14
TAIR|locus:2201996 889 RPS5 "AT1G12220" [Arabidopsis 0.496 0.263 0.274 8.9e-14
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 310 (114.2 bits), Expect = 5.0e-62, Sum P(3) = 5.0e-62
 Identities = 65/173 (37%), Positives = 101/173 (58%)

Query:   108 LTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGEND---- 163
             L+  DC  +F +   G ++  + + + D++E+IV +C GLPL  KTL G+LR E      
Sbjct:   334 LSDGDCWSLFMKTVFGNQEPCLNREIGDLAERIVHKCRGLPLAVKTLGGVLRFEGKVIEW 393

Query:   164 -----------PLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMA 212
                        P    +++P LR+SY+YL  +LKRCFAYCS+FPK + F +++V LLWMA
Sbjct:   394 ERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMA 453

Query:   213 EGFPYHIDTKEQIQDLGHKFLHELYXXXXXXXXXXDPCRFLMHDLINDLAQWA 265
             EGF     + + +++LG+++  EL              R++MHD IN+LAQ+A
Sbjct:   454 EGFLQQTRSSKNLEELGNEYFSELESRSLLQKTKT---RYIMHDFINELAQFA 503
GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00031014001
SubName- Full=Chromosome undetermined scaffold_53, whole genome shotgun sequence; (1121 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-35
PLN03210 1153 PLN03210, PLN03210, Resistant to P 7e-04
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  132 bits (334), Expect = 2e-35
 Identities = 67/217 (30%), Positives = 103/217 (47%), Gaps = 44/217 (20%)

Query: 39  WKKILVFIATADQPVNGTDELGLLQEKLKNQMSRKKFLLVLDDVWNENYSDWDSLSLPFE 98
            K IL  +   D           L  K+K  + RK+FLLVLDDVW +N  DWD + +PF 
Sbjct: 67  QKDILQELGLDDSDWVE-KNESELAVKIKEALLRKRFLLVLDDVWEKN--DWDKIGVPFP 123

Query: 99  AGAPGCQIILT-----------------------KDDCLQVFTQHCLGMRDFSMQQSLKD 135
            G  G ++I+T                        ++  ++F+   +  ++      L++
Sbjct: 124 DGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNK-VFEKELPPCPELEE 182

Query: 136 ISEKIVIRCNGLPLPAKTLVGLLRG-------------ENDPLVSCD----IIPALRLSY 178
           ++++IV +C GLPL  K L GLL                N+ L   D    ++  L LSY
Sbjct: 183 VAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSY 242

Query: 179 HYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGF 215
             L  +LKRCF Y +LFP++Y   +E++  LW+AEGF
Sbjct: 243 DNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGF 279

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 471
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.97
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.51
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.51
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.5
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.39
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.33
KOG0617264 consensus Ras suppressor protein (contains leucine 99.22
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.16
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.04
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.88
PRK04841 903 transcriptional regulator MalT; Provisional 98.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.81
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.72
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.62
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.6
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.55
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.53
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.43
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.41
PLN03150623 hypothetical protein; Provisional 98.39
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.38
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.35
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.35
PLN03150623 hypothetical protein; Provisional 98.32
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.29
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.23
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
PRK15386 426 type III secretion protein GogB; Provisional 97.91
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.75
COG3903414 Predicted ATPase [General function prediction only 97.73
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.7
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.57
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.55
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.53
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.53
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.52
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.51
PF13173128 AAA_14: AAA domain 97.51
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.44
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.23
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.2
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.16
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.12
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.03
PRK06893229 DNA replication initiation factor; Validated 96.96
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.94
PRK13342413 recombination factor protein RarA; Reviewed 96.93
PF05729166 NACHT: NACHT domain 96.92
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.9
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.77
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.69
COG2256436 MGS1 ATPase related to the helicase subunit of the 96.64
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.44
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.39
PRK15386 426 type III secretion protein GogB; Provisional 96.37
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.35
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.05
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.05
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 95.98
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.91
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 95.87
PRK09376416 rho transcription termination factor Rho; Provisio 95.85
PRK04195482 replication factor C large subunit; Provisional 95.66
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.52
PRK13341 725 recombination factor protein RarA/unknown domain f 95.46
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.39
PRK08116268 hypothetical protein; Validated 95.3
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.17
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.11
PLN03025319 replication factor C subunit; Provisional 95.05
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.02
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.96
cd01128249 rho_factor Transcription termination factor rho is 94.95
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 94.92
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 94.9
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.89
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.72
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.62
PRK05642234 DNA replication initiation factor; Validated 94.6
COG3899 849 Predicted ATPase [General function prediction only 94.59
PRK14087450 dnaA chromosomal replication initiation protein; P 94.59
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 94.51
PRK12402337 replication factor C small subunit 2; Reviewed 94.45
PRK09112351 DNA polymerase III subunit delta'; Validated 94.43
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 94.4
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.21
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 94.19
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.16
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 94.07
PTZ001121164 origin recognition complex 1 protein; Provisional 94.03
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 93.96
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 93.92
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 93.91
TIGR00767415 rho transcription termination factor Rho. Members 93.63
PRK07471365 DNA polymerase III subunit delta'; Validated 93.62
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.6
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.53
PRK06921266 hypothetical protein; Provisional 93.45
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 93.37
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 93.37
PF00004132 AAA: ATPase family associated with various cellula 93.36
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 93.35
PRK09087226 hypothetical protein; Validated 93.32
PRK05564313 DNA polymerase III subunit delta'; Validated 93.24
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.22
CHL00181287 cbbX CbbX; Provisional 93.15
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 93.15
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.11
KOG2123 388 consensus Uncharacterized conserved protein [Funct 93.04
PRK00149450 dnaA chromosomal replication initiation protein; R 93.04
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 92.97
PRK10536262 hypothetical protein; Provisional 92.63
PRK14086617 dnaA chromosomal replication initiation protein; P 92.61
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 92.58
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 92.45
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.41
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 92.38
COG0593408 DnaA ATPase involved in DNA replication initiation 92.37
PRK04132846 replication factor C small subunit; Provisional 92.22
PRK07940394 DNA polymerase III subunit delta'; Validated 92.09
smart00382148 AAA ATPases associated with a variety of cellular 92.02
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 91.96
PRK14088440 dnaA chromosomal replication initiation protein; P 91.85
PHA02544316 44 clamp loader, small subunit; Provisional 91.85
PRK12608380 transcription termination factor Rho; Provisional 91.84
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 91.56
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 91.53
PRK08939306 primosomal protein DnaI; Reviewed 91.35
PRK09183259 transposase/IS protein; Provisional 91.13
PRK12377248 putative replication protein; Provisional 91.04
PRK08181269 transposase; Validated 90.96
smart0037026 LRR Leucine-rich repeats, outliers. 90.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.91
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 90.85
PRK00440319 rfc replication factor C small subunit; Reviewed 90.73
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 90.54
PRK08903227 DnaA regulatory inactivator Hda; Validated 90.5
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 90.48
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 90.16
PRK05707328 DNA polymerase III subunit delta'; Validated 90.12
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 90.03
KOG4341483 consensus F-box protein containing LRR [General fu 89.93
PRK06526254 transposase; Provisional 89.78
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 89.68
PRK07952244 DNA replication protein DnaC; Validated 89.56
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 89.4
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 89.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.01
smart0037026 LRR Leucine-rich repeats, outliers. 89.01
PRK12422445 chromosomal replication initiation protein; Provis 88.93
PRK06620214 hypothetical protein; Validated 88.67
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 88.54
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 88.33
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 88.21
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 88.04
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 87.31
COG4088261 Predicted nucleotide kinase [Nucleotide transport 87.23
PF07726131 AAA_3: ATPase family associated with various cellu 86.8
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 86.76
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 86.49
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 86.41
KOG2982 418 consensus Uncharacterized conserved protein [Funct 86.35
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 86.34
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 86.24
PRK06835329 DNA replication protein DnaC; Validated 86.14
KOG1947 482 consensus Leucine rich repeat proteins, some prote 86.1
PRK08118167 topology modulation protein; Reviewed 86.09
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 86.04
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 85.95
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 85.73
PRK03992389 proteasome-activating nucleotidase; Provisional 85.72
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 85.71
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 85.67
COG2255332 RuvB Holliday junction resolvasome, helicase subun 85.59
CHL00176638 ftsH cell division protein; Validated 85.56
PRK08727233 hypothetical protein; Validated 85.53
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 85.5
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 85.45
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 85.42
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 85.33
PRK06871325 DNA polymerase III subunit delta'; Validated 85.16
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 85.08
PRK10867433 signal recognition particle protein; Provisional 84.98
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 84.85
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 84.78
PF14516331 AAA_35: AAA-like domain 84.74
COG0703172 AroK Shikimate kinase [Amino acid transport and me 84.66
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 84.65
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 83.96
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 83.95
TIGR00959428 ffh signal recognition particle protein. This mode 83.91
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 83.91
PRK12678672 transcription termination factor Rho; Provisional 83.9
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 83.36
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 82.99
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 82.67
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 82.5
PRK05541176 adenylylsulfate kinase; Provisional 82.24
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 82.12
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 82.01
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 81.72
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 81.68
PRK08769319 DNA polymerase III subunit delta'; Validated 81.36
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 81.31
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 80.9
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 80.64
KOG1969877 consensus DNA replication checkpoint protein CHL12 80.61
PRK08084235 DNA replication initiation factor; Provisional 80.44
PHA00729226 NTP-binding motif containing protein 80.21
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 80.03
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=4.9e-60  Score=502.53  Aligned_cols=448  Identities=30%  Similarity=0.459  Sum_probs=328.4

Q ss_pred             CCccchHHHHHHHHH---HHhhhhHHHHHHHHHHHhhhHHHHHHHHHHHhhccCCCCCCCcHHHHHHHHHHHcCCCcEEE
Q 047511            1 MIGETNLSVSIEMLV---NKLASEAILLFSLQEQIQSDLKKWKKILVFIATADQPVNGTDELGLLQEKLKNQMSRKKFLL   77 (471)
Q Consensus         1 ~iGKTtLA~~v~~~~---~~~~~~~~~~~~lq~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~L~~kr~Li   77 (471)
                      |+||||||+.++|+.   .++|+.-.|+...|.--..++.  +.|...+...+.. ....+.++.+..|.+.|++|||+|
T Consensus       189 GvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq--~~Il~~l~~~~~~-~~~~~~~~~~~~i~~~L~~krfll  265 (889)
T KOG4658|consen  189 GVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQ--QTILERLGLLDEE-WEDKEEDELASKLLNLLEGKRFLL  265 (889)
T ss_pred             cccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHH--HHHHHHhccCCcc-cchhhHHHHHHHHHHHhccCceEE
Confidence            799999999999984   4567665555555532222222  2332222222222 222334789999999999999999


Q ss_pred             EEecCCCCCcchhhhccccccCCCCCcEEEee-----------------------CchhHHHHHhhhcCCCCCCCCchHH
Q 047511           78 VLDDVWNENYSDWDSLSLPFEAGAPGCQIILT-----------------------KDDCLQVFTQHCLGMRDFSMQQSLK  134 (471)
Q Consensus        78 VLDDVw~~~~~~~~~l~~~~~~~~~gsriiiT-----------------------~~ea~~Lf~~~af~~~~~~~~~~~~  134 (471)
                      ||||||+.  .+|+.++.++|....||+|++|                       .+|||+||++.||.... ...+.++
T Consensus       266 vLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~-~~~~~i~  342 (889)
T KOG4658|consen  266 VLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTL-GSHPDIE  342 (889)
T ss_pred             EEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccc-cccccHH
Confidence            99999998  8899999999999899999999                       89999999999987643 2345599


Q ss_pred             HHHHHHHHHcCCCchHHHHHHHHHcCCCCC-------------------CCcCCchhHHhhhccCCChhhHHHHhHhccC
Q 047511          135 DISEKIVIRCNGLPLPAKTLVGLLRGENDP-------------------LVSCDIIPALRLSYHYLSPNLKRCFAYCSLF  195 (471)
Q Consensus       135 ~~~~~iv~~c~GlPLal~~~g~~L~~~~~~-------------------~~~~~i~~~l~~sy~~L~~~~k~~fl~~~~f  195 (471)
                      ++|++|+++|+|+|||++++|+.|+.+...                   .....+..+|++||+.||++.|.||+|||.|
T Consensus       343 ~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalF  422 (889)
T KOG4658|consen  343 ELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALF  422 (889)
T ss_pred             HHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccC
Confidence            999999999999999999999999999875                   1135778999999999999999999999999


Q ss_pred             CCCccccHHHHHHHHHHCCCCCCCCchhHHHHHHHHHHHHHHhcCcccccC--CCCCccchhhhHHHHHHHhcc-----c
Q 047511          196 PKNYEFHEEEVTLLWMAEGFPYHIDTKEQIQDLGHKFLHELYSRSSFQQSS--SDPCRFLMHDLINDLAQWAGD-----L  268 (471)
Q Consensus       196 ~~~~~i~~~~l~~~w~~~g~~~~~~~~~~~~~~~~~~l~~L~~~~ll~~~~--~~~~~~~mhdlv~~~a~~~~~-----~  268 (471)
                      |+|+.|+++.++.+|+||||+.+......+++.|..++.+|++++|+....  ++...|+|||+||++|.|++.     .
T Consensus       423 PED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~  502 (889)
T KOG4658|consen  423 PEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQE  502 (889)
T ss_pred             CcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccc
Confidence            999999999999999999999997778899999999999999999999865  456789999999999999965     1


Q ss_pred             cc-c-c------cccc----------------------cccCCCcceeeeCCCC----------cCCCCcceEEEecCC-
Q 047511          269 DG-I-K------MFEP----------------------FFEFENLQTFLPLPNS----------FGDLKHLRHLDLSET-  307 (471)
Q Consensus       269 ~~-~-~------~~~~----------------------~~~~~~l~~l~~~p~~----------~~~l~~L~~L~l~~~-  307 (471)
                      +. + .      ..+.                      -.+.++|++|......          |..|+.|++|||++| 
T Consensus       503 e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~  582 (889)
T KOG4658|consen  503 ENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNS  582 (889)
T ss_pred             cceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCC
Confidence            11 0 0      0111                      1234456666544332          677888888888876 


Q ss_pred             CCCcCCccccCCCCCcEEEccCCCcccccchhhhccccCCeeecCCCCCCccCcccccCCCCCcccCCeeec-Ccccccc
Q 047511          308 DIQILPESVNTLYNLRTLMLQKCNQLAKMCSDMGNLLKLHHLDNSDVDASEEIPKGMGKLACLLTLCSFVVG-KDIGSAL  386 (471)
Q Consensus       308 ~l~~lp~~i~~l~~L~~L~l~~~~~~~~lP~~~~~l~~L~~L~l~~~~~~~~lP~~~~~l~~L~~L~~~~~~-~~~~~~~  386 (471)
                      .+.++|.+|++|.+|++|++++ +.+..+|.++++|++|.+|++..+..+..+|..+..|++|++|.++... ......+
T Consensus       583 ~l~~LP~~I~~Li~LryL~L~~-t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l  661 (889)
T KOG4658|consen  583 SLSKLPSSIGELVHLRYLDLSD-TGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSALSNDKLLL  661 (889)
T ss_pred             ccCcCChHHhhhhhhhcccccC-CCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccccccchhhH
Confidence            5678888888888888888888 6788888888888888888888886666665555568888888766543 2223445


Q ss_pred             cccc-cccccCceEEcccCCCCChhhhHHhhcCCcccccceEEEecCCCCCCCCcchHHHhhccCCCCCCcceEEEEeec
Q 047511          387 QELK-LLHLHGALEISKLENVRDVSEAREAQLNGKKNLKTLLLQWTSNNGDSREPEIETHVLDMLKPHQNLERFCISGYG  465 (471)
Q Consensus       387 ~~l~-l~~L~~~L~~~~l~~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~L~~~~  465 (471)
                      .++. +.+|+ .+.+....    .  .....+..+..|.++...-..      ........+..+..+.+|++|.+.++.
T Consensus       662 ~el~~Le~L~-~ls~~~~s----~--~~~e~l~~~~~L~~~~~~l~~------~~~~~~~~~~~~~~l~~L~~L~i~~~~  728 (889)
T KOG4658|consen  662 KELENLEHLE-NLSITISS----V--LLLEDLLGMTRLRSLLQSLSI------EGCSKRTLISSLGSLGNLEELSILDCG  728 (889)
T ss_pred             Hhhhcccchh-hheeecch----h--HhHhhhhhhHHHHHHhHhhhh------cccccceeecccccccCcceEEEEcCC
Confidence            5555 66665 55553211    1  111223333444332221110      001223345566667888888888887


Q ss_pred             CCC
Q 047511          466 GTK  468 (471)
Q Consensus       466 ~~~  468 (471)
                      +..
T Consensus       729 ~~e  731 (889)
T KOG4658|consen  729 ISE  731 (889)
T ss_pred             Cch
Confidence            764

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 4e-53
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-46
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-30
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  187 bits (476), Expect = 4e-53
 Identities = 47/284 (16%), Positives = 92/284 (32%), Gaps = 75/284 (26%)

Query: 29  QEQIQSDLKKWKKILVFIATADQPVNGTDE-LGLLQEKLKNQMSRK--KFLLVLDDVWNE 85
           ++     L K + +   +   +         +   +++L+  M RK  + LL+LDDVW+ 
Sbjct: 189 KQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDS 248

Query: 86  NYSDWDSLSLPFEAGAPGCQIILT------------------------KDDCLQVFTQHC 121
                       +A    CQI+LT                        K+  L++ +   
Sbjct: 249 WV---------LKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFV 299

Query: 122 LGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLR---------------------G 160
                   +  L + +  I+  C G PL    +  LLR                      
Sbjct: 300 -----NMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIR 354

Query: 161 ENDPLVSCDIIPALRLSYHYLSPNLKRCFAYCSLFPKNYEFHEEEVTLLWMAEGFPYHID 220
           ++       +  A+ +S   L  ++K  +   S+  K+ +   + + +LW  E       
Sbjct: 355 KSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMET------ 408

Query: 221 TKEQIQDLGHKFLHELYSRSSFQQSSSDP-CRFLMHDLINDLAQ 263
                 +     L E  ++S      +    R+ +HDL  D   
Sbjct: 409 ------EEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLT 446
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query471
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.96
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.96
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.73
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.64
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.6
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.6
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.59
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.58
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.57
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.57
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.56
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.56
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.54
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.53
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.52
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.52
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.52
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.52
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.51
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.51
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.51
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.51
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.5
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.49
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.49
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.49
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.49
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.48
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.48
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.48
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.47
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.47
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.47
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.47
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.46
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.46
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.45
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.44
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.44
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.44
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.44
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.44
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.43
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.43
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.42
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.42
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.41
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.41
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.4
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.4
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.4
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.4
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.4
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.38
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.38
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.38
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.38
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.37
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.35
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.35
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.35
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.34
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.33
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.33
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.33
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.32
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.32
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.32
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.31
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.31
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.31
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.3
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.3
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.3
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.29
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.29
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.28
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.28
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.28
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.25
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.24
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.24
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.23
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.23
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.22
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.19
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.19
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.19
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.02
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.01
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.0
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.0
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.98
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.97
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.95
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.93
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.93
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.88
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.85
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.83
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.82
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.8
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.75
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.69
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.66
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.65
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.65
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.64
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.61
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.44
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.41
2fna_A357 Conserved hypothetical protein; structural genomic 98.38
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.31
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.22
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.06
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.04
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.01
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 97.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.83
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.82
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.81
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.8
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 97.68
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.62
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.48
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.42
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.03
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.99
2chq_A319 Replication factor C small subunit; DNA-binding pr 96.07
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.87
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 95.73
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.38
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.22
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.16
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.14
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.13
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.12
3bos_A242 Putative DNA replication factor; P-loop containing 94.03
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.91
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.77
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 93.65
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.37
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.15
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.14
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.65
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.62
3pvs_A447 Replication-associated recombination protein A; ma 92.44
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 92.0
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 91.79
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 91.64
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.55
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 91.11
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 91.07
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 90.88
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 90.76
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 90.68
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 90.31
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 89.6
4gt6_A394 Cell surface protein; leucine rich repeats, putati 89.56
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 89.09
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 88.54
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 88.17
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 88.15
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 88.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 87.35
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 85.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 85.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 84.15
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 81.12
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 80.11
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=6.7e-37  Score=317.96  Aligned_cols=250  Identities=16%  Similarity=0.214  Sum_probs=184.8

Q ss_pred             CCccchHHHHHHH----HHHHhhhhHHHHHHHHHH---HhhhHHHHHHHHHHHhhcc----CCCCCCCcHHHHHHHHHHH
Q 047511            1 MIGETNLSVSIEM----LVNKLASEAILLFSLQEQ---IQSDLKKWKKILVFIATAD----QPVNGTDELGLLQEKLKNQ   69 (471)
Q Consensus         1 ~iGKTtLA~~v~~----~~~~~~~~~~~~~~lq~~---~l~~l~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~l~~~   69 (471)
                      ||||||||++||+    +++..|+... |+.+...   -..+++  ..+...+....    ....+..+.+++...+++.
T Consensus       162 GvGKTtLA~~v~~~~~~~~~~~F~~~~-wv~vs~~~~~~~~~~~--~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~  238 (549)
T 2a5y_B          162 GSGKSVIASQALSKSDQLIGINYDSIV-WLKDSGTAPKSTFDLF--TDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNA  238 (549)
T ss_dssp             TSSHHHHHHHHHHHCSSTBTTTBSEEE-EEECCCCSTTHHHHHH--HHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHhhhHHHhccCCcEE-EEEECCCCCCCHHHHH--HHHHHHHhcCcccccccccccccHHHHHHHHHHH
Confidence            8999999999997    5777785533 3344321   112222  23322332221    1111234567788999999


Q ss_pred             cCCC-cEEEEEecCCCCCcchhhhccccccCCCCCcEEEee-----------------------CchhHHHHHhhhcCCC
Q 047511           70 MSRK-KFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILT-----------------------KDDCLQVFTQHCLGMR  125 (471)
Q Consensus        70 L~~k-r~LiVLDDVw~~~~~~~~~l~~~~~~~~~gsriiiT-----------------------~~ea~~Lf~~~af~~~  125 (471)
                      |++| |+||||||||+.+...|..        .+||+||||                       ++|||+||+++||+..
T Consensus       239 L~~~kr~LlVLDdv~~~~~~~~~~--------~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~  310 (549)
T 2a5y_B          239 LIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP  310 (549)
T ss_dssp             HTTSTTEEEEEEEECCHHHHHHHH--------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC
T ss_pred             HcCCCcEEEEEECCCCchhhcccc--------cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCC
Confidence            9996 9999999999862222332        279999999                       6899999999998654


Q ss_pred             CCCCCchHHHHHHHHHHHcCCCchHHHHHHHHHcCCCCC-----------CCcCCchhHHhhhccCCChhhHHHHh----
Q 047511          126 DFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDP-----------LVSCDIIPALRLSYHYLSPNLKRCFA----  190 (471)
Q Consensus       126 ~~~~~~~~~~~~~~iv~~c~GlPLal~~~g~~L~~~~~~-----------~~~~~i~~~l~~sy~~L~~~~k~~fl----  190 (471)
                         ..+.+++++++|+++|+|+||||+++|+.|+.+...           ....++..++.+||+.||++.|.||+    
T Consensus       311 ---~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~w~~~~~l~~~l~~~~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~  387 (549)
T 2a5y_B          311 ---VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSD  387 (549)
T ss_dssp             -----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTSCH
T ss_pred             ---CchhHHHHHHHHHHHhCCChHHHHHHHHHhccchHHHHHHhHHHhhcccHHHHHHHHhcccccccHHHHHHHhccch
Confidence               247888999999999999999999999998776321           13456888999999999999999999    


Q ss_pred             -------HhccCCCCccccHHHHHHHHHHC--CCCCCCCchhHHHHHHHHHHHHHHhcCcccccCC-CCCccchhhhHHH
Q 047511          191 -------YCSLFPKNYEFHEEEVTLLWMAE--GFPYHIDTKEQIQDLGHKFLHELYSRSSFQQSSS-DPCRFLMHDLIND  260 (471)
Q Consensus       191 -------~~~~f~~~~~i~~~~l~~~w~~~--g~~~~~~~~~~~~~~~~~~l~~L~~~~ll~~~~~-~~~~~~mhdlv~~  260 (471)
                             |||+||+++.|+    ++.|+++  ||+.........++.++ ++++|+++||++.... ...+|+|||++|+
T Consensus       388 ~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~  462 (549)
T 2a5y_B          388 EDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHIIHM  462 (549)
T ss_dssp             HHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHHHH
T ss_pred             hhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHHHH
Confidence                   999999999998    8899999  99887543455677777 9999999999998653 4567999999999


Q ss_pred             HHHHhcccc
Q 047511          261 LAQWAGDLD  269 (471)
Q Consensus       261 ~a~~~~~~~  269 (471)
                      +|+++...+
T Consensus       463 ~a~~~~~~~  471 (549)
T 2a5y_B          463 FLKHVVDAQ  471 (549)
T ss_dssp             HHHTTSCTH
T ss_pred             HHHHHHHHH
Confidence            999886543
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 471
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-14
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 71.8 bits (175), Expect = 1e-14
 Identities = 26/157 (16%), Positives = 44/157 (28%), Gaps = 29/157 (18%)

Query: 61  LLQEKLKNQMSRKKFLLVLDDVWNENYSDWD-----------SLSLPFEAGAPGCQII-- 107
           L +      + R   L V DDV  E    W                   A +  C+ I  
Sbjct: 123 LKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEV 182

Query: 108 --LTKDDCLQVFTQHCLGMRDFSMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDPL 165
             L  D+C      + + M     ++   D+  K +   +G P            +    
Sbjct: 183 TSLEIDECYDFLEAYGMPMPVGEKEE---DVLNKTIELSSGNPATLMMFFKSCEPKTFEK 239

Query: 166 VS-----------CDIIPALRLSYHYLSPNLKRCFAY 191
           ++             +      SY  L+  L+RC   
Sbjct: 240 MAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEV 276
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query471
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.53
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.46
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.4
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.37
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.35
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.34
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.33
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.28
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.28
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.21
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.19
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.17
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.14
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.09
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.08
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.02
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.01
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.99
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.96
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.94
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.93
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.87
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.86
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.85
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.82
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.63
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.34
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.9
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.85
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.69
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.04
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.86
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.81
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.55
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.03
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.81
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.42
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.26
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.14
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.08
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.99
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.58
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 93.55
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.94
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.9
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.35
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 89.7
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.2
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 89.19
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 88.49
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 88.19
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 87.81
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 86.87
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 86.36
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 86.35
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.99
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 85.69
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 84.67
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 84.49
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 84.37
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 83.68
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 82.95
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 82.8
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 82.78
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 82.44
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 82.37
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 82.01
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 81.79
d1xpua3289 Transcription termination factor Rho, ATPase domai 81.7
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 81.53
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 81.04
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 80.98
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 80.5
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 80.07
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.94  E-value=1.4e-28  Score=230.41  Aligned_cols=179  Identities=16%  Similarity=0.166  Sum_probs=125.8

Q ss_pred             CCccchHHHHHHHHHH----HhhhhHHHHHHHHH-HHhhhHHHHHHH-HHHHhhccC----CCCCCCcHHHHHHHHHHHc
Q 047511            1 MIGETNLSVSIEMLVN----KLASEAILLFSLQE-QIQSDLKKWKKI-LVFIATADQ----PVNGTDELGLLQEKLKNQM   70 (471)
Q Consensus         1 ~iGKTtLA~~v~~~~~----~~~~~~~~~~~lq~-~~l~~l~~~~~~-~~~~~~~~~----~~~~~~~~~~~~~~l~~~L   70 (471)
                      ||||||||++||++.+    ..|+. ++|+.+.. ....++...... ...+.....    ......+.......+++.+
T Consensus        54 GiGKTtLA~~v~~~~~~~~~~~f~~-~~Wv~vs~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L  132 (277)
T d2a5yb3          54 GSGKSVIASQALSKSDQLIGINYDS-IVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALI  132 (277)
T ss_dssp             TSSHHHHHHHHHHHCSSTBTTTBSE-EEEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHhhhhhhhhcCce-EEEEEecCCCCHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHh
Confidence            8999999999999732    23333 33443321 111222211111 111111110    1112334455566788999


Q ss_pred             CCCcEEEEEecCCCCCcchhhhccccccCCCCCcEEEee-----------------------CchhHHHHHhhhcCCCCC
Q 047511           71 SRKKFLLVLDDVWNENYSDWDSLSLPFEAGAPGCQIILT-----------------------KDDCLQVFTQHCLGMRDF  127 (471)
Q Consensus        71 ~~kr~LiVLDDVw~~~~~~~~~l~~~~~~~~~gsriiiT-----------------------~~ea~~Lf~~~af~~~~~  127 (471)
                      .+||+|+||||||+.  .+|+.+.      ..|||||||                       .+|||+||+.++|...  
T Consensus       133 ~~kr~LlVLDDv~~~--~~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~--  202 (277)
T d2a5yb3         133 DRPNTLFVFDDVVQE--ETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP--  202 (277)
T ss_dssp             TSTTEEEEEEEECCH--HHHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--
T ss_pred             ccCCeeEecchhhHH--hhhhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCcc--
Confidence            999999999999987  6676432      358999999                       7899999999998664  


Q ss_pred             CCCchHHHHHHHHHHHcCCCchHHHHHHHHHcCCCCC-----------CCcCCchhHHhhhccCCChhhHHHHhH
Q 047511          128 SMQQSLKDISEKIVIRCNGLPLPAKTLVGLLRGENDP-----------LVSCDIIPALRLSYHYLSPNLKRCFAY  191 (471)
Q Consensus       128 ~~~~~~~~~~~~iv~~c~GlPLal~~~g~~L~~~~~~-----------~~~~~i~~~l~~sy~~L~~~~k~~fl~  191 (471)
                       ..+..++++++|+++|+|+||||+++|+.|+.++..           ....++..++.+||+.||+++|.||-+
T Consensus       203 -~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v~~il~~sY~~L~~~lk~c~~~  276 (277)
T d2a5yb3         203 -VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEV  276 (277)
T ss_dssp             ---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHT
T ss_pred             -CchhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcHHHHHHHHHHHHhcccHHHHHHHHh
Confidence             345678999999999999999999999999887643           345678999999999999999999965
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure