Citrus Sinensis ID: 047558

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MDLLISCILWLVFTFVWVMALSFISRRRRKQVRPGPKPYPVIGNLLEPGGKPHKSLANLTKIHGRIMSLKTWPDLRRKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNTIFSSNL
ccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHcccccccccEEEEcHHHHHHHHHHHHHHHccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEccHHHHccccHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHccccccEEcHHHHHHHHHHHHHHccEEEccc
MDLLISCILWLVFTFVWVMALSFISRrrrkqvrpgpkpypvignllepggkphksLANLTKIHGRImslktwpdLRRKKINDLLASVeencpagkaigfgqaafhtslnlssntifssnl
MDLLISCILWLVFTFVWVMALSFisrrrrkqvrpgpkpypvignllepggkPHKSLANLTKIHGRimslktwpdlRRKKINDLLASVEENCPAGKAIGFGQAAFHTslnlssntifssnl
MDLLISCILWLVFTFVWVMALSFISRRRRKQVRPGPKPYPVIGNLLEPGGKPHKSLANLTKIHGRIMSLKTWPDLRRKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNTIFSSNL
**LLISCILWLVFTFVWVMALSFISRR***********YPVIGNLL********SLANLTKIHGRIMSLKTWPDLRRKKINDLLASVEENCPAGKAIGFGQAAFHTSLNL**********
MDLLISCILWLVFTFVWVMALS**************KPYPVIGNLLEPGGKPHKSLANLTKIHGRIMSLKTWPDLRRKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNTIFSSNL
MDLLISCILWLVFTFVWVMALSFIS*********GPKPYPVIGNLLEPGGKPHKSLANLTKIHGRIMSLKTWPDLRRKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNTIFSSNL
MDLLISCILWLVFTFVWVMALSFISRRRRKQVRPGPKPYPVIGNLLEPGGKPHKSLANLTKIHGRIMSLKTWPDLRRKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNTIFSSNL
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLLISCILWLVFTFVWVMALSFISRRRRKQVRPGPKPYPVIGNLLEPGGKPHKSLANLTKIHGRIMSLKTWPDLRRKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNTIFSSNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query120 2.2.26 [Sep-21-2011]
Q8VWZ7 493 Geraniol 8-hydroxylase OS N/A no 0.566 0.137 0.528 4e-10
O64635 511 Cytochrome P450 76C4 OS=A yes no 0.583 0.136 0.421 6e-08
O23976 490 7-ethoxycoumarin O-deethy N/A no 0.541 0.132 0.450 9e-08
O64900 488 (S)-N-methylcoclaurine 3' N/A no 0.475 0.116 0.397 2e-07
O64899 487 (S)-N-methylcoclaurine 3' N/A no 0.475 0.117 0.397 3e-07
Q9ZU07 496 Cytochrome P450 71B12 OS= no no 0.516 0.125 0.415 6e-07
O64636 512 Cytochrome P450 76C1 OS=A no no 0.583 0.136 0.381 3e-06
Q9FXW4 488 Probable (S)-N-methylcocl N/A no 0.358 0.088 0.488 3e-06
P49264 496 Cytochrome P450 71B1 OS=T N/A no 0.733 0.177 0.312 6e-06
Q92095 521 Cytochrome P450 1A1 OS=Op N/A no 0.516 0.119 0.338 6e-06
>sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 Back     alignment and function desciption
 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 45/70 (64%), Gaps = 2/70 (2%)

Query: 1  MDLLISCILWLVFTFVWVMALSFISRRRRKQVRPGPKPYPVIGNLLEPGGKPHKSLANLT 60
          MD L + IL L+F      A S++SRR  K + PGP P P IG+L   G +PHKSLA L+
Sbjct: 1  MDYL-TIILTLLFALTLYEAFSYLSRRT-KNLPPGPSPLPFIGSLHLLGDQPHKSLAKLS 58

Query: 61 KIHGRIMSLK 70
          K HG IMSLK
Sbjct: 59 KKHGPIMSLK 68
Hydroxylase involved in the biosynthesis of hydroxygeraniol, a precursor of the terpenoid indole alkaloids such as vinblastine and vincristine. Also able to hydroxylate in vitro nerol and to catalyze 3'-hydroxylation of the flavanone naringenin to form eriodictyol. No activity with apigenin, kaempferol, p-coumaric acid and ferulic acid as substrates.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 5EC: 2
>sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 Back     alignment and function description
>sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 Back     alignment and function description
>sp|O64900|C80B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 Back     alignment and function description
>sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 Back     alignment and function description
>sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 Back     alignment and function description
>sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 Back     alignment and function description
>sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
296089100 1702 unnamed protein product [Vitis vinifera] 0.916 0.064 0.363 3e-14
359474456 443 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.975 0.264 0.365 6e-14
297742641 373 unnamed protein product [Vitis vinifera] 0.866 0.278 0.357 3e-13
224071632 496 cytochrome P450 [Populus trichocarpa] gi 0.583 0.141 0.465 1e-11
388504812 318 unknown [Lotus japonicus] 1.0 0.377 0.276 7e-11
357478913 372 Cytochrome P450, partial [Medicago trunc 0.541 0.174 0.514 4e-10
255537171 377 cytochrome P450, putative [Ricinus commu 0.55 0.175 0.520 6e-10
357438767 499 Cytochrome P450 monooxygenase [Medicago 0.541 0.130 0.514 6e-10
356574422 522 PREDICTED: cytochrome P450 76C4-like [Gl 0.558 0.128 0.535 3e-09
356575857 501 PREDICTED: cytochrome P450 76C4-like [Gl 0.558 0.133 0.535 3e-09
>gi|296089100|emb|CBI38803.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 78/168 (46%), Gaps = 58/168 (34%)

Query: 11   LVFTFVW----VMALSFISRR-RRKQVRPGPKPYPVIGNLLEPGGKPHKSLANLTKIHGR 65
            L+ +FVW    ++ LS I R+     + PGP+P P+IGN+L+ G KPH+SLANL+K +G 
Sbjct: 920  LLLSFVWTCIHLLKLSPIGRKPGTASLPPGPRPLPIIGNILKLGDKPHRSLANLSKTYGP 979

Query: 66   IMSLK-----------------------------TWPD---------------------- 74
            +MSLK                             T PD                      
Sbjct: 980  VMSLKLGSIATIVISSSETAKEVLHRNDQAFSSRTVPDAVRAHNHHESSVVWVPASLDAS 1039

Query: 75   --LRRKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNTIFSSNL 120
              LRRK + +LL  VEE C  G A+    A F  SLNL SNTIFS NL
Sbjct: 1040 QGLRRKIVQELLDHVEECCSRGCAVDINGAVFTASLNLLSNTIFSINL 1087

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359474456|ref|XP_003631472.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76C4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742641|emb|CBI34790.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224071632|ref|XP_002303546.1| cytochrome P450 [Populus trichocarpa] gi|222840978|gb|EEE78525.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388504812|gb|AFK40472.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357478913|ref|XP_003609742.1| Cytochrome P450, partial [Medicago truncatula] gi|355510797|gb|AES91939.1| Cytochrome P450, partial [Medicago truncatula] Back     alignment and taxonomy information
>gi|255537171|ref|XP_002509652.1| cytochrome P450, putative [Ricinus communis] gi|223549551|gb|EEF51039.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357438767|ref|XP_003589660.1| Cytochrome P450 monooxygenase [Medicago truncatula] gi|355478708|gb|AES59911.1| Cytochrome P450 monooxygenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356574422|ref|XP_003555347.1| PREDICTED: cytochrome P450 76C4-like [Glycine max] Back     alignment and taxonomy information
>gi|356575857|ref|XP_003556053.1| PREDICTED: cytochrome P450 76C4-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
UNIPROTKB|Q8VWZ7 493 CYP76B6 "Geraniol 8-hydroxylas 0.566 0.137 0.528 4e-20
UNIPROTKB|D1MI46 495 CYP76B10 "Geraniol 8-hydroxyla 0.575 0.139 0.464 7.8e-19
TAIR|locus:2043694 511 CYP76C4 ""cytochrome P450, fam 0.583 0.136 0.421 6e-14
TAIR|locus:2012693 511 CYP76C6 ""cytochrome P450, fam 0.583 0.136 0.381 8.4e-14
TAIR|locus:2043605 512 CYP76C2 ""cytochrome P450, fam 0.583 0.136 0.381 9.3e-13
TAIR|locus:2043699 512 CYP76C1 ""cytochrome P450, fam 0.583 0.136 0.381 6.4e-12
TAIR|locus:2100982 498 CYP76C7 ""cytochrome P450, fam 0.575 0.138 0.319 6.8e-12
TAIR|locus:504955652 340 AT3G61035 [Arabidopsis thalian 0.566 0.2 0.386 7.2e-12
TAIR|locus:2043614 515 CYP76C3 ""cytochrome P450, fam 0.55 0.128 0.352 1.1e-11
UNIPROTKB|Q69X58 500 CYP76M7 "Ent-cassadiene C11-al 0.516 0.124 0.411 1e-10
UNIPROTKB|Q8VWZ7 CYP76B6 "Geraniol 8-hydroxylase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
 Score = 155 (59.6 bits), Expect = 4.0e-20, Sum P(2) = 4.0e-20
 Identities = 37/70 (52%), Positives = 45/70 (64%)

Query:     1 MDLLISCILWLVFTFVWVMALSFISRRRRKQVRPGPKPYPVIGNLLEPGGKPHKSLANLT 60
             MD L + IL L+F      A S++SRR  K + PGP P P IG+L   G +PHKSLA L+
Sbjct:     1 MDYL-TIILTLLFALTLYEAFSYLSRRT-KNLPPGPSPLPFIGSLHLLGDQPHKSLAKLS 58

Query:    61 KIHGRIMSLK 70
             K HG IMSLK
Sbjct:    59 KKHGPIMSLK 68
GO:0016099 "monoterpenoid biosynthetic process" evidence=IDA
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
UNIPROTKB|D1MI46 CYP76B10 "Geraniol 8-hydroxylase" [Swertia mussotii (taxid:137888)] Back     alignment and assigned GO terms
TAIR|locus:2043694 CYP76C4 ""cytochrome P450, family 76, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012693 CYP76C6 ""cytochrome P450, family 76, subfamily C, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043699 CYP76C1 ""cytochrome P450, family 76, subfamily C, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100982 CYP76C7 ""cytochrome P450, family 76, subfamily C, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955652 AT3G61035 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043614 CYP76C3 ""cytochrome P450, family 76, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q69X58 CYP76M7 "Ent-cassadiene C11-alpha-hydroxylase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP76F4
cytochrome P450 (505 aa)
(Populus trichocarpa)
Predicted Functional Partners:
CYP715A2-2
cytochrome P450 (359 aa)
  •     0.414

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 5e-11
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 2e-08
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 5e-08
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-07
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-06
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-04
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 8e-04
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 0.002
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 0.003
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information 
 Score = 57.9 bits (140), Expect = 5e-11
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 1  MDLLISCILW--LVFTFVWVMAL-SFISRRRRKQVRPGPKPYPVIGNLLEPGGKPHKSLA 57
          MDL +  +L    V   VW + L    S + ++ + PGP+ +PV+GNL + G KPH ++A
Sbjct: 1  MDLPLPLLLGTVAVSVLVWCLLLRRGGSGKHKRPLPPGPRGWPVLGNLPQLGPKPHHTMA 60

Query: 58 NLTKIHGRIMSLK 70
           L K +G +  L+
Sbjct: 61 ALAKTYGPLFRLR 73

Length = 517
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 120
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.82
PLN03234 499 cytochrome P450 83B1; Provisional 99.69
PTZ00404 482 cytochrome P450; Provisional 99.69
PLN03112 514 cytochrome P450 family protein; Provisional 99.67
PLN02687 517 flavonoid 3'-monooxygenase 99.66
PLN02971 543 tryptophan N-hydroxylase 99.65
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.65
PLN02290 516 cytokinin trans-hydroxylase 99.63
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.63
PLN02183 516 ferulate 5-hydroxylase 99.61
PLN02966 502 cytochrome P450 83A1 99.6
PLN02394 503 trans-cinnamate 4-monooxygenase 99.58
PLN02500 490 cytochrome P450 90B1 99.52
PLN00168 519 Cytochrome P450; Provisional 99.5
PLN02655 466 ent-kaurene oxidase 99.48
PLN02774 463 brassinosteroid-6-oxidase 99.47
PLN02196 463 abscisic acid 8'-hydroxylase 99.46
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.43
PLN03018 534 homomethionine N-hydroxylase 99.4
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.4
PLN02302 490 ent-kaurenoic acid oxidase 99.4
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.39
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.38
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.37
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.33
PLN02936 489 epsilon-ring hydroxylase 99.2
PLN02738 633 carotene beta-ring hydroxylase 99.17
PLN02648 480 allene oxide synthase 99.09
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 98.93
PLN02426 502 cytochrome P450, family 94, subfamily C protein 98.52
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 98.44
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 90.06
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.82  E-value=5.2e-19  Score=123.00  Aligned_cols=91  Identities=26%  Similarity=0.622  Sum_probs=80.0

Q ss_pred             cCCCCCCCCCCcccccccccCCC-hhHHHHHHHHhhCCceeeec------------------------------------
Q 047558           29 RKQVRPGPKPYPVIGNLLEPGGK-PHKSLANLTKIHGRIMSLKT------------------------------------   71 (120)
Q Consensus        29 ~~~~~p~p~~~p~~g~~~~~~~~-~~~~~~~~~~~yg~~~~~~~------------------------------------   71 (120)
                      +.+.||||+++|++||++++... +|..+.++.++|||++++++                                    
T Consensus        24 ~~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   24 RRNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            37889999999999999999865 89999999999999999998                                    


Q ss_pred             -----------------cHHHH--------------------HHHHHHHHHHHHHhCCCCCceeHHHHHHHHHHHHHHHH
Q 047558           72 -----------------WPDLR--------------------RKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNT  114 (120)
Q Consensus        72 -----------------W~~~R--------------------~~~~~~~~~~l~~~~~~~~~~d~~~~~~~~t~dvi~~~  114 (120)
                                       ||.+|                    .+|++.+++.+.+ ..+++++|+.+.+..++.|||+++
T Consensus       104 ~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~-~~~~~~vdl~~~l~~~~~nvI~~~  182 (489)
T KOG0156|consen  104 YLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSK-SKKGEPVDLSELLDLLVGNVICRM  182 (489)
T ss_pred             HhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh-cCCCceeeHHHHHHHHHHHHHHHH
Confidence                             88777                    5778888888876 233379999999999999999999


Q ss_pred             HhcCCC
Q 047558          115 IFSSNL  120 (120)
Q Consensus       115 ~fg~~~  120 (120)
                      +||.++
T Consensus       183 ~fG~rf  188 (489)
T KOG0156|consen  183 LFGRRF  188 (489)
T ss_pred             HhCCcc
Confidence            999875

>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-04
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-04
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 4e-04
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure 
Iteration: 1

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
Query: 29 RKQVRPGPKPYPVIGNLLEPGGKP-HKSLANLTKIHGRIMSL 69
          R ++ PGP P PVIGN+L+ G K   KSL NL+K++G + +L
Sbjct: 9  RGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTL 50
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-11
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-10
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-10
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-09
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 5e-09
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-09
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-08
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-08
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-08
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 3e-08
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-08
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 6e-08
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-07
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-07
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-06
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-05
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-04
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
 Score = 58.0 bits (141), Expect = 2e-11
 Identities = 13/52 (25%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 21 LSFISRRRRKQVR--PGPKPYPVIGNLLEPGGKPHKSLANLTKIHGRIMSLK 70
          L  +  R  K ++  P P  +P++G++L  G  PH +L+ +++ +G ++ ++
Sbjct: 4  LKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKNPHLALSRMSQRYGDVLQIR 55
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.68
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.62
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.6
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.6
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.58
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.58
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.57
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.49
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.46
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.45
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.44
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.43
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.4
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.39
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.39
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.36
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.33
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.3
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.3
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.26
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.25
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.25
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.22
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.2
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.03
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 98.97
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 98.97
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 98.94
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 98.93
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 98.89
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 98.85
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 98.81
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 98.81
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 98.18
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 98.17
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 98.01
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 97.85
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 97.8
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 97.78
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 97.75
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 97.69
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 97.57
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 97.5
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 97.49
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 97.49
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 97.41
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 97.3
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 97.08
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 97.04
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 96.93
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 96.56
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 96.53
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 96.45
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 96.43
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 96.36
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 96.23
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 95.96
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 95.78
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 95.56
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 95.33
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 95.29
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 95.25
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 95.24
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 95.15
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 94.94
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 94.93
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 94.86
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 94.46
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 94.4
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 94.23
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 93.61
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 92.92
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 91.91
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 91.64
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 86.81
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.68  E-value=7.7e-17  Score=110.78  Aligned_cols=94  Identities=22%  Similarity=0.329  Sum_probs=79.4

Q ss_pred             hhcCCCCCCCCCCcccccccccCCChhHHHHHHHHhhCCceeeec-----------------------------------
Q 047558           27 RRRKQVRPGPKPYPVIGNLLEPGGKPHKSLANLTKIHGRIMSLKT-----------------------------------   71 (120)
Q Consensus        27 ~~~~~~~p~p~~~p~~g~~~~~~~~~~~~~~~~~~~yg~~~~~~~-----------------------------------   71 (120)
                      +++++.+|||+++|++||++.+.++++..+.+++++||+++++++                                   
T Consensus        10 ~~k~~~~PGP~~~PliGn~~~~~~~~~~~~~~~~~~yG~i~~~~~g~~~~vvv~dp~~i~~il~~~~~~~f~~r~~~~~~   89 (485)
T 3nxu_A           10 LFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPV   89 (485)
T ss_dssp             HHHHHTCCCCCCBTTTBTGGGGGGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCCCCCCSCC
T ss_pred             HHhhCCCCCCCCcCeecCcHHhhcChHHHHHHHHHHcCCeEEEEeCCCCEEEECCHHHHHHHHhccchhhccCCcccccc
Confidence            445567999999999999998877888999999999999998866                                   


Q ss_pred             --------------cHHHH-------------------HHHHHHHHHHHHHhCCCCCceeHHHHHHHHHHHHHHHHHhcC
Q 047558           72 --------------WPDLR-------------------RKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNTIFSS  118 (120)
Q Consensus        72 --------------W~~~R-------------------~~~~~~~~~~l~~~~~~~~~~d~~~~~~~~t~dvi~~~~fg~  118 (120)
                                    |+.+|                   +++++++++.+.+..++|+++|+.+.+..+++|+|++++||.
T Consensus        90 ~~~~~~l~~~~g~~w~~~R~~~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~~g~~~d~~~~~~~~~~dvi~~~~fG~  169 (485)
T 3nxu_A           90 GFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGV  169 (485)
T ss_dssp             GGGGGSTTTCCHHHHHHHHHHHGGGGCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCEEHHHHHHHHHHHHHHHHHHSC
T ss_pred             cccccCccccCCcHHHHHHhhcChhcCHHHHHHHHHHHHHHHHHHHHHHHHHhccCCcCcHHHHHHHHHHHHHHHHHcCC
Confidence                          77777                   566777777776544557789999999999999999999998


Q ss_pred             CC
Q 047558          119 NL  120 (120)
Q Consensus       119 ~~  120 (120)
                      ++
T Consensus       170 ~~  171 (485)
T 3nxu_A          170 NI  171 (485)
T ss_dssp             CC
T ss_pred             cc
Confidence            63
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 120
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 4e-08
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-08
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-07
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-07
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-07
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 5e-07
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.8 bits (112), Expect = 4e-08
 Identities = 20/38 (52%), Positives = 27/38 (71%), Gaps = 1/38 (2%)

Query: 34 PGPKPYPVIGNLLEPGGK-PHKSLANLTKIHGRIMSLK 70
          PGP P PVIGN+L+ G K   KSL NL+K++G + +L 
Sbjct: 6  PGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLY 43
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.65
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.62
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.49
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.43
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.39
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.38
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 98.39
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 98.35
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 97.21
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 96.82
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 96.65
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 96.18
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 95.74
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 93.87
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 93.04
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 92.39
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.65  E-value=1.2e-16  Score=107.41  Aligned_cols=92  Identities=23%  Similarity=0.356  Sum_probs=79.9

Q ss_pred             cCCCCCCCCCCcccccccccCCChhHHHHHHHHhhCCceeeec-------------------------------------
Q 047558           29 RKQVRPGPKPYPVIGNLLEPGGKPHKSLANLTKIHGRIMSLKT-------------------------------------   71 (120)
Q Consensus        29 ~~~~~p~p~~~p~~g~~~~~~~~~~~~~~~~~~~yg~~~~~~~-------------------------------------   71 (120)
                      +++.+|||+++|++|++.++.++++.++.+++++||+++++++                                     
T Consensus         7 ~~~~iPGP~~~P~iG~~~~~~~~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~~~   86 (472)
T d1tqna_           7 KKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGF   86 (472)
T ss_dssp             HHTTCCCCCCBTTTBTGGGGGGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSCCGG
T ss_pred             hhcCCCCCCCcCceeEHHHhhCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCcccccccc
Confidence            4456799999999999999888899999999999999999887                                     


Q ss_pred             ------------cHHHH-------------------HHHHHHHHHHHHHhCCCCCceeHHHHHHHHHHHHHHHHHhcCCC
Q 047558           72 ------------WPDLR-------------------RKKINDLLASVEENCPAGKAIGFGQAAFHTSLNLSSNTIFSSNL  120 (120)
Q Consensus        72 ------------W~~~R-------------------~~~~~~~~~~l~~~~~~~~~~d~~~~~~~~t~dvi~~~~fg~~~  120 (120)
                                  |+.+|                   +++++.+++.+.+....+.++|+.+.+.++++|+++.++||.++
T Consensus        87 ~~~~i~~~~g~~~~~~R~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~dl~~~~~~~~~~v~~~~~~G~~~  166 (472)
T d1tqna_          87 MKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNI  166 (472)
T ss_dssp             GGGSTTTCCHHHHHHHHHHTTGGGSHHHHHTTHHHHHHHHHHHHHHHHHHHHHSSCEEHHHHHHHHHHHHHHHTSSCCCC
T ss_pred             cCCceeccCcHHHHHhhhhcCccccchhhhcccchhhhhhhcccccccccccccccchhhhhhhccchhhhhheeccccc
Confidence                        77777                   56677888888776666788999999999999999999999864
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure