Citrus Sinensis ID: 047599

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MHGSITYITSRDSKNFHFNTFKINIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNGGTSSTKVAVDLQCSKVKPRDKIELRDIDMACHGAGGGQAAVSNYSNVHGVA
ccEEEEEEEEEcccccEEEEEEEEEEccccccccccccccccccEEEEccEEEccccEEEEcccccEEEEEEEEEEccccccEEEEEEcccccccccEEEEEEEEEEEEcccccEEEEEEEEccEEEEEEEEcccccEEEEEccccccccccEEEEEEEcEEEcc
ccEEEEEEEEEccccEEEEEEcEEEEccccccccccEEEEccccEEEEEEEEcccccEEEEccccccEEEEEEEEEcccccccEEEcEcccccccccEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEEEEcccccEEEEcccccccccEEEEEEcEcccccc
mhgsityitsrdsknfhfntfkiniqapensphtdgihiansnniqilnseistgddcasmdpgsqnvnissnvkiwpsnvesisirslggtpnekEAREITVQNcnlkgtsnggtsstKVAVDLqcskvkprdkielrdidmachgagggqaavsnysnvhgva
mhgsityitsrdsknfHFNTFKINIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCASMDPGSQNVNissnvkiwpsnvESISIRslggtpnekEAREITVQNcnlkgtsnggtsstkvavdlqcskvkprdkiELRDIDMACHGAgggqaavsnYSNVHGVA
MHGSITYITSRDSKNFHFNTFKINIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNGGTSSTKVAVDLQCSKVKPRDKIELRDIDMACHGAGGGQAAVSNYSNVHGVA
******YI*****KNFHFNTFKINIQ**********IHIANSNNIQIL*************************VKIWP********************************************VDLQC*******KIELRDIDMACHGA*****************
MHGSITYITSRDSKNFHFNTFKINIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNGGTSSTKVAVDLQCSKVKPRDKIELRDIDMACHGAGGGQAAVSNYSNVHGV*
MHGSITYITSRDSKNFHFNTFKINIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNGGTSSTKVAVDLQCSKVKPRDKIELRDIDMACHGAGGGQAAVSNYSNVHGVA
MHGSITYITSRDSKNFHFNTFKINIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNGGTSSTKVAVDLQCSKVKPRDKIELRDIDMACHGAGGGQAAVSNYSNV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHGSITYITSRDSKNFHFNTFKINIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNGGTSSTKVAVDLQCSKVKPRDKIELRDIDMACHGAGGGQAAVSNYSNVHGVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query165 2.2.26 [Sep-21-2011]
Q6H9K0377 Exopolygalacturonase (Fra N/A no 0.666 0.291 0.471 3e-18
P35339410 Exopolygalacturonase OS=Z N/A no 0.666 0.268 0.421 4e-18
P35337397 Polygalacturonase OS=Bras N/A no 0.648 0.269 0.457 5e-18
P24548362 Exopolygalacturonase (Fra N/A no 0.630 0.287 0.452 5e-17
Q40312421 Polygalacturonase OS=Medi N/A no 0.630 0.247 0.417 3e-16
P49063444 Exopolygalacturonase clon no no 0.648 0.240 0.432 3e-16
Q39786407 Polygalacturonase OS=Goss N/A no 0.678 0.275 0.414 4e-16
P26216410 Exopolygalacturonase OS=Z N/A no 0.666 0.268 0.396 4e-16
Q39766407 Polygalacturonase OS=Goss N/A no 0.678 0.275 0.414 5e-16
P35338410 Exopolygalacturonase OS=Z N/A no 0.666 0.268 0.396 7e-16
>sp|Q6H9K0|PGLR2_PLAAC Exopolygalacturonase (Fragment) OS=Platanus acerifolia GN=plaa2 PE=1 SV=1 Back     alignment and function desciption
 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 71/121 (58%), Gaps = 11/121 (9%)

Query: 2   HGSITYITSRDSKNFHFN-------TFK-INIQAPENSPHTDGIHIANSNNIQILNSEIS 53
           H  +  ITS +SK FH N       TF+ + + AP  S +TDGIH+  S  + I N++I+
Sbjct: 138 HAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGISKGVTITNTKIA 197

Query: 54  TGDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSN 113
           TGDDC S+ PGSQNV I + V   P     ISI SLG   NEKE R ITV+ C   GT N
Sbjct: 198 TGDDCISIGPGSQNVTI-TQVNCGPG--HGISIGSLGRYNNEKEVRGITVKGCTFSGTMN 254

Query: 114 G 114
           G
Sbjct: 255 G 255
May function in depolymerizing pectin during pollen development, germination, and tube growth. Acts as an exo-polygalacturonase.
Platanus acerifolia (taxid: 140101)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 6EC: 7
>sp|P35339|PGLR3_MAIZE Exopolygalacturonase OS=Zea mays GN=PG2C PE=2 SV=1 Back     alignment and function description
>sp|P35337|PGLR_BRANA Polygalacturonase OS=Brassica napus PE=2 SV=1 Back     alignment and function description
>sp|P24548|PGLR_OENOR Exopolygalacturonase (Fragment) OS=Oenothera organensis PE=2 SV=1 Back     alignment and function description
>sp|Q40312|PGLR_MEDSA Polygalacturonase OS=Medicago sativa PE=2 SV=1 Back     alignment and function description
>sp|P49063|PGLR2_ARATH Exopolygalacturonase clone GBGA483 OS=Arabidopsis thaliana GN=At3g07850 PE=1 SV=2 Back     alignment and function description
>sp|Q39786|PGLR_GOSHI Polygalacturonase OS=Gossypium hirsutum GN=G9 PE=2 SV=1 Back     alignment and function description
>sp|P26216|PGLR1_MAIZE Exopolygalacturonase OS=Zea mays GN=PG1 PE=1 SV=1 Back     alignment and function description
>sp|Q39766|PGLR_GOSBA Polygalacturonase OS=Gossypium barbadense GN=G9 PE=2 SV=1 Back     alignment and function description
>sp|P35338|PGLR2_MAIZE Exopolygalacturonase OS=Zea mays GN=PG9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
225423446 396 PREDICTED: exopolygalacturonase [Vitis v 0.709 0.295 0.468 2e-19
242093572 404 hypothetical protein SORBIDRAFT_10g02402 0.654 0.267 0.428 1e-18
449508876 412 PREDICTED: polygalacturonase-like [Cucum 0.787 0.315 0.427 4e-18
449453569 412 PREDICTED: polygalacturonase-like [Cucum 0.787 0.315 0.427 4e-18
225217013 413 exopolygalacturonase precursor [Oryza co 0.666 0.266 0.438 4e-18
357117667 412 PREDICTED: exopolygalacturonase-like [Br 0.654 0.262 0.420 5e-18
449463753 349 PREDICTED: exopolygalacturonase-like [Cu 0.654 0.309 0.495 7e-18
125556041 415 hypothetical protein OsI_23683 [Oryza sa 0.654 0.260 0.411 1e-17
125597839 415 hypothetical protein OsJ_21954 [Oryza sa 0.654 0.260 0.411 1e-17
449457983 325 PREDICTED: polygalacturonase-like [Cucum 0.630 0.32 0.513 2e-17
>gi|225423446|ref|XP_002273801.1| PREDICTED: exopolygalacturonase [Vitis vinifera] gi|297738101|emb|CBI27302.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 79/128 (61%), Gaps = 11/128 (8%)

Query: 3   GSITYITSRDSKNFHFNTF--------KINIQAPENSPHTDGIHIANSNNIQILNSEIST 54
           G I +ITS +SK FHFN +         + I AP  SP+TDGIHI  SN+I+I NSEI T
Sbjct: 160 GRIDHITSINSKMFHFNIYDNQKISINHVKILAPAESPNTDGIHIGRSNDIRITNSEIRT 219

Query: 55  GDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNG 114
           GDDC S+  GS++++I  NV+  P +   IS+ SLG    E+E R ITV+NC  +G+ NG
Sbjct: 220 GDDCISLKQGSRDIHI-QNVQCGPGH--GISVGSLGKDEGEEEVRGITVRNCTFQGSDNG 276

Query: 115 GTSSTKVA 122
               T  A
Sbjct: 277 LRIKTWAA 284

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|242093572|ref|XP_002437276.1| hypothetical protein SORBIDRAFT_10g024020 [Sorghum bicolor] gi|241915499|gb|EER88643.1| hypothetical protein SORBIDRAFT_10g024020 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|449508876|ref|XP_004163433.1| PREDICTED: polygalacturonase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449453569|ref|XP_004144529.1| PREDICTED: polygalacturonase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225217013|gb|ACN85300.1| exopolygalacturonase precursor [Oryza coarctata] Back     alignment and taxonomy information
>gi|357117667|ref|XP_003560585.1| PREDICTED: exopolygalacturonase-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|449463753|ref|XP_004149596.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus] gi|449520775|ref|XP_004167408.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|125556041|gb|EAZ01647.1| hypothetical protein OsI_23683 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|125597839|gb|EAZ37619.1| hypothetical protein OsJ_21954 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|449457983|ref|XP_004146727.1| PREDICTED: polygalacturonase-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
TAIR|locus:2020352402 AT1G17150 [Arabidopsis thalian 0.666 0.273 0.471 4.3e-27
TAIR|locus:2032125404 AT1G78400 [Arabidopsis thalian 0.648 0.264 0.406 1.3e-20
UNIPROTKB|Q6H9K0377 plaa2 "Exopolygalacturonase" [ 0.666 0.291 0.471 2.4e-20
TAIR|locus:2080422388 AT3G59850 [Arabidopsis thalian 0.648 0.275 0.415 2.6e-20
TAIR|locus:2016239336 AT1G80140 [Arabidopsis thalian 0.660 0.324 0.368 1.3e-19
TAIR|locus:2077437401 AT3G07840 [Arabidopsis thalian 0.666 0.274 0.438 1.8e-19
TAIR|locus:2046555 664 AT2G33160 [Arabidopsis thalian 0.648 0.161 0.398 3.5e-19
TAIR|locus:2141877414 AT4G18180 [Arabidopsis thalian 0.630 0.251 0.426 2.1e-18
TAIR|locus:2077402391 AT3G07820 [Arabidopsis thalian 0.830 0.350 0.390 2.7e-18
TAIR|locus:2024680422 PGA4 "polygalacturonase 4" [Ar 0.939 0.367 0.367 2.9e-18
TAIR|locus:2020352 AT1G17150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 4.3e-27, Sum P(2) = 4.3e-27
 Identities = 57/121 (47%), Positives = 75/121 (61%)

Query:     2 HGSITYITSRDSK----NF----HFNTFKINIQAPENSPHTDGIHIANSNNIQILNSEIS 53
             + S+  ITS +SK    NF    HF+  ++NI AP NSP+TDGI IA S+N+QI N+ IS
Sbjct:   162 NSSMNGITSLNSKAGHFNFLSVDHFSITRVNIIAPSNSPNTDGIKIALSSNMQISNTHIS 221

Query:    54 TGDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSN 113
             TGDDC +M  G+ N +I  NVK  P +   ISI SLG   +EK    + V+N    GT+N
Sbjct:   222 TGDDCIAMLSGNTNFDIY-NVKCGPGH--GISIGSLGKNKDEKNVNGLMVRNSVFTGTTN 278

Query:   114 G 114
             G
Sbjct:   279 G 279
GO:0004650 "polygalacturonase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA;ISS
TAIR|locus:2032125 AT1G78400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6H9K0 plaa2 "Exopolygalacturonase" [Platanus x acerifolia (taxid:140101)] Back     alignment and assigned GO terms
TAIR|locus:2080422 AT3G59850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016239 AT1G80140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077437 AT3G07840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046555 AT2G33160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141877 AT4G18180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077402 AT3G07820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024680 PGA4 "polygalacturonase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
PLN02188404 PLN02188, PLN02188, polygalacturonase/glycoside hy 9e-23
pfam00295325 pfam00295, Glyco_hydro_28, Glycosyl hydrolases fam 8e-22
PLN03010409 PLN03010, PLN03010, polygalacturonase 4e-17
PLN03003 456 PLN03003, PLN03003, Probable polygalacturonase At3 1e-15
PLN02218431 PLN02218, PLN02218, polygalacturonase ADPG 1e-14
PLN02793443 PLN02793, PLN02793, Probable polygalacturonase 2e-13
PLN02155394 PLN02155, PLN02155, polygalacturonase 5e-10
COG5434 542 COG5434, PGU1, Endopygalactorunase [Cell envelope 0.002
>gnl|CDD|215120 PLN02188, PLN02188, polygalacturonase/glycoside hydrolase family protein Back     alignment and domain information 
 Score = 92.6 bits (230), Expect = 9e-23
 Identities = 47/115 (40%), Positives = 66/115 (57%), Gaps = 11/115 (9%)

Query: 8   ITSRDSKNFH--------FNTFKINIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCA 59
           ITS +SK FH        F    + I AP +SP+TDGIHI  S+ + I +S I TGDDC 
Sbjct: 171 ITSVNSKFFHIALVECRNFKGSGLKISAPSDSPNTDGIHIERSSGVYISDSRIGTGDDCI 230

Query: 60  SMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNG 114
           S+  G+  V I+  ++  P +   IS+ SLG  PNE +   + V++C   GT+NG
Sbjct: 231 SIGQGNSQVTITR-IRCGPGH--GISVGSLGRYPNEGDVTGLVVRDCTFTGTTNG 282

Length = 404
>gnl|CDD|215843 pfam00295, Glyco_hydro_28, Glycosyl hydrolases family 28 Back     alignment and domain information
>gnl|CDD|215540 PLN03010, PLN03010, polygalacturonase Back     alignment and domain information
>gnl|CDD|178580 PLN03003, PLN03003, Probable polygalacturonase At3g15720 Back     alignment and domain information
>gnl|CDD|177865 PLN02218, PLN02218, polygalacturonase ADPG Back     alignment and domain information
>gnl|CDD|215426 PLN02793, PLN02793, Probable polygalacturonase Back     alignment and domain information
>gnl|CDD|165802 PLN02155, PLN02155, polygalacturonase Back     alignment and domain information
>gnl|CDD|227721 COG5434, PGU1, Endopygalactorunase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 165
PLN03003456 Probable polygalacturonase At3g15720 100.0
PLN02793443 Probable polygalacturonase 100.0
PLN02155394 polygalacturonase 100.0
PLN02218431 polygalacturonase ADPG 100.0
PLN02188404 polygalacturonase/glycoside hydrolase family prote 100.0
PLN03010409 polygalacturonase 100.0
PF00295326 Glyco_hydro_28: Glycosyl hydrolases family 28; Int 100.0
COG5434 542 PGU1 Endopygalactorunase [Cell envelope biogenesis 99.92
PF03718582 Glyco_hydro_49: Glycosyl hydrolase family 49; Inte 99.21
smart00656190 Amb_all Amb_all domain. 98.17
PLN02793443 Probable polygalacturonase 98.11
PLN02188404 polygalacturonase/glycoside hydrolase family prote 97.99
PF00295326 Glyco_hydro_28: Glycosyl hydrolases family 28; Int 97.97
TIGR03805314 beta_helix_1 parallel beta-helix repeat-containing 97.89
PLN02218431 polygalacturonase ADPG 97.88
PLN03003 456 Probable polygalacturonase At3g15720 97.85
PLN02155394 polygalacturonase 97.74
PF00544200 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pe 97.74
PF13229158 Beta_helix: Right handed beta helix region; PDB: 2 97.57
PLN03010409 polygalacturonase 97.5
COG3866345 PelB Pectate lyase [Carbohydrate transport and met 97.34
PF12708225 Pectate_lyase_3: Pectate lyase superfamily protein 97.28
PF13229158 Beta_helix: Right handed beta helix region; PDB: 2 97.21
PF12708225 Pectate_lyase_3: Pectate lyase superfamily protein 96.93
TIGR03805 314 beta_helix_1 parallel beta-helix repeat-containing 96.88
PF12541277 DUF3737: Protein of unknown function (DUF3737) ; I 96.79
COG5434 542 PGU1 Endopygalactorunase [Cell envelope biogenesis 96.35
smart00656190 Amb_all Amb_all domain. 96.23
PF12541 277 DUF3737: Protein of unknown function (DUF3737) ; I 96.14
PF05048236 NosD: Periplasmic copper-binding protein (NosD); I 95.93
PF00544200 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pe 95.64
PF05048236 NosD: Periplasmic copper-binding protein (NosD); I 94.84
TIGR03808455 RR_plus_rpt_1 twin-arg-translocated uncharacterize 94.75
COG3866345 PelB Pectate lyase [Carbohydrate transport and met 93.89
TIGR03808 455 RR_plus_rpt_1 twin-arg-translocated uncharacterize 90.04
PF03718 582 Glyco_hydro_49: Glycosyl hydrolase family 49; Inte 80.8
TIGR0380444 para_beta_helix parallel beta-helix repeat (two co 80.46
>PLN03003 Probable polygalacturonase At3g15720 Back     alignment and domain information 
Probab=100.00  E-value=1.5e-43  Score=312.82  Aligned_cols=162  Identities=38%  Similarity=0.631  Sum_probs=146.8

Q ss_pred             CcEEEEeeEEeCCCCceEEEeE--------EEEEcCCCCCCCCeEEecceecEEEEeeEEecCCceEEecCCCeeEEEEe
Q 047599            1 MHGSITYITSRDSKNFHFNTFK--------INIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCASMDPGSQNVNISS   72 (165)
Q Consensus         1 ~nv~i~gitl~nsp~w~i~i~~--------v~I~~~~~~~NtDGidi~~s~nV~I~n~~i~~gDDcIaiks~s~nI~i~~   72 (165)
                      .|+.|+||+++|||+||+++.+        |+|.+|..+|||||||+++|+||+|+||+|++||||||||++++||+|+ 
T Consensus       147 ~nv~I~gitl~NSp~w~i~i~~c~nV~i~~l~I~ap~~spNTDGIDi~~S~nV~I~n~~I~tGDDCIaiksgs~NI~I~-  225 (456)
T PLN03003        147 NNLRLSGLTHLDSPMAHIHISECNYVTISSLRINAPESSPNTDGIDVGASSNVVIQDCIIATGDDCIAINSGTSNIHIS-  225 (456)
T ss_pred             CCcEEeCeEEecCCcEEEEEeccccEEEEEEEEeCCCCCCCCCcEeecCcceEEEEecEEecCCCeEEeCCCCccEEEE-
Confidence            3789999999999999998764        9999998899999999999999999999999999999999999999999 


Q ss_pred             CeEEcCCCcceEEEeecCCCCCCCCeeeEEEEeeEEeCCCCC--------------------------------------
Q 047599           73 NVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNG--------------------------------------  114 (165)
Q Consensus        73 n~~~~~g~~hGisiGS~g~~~~~~~v~nV~v~n~~~~~t~~g--------------------------------------  114 (165)
                      |++|.+|  |||+|||||+++..+.|+||+|+||+|.++.+|                                      
T Consensus       226 n~~c~~G--HGISIGSlg~~g~~~~V~NV~v~n~~~~~T~nGvRIKT~~Gg~G~v~nItf~nI~m~nV~~pI~Idq~Y~~  303 (456)
T PLN03003        226 GIDCGPG--HGISIGSLGKDGETATVENVCVQNCNFRGTMNGARIKTWQGGSGYARMITFNGITLDNVENPIIIDQFYNG  303 (456)
T ss_pred             eeEEECC--CCeEEeeccCCCCcceEEEEEEEeeEEECCCcEEEEEEeCCCCeEEEEEEEEeEEecCccceEEEEcccCC
Confidence            9999999  999999999988778999999999999999887                                      


Q ss_pred             -------------------------cccCccceEEEEcCCCCCeEeEEEEeEEEEecCCCCCCcCceeeEeeEecC
Q 047599          115 -------------------------GTSSTKVAVDLQCSKVKPRDKIELRDIDMACHGAGGGQAAVSNYSNVHGVA  165 (165)
Q Consensus       115 -------------------------Gt~~~~~a~~l~c~~~~pc~~i~~~dv~l~~~~~~~~~~~~~~C~nv~g~~  165 (165)
                                               ||+..+.++.|.|++..||+||+|+||+|+...++.+..+.+.|+||+|.+
T Consensus       304 ~~~~~~~~~~~s~v~IsnI~f~NI~GTs~~~~ai~l~Cs~~~PC~nI~l~ni~l~~~~~g~~~~~~~~C~Nv~G~~  379 (456)
T PLN03003        304 GDSDNAKDRKSSAVEVSKVVFSNFIGTSKSEYGVDFRCSERVPCTEIFLRDMKIETASSGSGQVAQGQCLNVRGAS  379 (456)
T ss_pred             CCCCCcccCCCCCcEEEeEEEEeEEEEeCccceEEEEeCCCCCeeeEEEEEEEEEecCCCCCCccCcEEecccccc
Confidence                                     344567899999999999999999999999874221225789999999973

>PLN02793 Probable polygalacturonase Back     alignment and domain information
>PLN02155 polygalacturonase Back     alignment and domain information
>PLN02218 polygalacturonase ADPG Back     alignment and domain information
>PLN02188 polygalacturonase/glycoside hydrolase family protein Back     alignment and domain information
>PLN03010 polygalacturonase Back     alignment and domain information
>PF00295 Glyco_hydro_28: Glycosyl hydrolases family 28; InterPro: IPR000743 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG5434 PGU1 Endopygalactorunase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03718 Glyco_hydro_49: Glycosyl hydrolase family 49; InterPro: IPR005192 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00656 Amb_all Amb_all domain Back     alignment and domain information
>PLN02793 Probable polygalacturonase Back     alignment and domain information
>PLN02188 polygalacturonase/glycoside hydrolase family protein Back     alignment and domain information
>PF00295 Glyco_hydro_28: Glycosyl hydrolases family 28; InterPro: IPR000743 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR03805 beta_helix_1 parallel beta-helix repeat-containing protein Back     alignment and domain information
>PLN02218 polygalacturonase ADPG Back     alignment and domain information
>PLN03003 Probable polygalacturonase At3g15720 Back     alignment and domain information
>PLN02155 polygalacturonase Back     alignment and domain information
>PF00544 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pectate lyase 4 Back     alignment and domain information
>PF13229 Beta_helix: Right handed beta helix region; PDB: 2INV_C 2INU_C 1RU4_A Back     alignment and domain information
>PLN03010 polygalacturonase Back     alignment and domain information
>COG3866 PelB Pectate lyase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12708 Pectate_lyase_3: Pectate lyase superfamily protein; PDB: 3EQN_A 3EQO_A 2PYG_A 2PYH_A 3SUC_A 3GQ7_A 3GQ9_A 3GQA_A 3GQ8_A 2VBE_A Back     alignment and domain information
>PF13229 Beta_helix: Right handed beta helix region; PDB: 2INV_C 2INU_C 1RU4_A Back     alignment and domain information
>PF12708 Pectate_lyase_3: Pectate lyase superfamily protein; PDB: 3EQN_A 3EQO_A 2PYG_A 2PYH_A 3SUC_A 3GQ7_A 3GQ9_A 3GQA_A 3GQ8_A 2VBE_A Back     alignment and domain information
>TIGR03805 beta_helix_1 parallel beta-helix repeat-containing protein Back     alignment and domain information
>PF12541 DUF3737: Protein of unknown function (DUF3737) ; InterPro: IPR022208 This family of proteins is found in bacteria, archaea and eukaryotes Back     alignment and domain information
>COG5434 PGU1 Endopygalactorunase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>smart00656 Amb_all Amb_all domain Back     alignment and domain information
>PF12541 DUF3737: Protein of unknown function (DUF3737) ; InterPro: IPR022208 This family of proteins is found in bacteria, archaea and eukaryotes Back     alignment and domain information
>PF05048 NosD: Periplasmic copper-binding protein (NosD); InterPro: IPR007742 Bacterial nitrous oxide (N(2)O) reductase is the terminal oxidoreductase of a respiratory process that generates dinitrogen from N(2)O Back     alignment and domain information
>PF00544 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pectate lyase 4 Back     alignment and domain information
>PF05048 NosD: Periplasmic copper-binding protein (NosD); InterPro: IPR007742 Bacterial nitrous oxide (N(2)O) reductase is the terminal oxidoreductase of a respiratory process that generates dinitrogen from N(2)O Back     alignment and domain information
>TIGR03808 RR_plus_rpt_1 twin-arg-translocated uncharacterized repeat protein Back     alignment and domain information
>COG3866 PelB Pectate lyase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03808 RR_plus_rpt_1 twin-arg-translocated uncharacterized repeat protein Back     alignment and domain information
>PF03718 Glyco_hydro_49: Glycosyl hydrolase family 49; InterPro: IPR005192 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR03804 para_beta_helix parallel beta-helix repeat (two copies) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
1bhe_A376 PEHA, polygalacturonase; family 28 glycosyl hydrol 8e-22
1czf_A362 Polygalacturonase II; beta helix, hydrolase; HET: 9e-20
1ia5_A339 Polygalacturonase; glycosylhydrolase, hydrolase; H 9e-20
2iq7_A339 Endopolygalacturonase; parallel beta helix, hydrol 1e-19
1nhc_A336 Polygalacturonase I; beta-helix, hydrolase; HET: M 2e-19
1rmg_A 422 Rgase A, rhamnogalacturonase A; hydrolase, inverti 2e-19
1k5c_A335 Endopolygalacturonase; beta helical structure, gly 3e-17
1hg8_A349 Endopolygalacturonase; hydrolase, pectin degradati 3e-16
3jur_A448 EXO-poly-alpha-D-galacturonosidase; beta-helix, ce 8e-16
2uvf_A608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 1e-14
>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 Length = 376 Back     alignment and structure
 Score = 89.0 bits (221), Expect = 8e-22
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 17/124 (13%)

Query: 2   HGSITYITSRDSKNFHFNTFK--------INIQAPENSPHTDGIHIANSNNIQILNSEIS 53
           + ++  ++  +S NFH               I+ P  + +TDGI   +S NI I  S I+
Sbjct: 161 NFTLYNVSLINSPNFHVVFSDGDGFTAWKTTIKTPSTARNTDGIDPMSSKNITIAYSNIA 220

Query: 54  TGDDCASMDPGSQNVNISSNVKIWPSNVES---ISIRSLGGTPNEKEAREITVQNCNLKG 110
           TGDD  ++         + N+ I  ++  +   +SI S            +TV +  + G
Sbjct: 221 TGDDNVAIKAYKGRAE-TRNISILHNDFGTGHGMSIGSETMG-----VYNVTVDDLKMNG 274

Query: 111 TSNG 114
           T+NG
Sbjct: 275 TTNG 278
>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 Length = 362 Back     alignment and structure
>1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A* Length = 339 Back     alignment and structure
>2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini} Length = 339 Back     alignment and structure
>1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3 Length = 336 Back     alignment and structure
>1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 Length = 422 Back     alignment and structure
>1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A* Length = 335 Back     alignment and structure
>1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3 Length = 349 Back     alignment and structure
>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} Length = 448 Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Length = 608 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
1bhe_A376 PEHA, polygalacturonase; family 28 glycosyl hydrol 100.0
1ia5_A339 Polygalacturonase; glycosylhydrolase, hydrolase; H 100.0
1nhc_A336 Polygalacturonase I; beta-helix, hydrolase; HET: M 100.0
1czf_A362 Polygalacturonase II; beta helix, hydrolase; HET: 100.0
1hg8_A349 Endopolygalacturonase; hydrolase, pectin degradati 100.0
2iq7_A339 Endopolygalacturonase; parallel beta helix, hydrol 100.0
1rmg_A422 Rgase A, rhamnogalacturonase A; hydrolase, inverti 100.0
1k5c_A335 Endopolygalacturonase; beta helical structure, gly 100.0
3jur_A448 EXO-poly-alpha-D-galacturonosidase; beta-helix, ce 100.0
2uvf_A608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 99.96
1x0c_A549 Isopullulanase; glycoside hydrolase family 49, gly 99.91
1ogo_X574 Dextranase; hydrolase, dextran degradation, glycos 99.9
2x6w_A 600 Tail spike protein; viral protein, beta-helix, hyd 99.81
3gqn_A 772 Preneck appendage protein; beta helix, beta barrel 99.77
3gq8_A 609 Preneck appendage protein; beta helix, viral prote 99.77
1h80_A 464 IOTA-carrageenase; hydrolase, IOTA-carrageenan dou 99.59
2vbk_A 514 Tailspike-protein; viral adhesion protein, viral p 99.39
2pyg_A377 Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli 99.18
2uvf_A608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 98.86
1h80_A 464 IOTA-carrageenase; hydrolase, IOTA-carrageenan dou 98.83
1x0c_A549 Isopullulanase; glycoside hydrolase family 49, gly 98.78
1ogo_X574 Dextranase; hydrolase, dextran degradation, glycos 98.75
2iq7_A339 Endopolygalacturonase; parallel beta helix, hydrol 98.75
3jur_A448 EXO-poly-alpha-D-galacturonosidase; beta-helix, ce 98.74
1rmg_A 422 Rgase A, rhamnogalacturonase A; hydrolase, inverti 98.72
1hg8_A349 Endopolygalacturonase; hydrolase, pectin degradati 98.64
1nhc_A336 Polygalacturonase I; beta-helix, hydrolase; HET: M 98.56
1k5c_A335 Endopolygalacturonase; beta helical structure, gly 98.56
1ia5_A339 Polygalacturonase; glycosylhydrolase, hydrolase; H 98.55
1czf_A362 Polygalacturonase II; beta helix, hydrolase; HET: 98.45
1bhe_A376 PEHA, polygalacturonase; family 28 glycosyl hydrol 98.19
1pcl_A355 Pectate lyase E; lyase (acting on polysaccharides) 98.11
2o04_A399 Pectate lyase, PL; hexasaccharide compound II, cal 98.01
1vbl_A416 Pectate lyase 47; PL 47, thermostable, bacillus su 97.95
1pxz_A346 Major pollen allergen JUN A 1; parallel beta-helix 97.88
2pyg_A377 Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli 97.85
3gq8_A 609 Preneck appendage protein; beta helix, viral prote 97.84
3gqn_A 772 Preneck appendage protein; beta helix, beta barrel 97.83
1air_A353 Pectate lyase C, PELC; pectate cleavage, pectinoly 97.82
3vmv_A326 Pectate lyase; polysaccharide lyase family 1, beta 97.7
3zsc_A340 Pectate trisaccharide-lyase; hydrolase; HET: ADA A 97.7
1pe9_A361 Pectate lyase A; parallel beta helix; 1.60A {Erwin 97.57
2x6w_A 600 Tail spike protein; viral protein, beta-helix, hyd 97.54
2qy1_A330 Pectate lyase II; GAG lyase; 1.90A {Xanthomonas ca 97.48
1idk_A359 Pectin lyase A; signal, glycoprotein, multigene fa 97.36
3eqn_A 758 Glucan 1,3-beta-glucosidase; tandem beta-helix dom 96.74
3zsc_A 340 Pectate trisaccharide-lyase; hydrolase; HET: ADA A 96.6
1qcx_A359 Pectin lyase B; beta-helix protein, plant cell WAL 96.53
1idk_A 359 Pectin lyase A; signal, glycoprotein, multigene fa 96.35
3vmv_A326 Pectate lyase; polysaccharide lyase family 1, beta 96.3
1qcx_A 359 Pectin lyase B; beta-helix protein, plant cell WAL 96.06
3eqn_A 758 Glucan 1,3-beta-glucosidase; tandem beta-helix dom 96.03
1ru4_A 400 Pectate lyase, PEL9A; parallel beta-helix; 1.60A { 95.85
1pxz_A346 Major pollen allergen JUN A 1; parallel beta-helix 95.8
1pe9_A 361 Pectate lyase A; parallel beta helix; 1.60A {Erwin 95.76
2qy1_A 330 Pectate lyase II; GAG lyase; 1.90A {Xanthomonas ca 95.74
1pcl_A 355 Pectate lyase E; lyase (acting on polysaccharides) 95.64
1ru4_A400 Pectate lyase, PEL9A; parallel beta-helix; 1.60A { 95.49
1air_A 353 Pectate lyase C, PELC; pectate cleavage, pectinoly 95.11
1vbl_A 416 Pectate lyase 47; PL 47, thermostable, bacillus su 95.01
2o04_A399 Pectate lyase, PL; hexasaccharide compound II, cal 94.18
2inu_A410 Insulin fructotransferase; right-handed parallel b 89.16
1xg2_A317 Pectinesterase 1; protein-protein complex, beta he 87.54
1gq8_A319 Pectinesterase; hydrolase, carboxylic ester hydrol 87.4
>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 Back     alignment and structure
Probab=100.00  E-value=4.5e-36  Score=258.37  Aligned_cols=148  Identities=28%  Similarity=0.390  Sum_probs=131.0

Q ss_pred             cEEEEeeEEeCCCCceEEEe--------EEEEEcCCCCCCCCeEEecceecEEEEeeEEecCCceEEecC-----CCeeE
Q 047599            2 HGSITYITSRDSKNFHFNTF--------KINIQAPENSPHTDGIHIANSNNIQILNSEISTGDDCASMDP-----GSQNV   68 (165)
Q Consensus         2 nv~i~gitl~nsp~w~i~i~--------~v~I~~~~~~~NtDGidi~~s~nV~I~n~~i~~gDDcIaiks-----~s~nI   68 (165)
                      |++|+||+|+|||+||+++.        +++|.+|..+|||||||+++|++|+|+||+|++||||||+|+     +++||
T Consensus       161 nv~I~~iti~nsp~~~i~~~~~~~v~i~~v~I~~~~~~~NtDGid~~~s~nV~I~n~~i~~gDDcIaiks~~~~~~s~nI  240 (376)
T 1bhe_A          161 NFTLYNVSLINSPNFHVVFSDGDGFTAWKTTIKTPSTARNTDGIDPMSSKNITIAYSNIATGDDNVAIKAYKGRAETRNI  240 (376)
T ss_dssp             EEEEEEEEEECCSSCSEEEESCEEEEEEEEEEECCTTCSSCCSEEEESCEEEEEESCEEECSSCSEEEEECTTSCCEEEE
T ss_pred             EEEEEeEEEECCCcEEEEEeCCCcEEEEeEEEECCCCCCCCceEeecCCceEEEEeCEEecCCCeEEEcccCCCCCceEE
Confidence            78999999999999998774        388899988899999999999999999999999999999996     79999


Q ss_pred             EEEeCeEEcCCCcceEEEeecCCCCCCCCeeeEEEEeeEEeCCCCC----------c-----------------------
Q 047599           69 NISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNG----------G-----------------------  115 (165)
Q Consensus        69 ~i~~n~~~~~g~~hGisiGS~g~~~~~~~v~nV~v~n~~~~~t~~g----------G-----------------------  115 (165)
                      +|+ ||+|+++  |||+||||    +. +|+||+|+||+|.++.+|          |                       
T Consensus       241 ~I~-n~~~~~g--hGisiGSe----~~-~v~nV~v~n~~~~~t~~GirIKt~~g~~G~v~ni~f~ni~~~~v~~~i~i~~  312 (376)
T 1bhe_A          241 SIL-HNDFGTG--HGMSIGSE----TM-GVYNVTVDDLKMNGTTNGLRIKSDKSAAGVVNGVRYSNVVMKNVAKPIVIDT  312 (376)
T ss_dssp             EEE-EEEECSS--SCEEEEEE----ES-SEEEEEEEEEEEESCSEEEEEECCTTTCCEEEEEEEEEEEEESCSEEEEEET
T ss_pred             EEE-eeEEEcc--ccEEeccC----Cc-cEeeEEEEeeEEeCCCcEEEEEEecCCCceEeeEEEEeEEEeCCCceEEEEe
Confidence            999 9999999  99999999    44 899999999999998876          0                       


Q ss_pred             ---------------------ccCccceEEEEcCCCCCeEeEEEEeEEEEecCCCCCCcCceeeEeeEec
Q 047599          116 ---------------------TSSTKVAVDLQCSKVKPRDKIELRDIDMACHGAGGGQAAVSNYSNVHGV  164 (165)
Q Consensus       116 ---------------------t~~~~~a~~l~c~~~~pc~~i~~~dv~l~~~~~~~~~~~~~~C~nv~g~  164 (165)
                                           +.....++.|.|+++.||++|+|+||+|.+..       .|.|.|++.+
T Consensus       313 ~y~~~~~~~~~~i~ni~~~ni~gt~~~~~~l~g~~~~~~~~I~l~nv~l~~~~-------~~~~~~~~~~  375 (376)
T 1bhe_A          313 VYEKKEGSNVPDWSDITFKDVTSETKGVVVLNGENAKKPIEVTMKNVKLTSDS-------TWQIKNVNVK  375 (376)
T ss_dssp             TSSCCCCCCCCEEEEEEEEEEEECSCCEEEEECTTCSSCEEEEEEEEECCTTC-------EEEEESEEEE
T ss_pred             eccCCCCCcCcEEEEEEEEEEEEEecceEEEEeCCCCCeeeEEEEeEEEecCC-------CceEEEEEec
Confidence                                 01123478999999999999999999998753       3999999864
>1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A* Back     alignment and structure
>1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3 Back     alignment and structure
>2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini} Back     alignment and structure
>1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 Back     alignment and structure
>1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A* Back     alignment and structure
>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>1x0c_A Isopullulanase; glycoside hydrolase family 49, glycoprotein, hydro; HET: NAG; 1.70A {Aspergillus niger} PDB: 1wmr_A* 2z8g_A* Back     alignment and structure
>1ogo_X Dextranase; hydrolase, dextran degradation, glycosidase; HET: BGC GLC; 1.65A {Penicillium minioluteum} SCOP: b.133.1.1 b.80.1.10 PDB: 1ogm_X* Back     alignment and structure
>2x6w_A Tail spike protein; viral protein, beta-helix, hydrolase; HET: RAM GLC GLA NAG NDG; 1.35A {Enterobacteria phage HK620} PDB: 2vji_A 2vjj_A* 2x85_A* 2x6x_A* 2x6y_A* Back     alignment and structure
>3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A Back     alignment and structure
>1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A Back     alignment and structure
>2vbk_A Tailspike-protein; viral adhesion protein, viral protein, hydrolase, endorhamnosidase, right-handed parallel beta-helix; 1.25A {Enterobacteria phage SF6} PDB: 2vbe_A 2vbm_A* Back     alignment and structure
>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A Back     alignment and structure
>1x0c_A Isopullulanase; glycoside hydrolase family 49, glycoprotein, hydro; HET: NAG; 1.70A {Aspergillus niger} PDB: 1wmr_A* 2z8g_A* Back     alignment and structure
>1ogo_X Dextranase; hydrolase, dextran degradation, glycosidase; HET: BGC GLC; 1.65A {Penicillium minioluteum} SCOP: b.133.1.1 b.80.1.10 PDB: 1ogm_X* Back     alignment and structure
>2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini} Back     alignment and structure
>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} Back     alignment and structure
>1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 Back     alignment and structure
>1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3 Back     alignment and structure
>1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A* Back     alignment and structure
>1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A* Back     alignment and structure
>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 Back     alignment and structure
>1pcl_A Pectate lyase E; lyase (acting on polysaccharides); 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 Back     alignment and structure
>2o04_A Pectate lyase, PL; hexasaccharide compound II, calciums; HET: ADA; 1.70A {Bacillus subtilis} PDB: 2nzm_A* 2o0v_A* 2o0w_A 2o17_A* 2o1d_A* 2bsp_A 1bn8_A 3krg_A* Back     alignment and structure
>1vbl_A Pectate lyase 47; PL 47, thermostable, bacillus subtilis, pectin, calcium ION; 1.91A {Bacillus SP} Back     alignment and structure
>1pxz_A Major pollen allergen JUN A 1; parallel beta-helix, cedar pollen; 1.70A {Juniperus ashei} SCOP: b.80.1.1 Back     alignment and structure
>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* Back     alignment and structure
>3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A Back     alignment and structure
>1air_A Pectate lyase C, PELC; pectate cleavage, pectinolyitc activity, trans-elimination; 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1o88_A 1o8d_A 1o8e_A 1o8f_A 1o8g_A 1o8h_A 1o8i_A 1o8j_A 1o8k_A 1o8l_A 1o8m_A 1plu_A 2pec_A 2ewe_A* Back     alignment and structure
>3vmv_A Pectate lyase; polysaccharide lyase family 1, beta-helix, pectolytic, polygalacturonate; 1.54A {Bacillus} PDB: 3vmw_A* Back     alignment and structure
>3zsc_A Pectate trisaccharide-lyase; hydrolase; HET: ADA AQA; 1.94A {Thermotoga maritima} Back     alignment and structure
>1pe9_A Pectate lyase A; parallel beta helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1ooc_A 1jta_A 1jrg_A Back     alignment and structure
>2x6w_A Tail spike protein; viral protein, beta-helix, hydrolase; HET: RAM GLC GLA NAG NDG; 1.35A {Enterobacteria phage HK620} PDB: 2vji_A 2vjj_A* 2x85_A* 2x6x_A* 2x6y_A* Back     alignment and structure
>2qy1_A Pectate lyase II; GAG lyase; 1.90A {Xanthomonas campestris PV} PDB: 2qxz_A 2qx3_A Back     alignment and structure
>1idk_A Pectin lyase A; signal, glycoprotein, multigene family; 1.93A {Aspergillus niger} SCOP: b.80.1.2 PDB: 1idj_A Back     alignment and structure
>3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A* Back     alignment and structure
>3zsc_A Pectate trisaccharide-lyase; hydrolase; HET: ADA AQA; 1.94A {Thermotoga maritima} Back     alignment and structure
>1qcx_A Pectin lyase B; beta-helix protein, plant cell WALL; 1.70A {Aspergillus niger} SCOP: b.80.1.2 Back     alignment and structure
>1idk_A Pectin lyase A; signal, glycoprotein, multigene family; 1.93A {Aspergillus niger} SCOP: b.80.1.2 PDB: 1idj_A Back     alignment and structure
>3vmv_A Pectate lyase; polysaccharide lyase family 1, beta-helix, pectolytic, polygalacturonate; 1.54A {Bacillus} PDB: 3vmw_A* Back     alignment and structure
>1qcx_A Pectin lyase B; beta-helix protein, plant cell WALL; 1.70A {Aspergillus niger} SCOP: b.80.1.2 Back     alignment and structure
>3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A* Back     alignment and structure
>1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 Back     alignment and structure
>1pxz_A Major pollen allergen JUN A 1; parallel beta-helix, cedar pollen; 1.70A {Juniperus ashei} SCOP: b.80.1.1 Back     alignment and structure
>1pe9_A Pectate lyase A; parallel beta helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1ooc_A 1jta_A 1jrg_A Back     alignment and structure
>2qy1_A Pectate lyase II; GAG lyase; 1.90A {Xanthomonas campestris PV} PDB: 2qxz_A 2qx3_A Back     alignment and structure
>1pcl_A Pectate lyase E; lyase (acting on polysaccharides); 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 Back     alignment and structure
>1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 Back     alignment and structure
>1air_A Pectate lyase C, PELC; pectate cleavage, pectinolyitc activity, trans-elimination; 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1o88_A 1o8d_A 1o8e_A 1o8f_A 1o8g_A 1o8h_A 1o8i_A 1o8j_A 1o8k_A 1o8l_A 1o8m_A 1plu_A 2pec_A 2ewe_A* Back     alignment and structure
>1vbl_A Pectate lyase 47; PL 47, thermostable, bacillus subtilis, pectin, calcium ION; 1.91A {Bacillus SP} Back     alignment and structure
>2o04_A Pectate lyase, PL; hexasaccharide compound II, calciums; HET: ADA; 1.70A {Bacillus subtilis} PDB: 2nzm_A* 2o0v_A* 2o0w_A 2o17_A* 2o1d_A* 2bsp_A 1bn8_A 3krg_A* Back     alignment and structure
>2inu_A Insulin fructotransferase; right-handed parallel beta-helix, lyase; 1.80A {Bacillus SP} PDB: 2inv_A* Back     alignment and structure
>1xg2_A Pectinesterase 1; protein-protein complex, beta helix,four helix bundle, hydrolase/hydrolase inhibitor complex; 1.90A {Solanum lycopersicum} Back     alignment and structure
>1gq8_A Pectinesterase; hydrolase, carboxylic ester hydrolase; 1.75A {Daucus carota} SCOP: b.80.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 165
d1ogmx2373 b.80.1.10 (X:202-574) Dextranase, catalytic domain 1e-09
d1ia5a_339 b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergill 1e-08
d1k5ca_333 b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum p 3e-08
d1czfa_335 b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergill 1e-07
d1bhea_376 b.80.1.3 (A:) Polygalacturonase {Erwinia carotovor 2e-06
d1rmga_ 422 b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus a 3e-06
d1nhca_336 b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergill 3e-05
d1hg8a_349 b.80.1.3 (A:) Polygalacturonase {Fusarium monilifo 6e-05
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Length = 373 Back     information, alignment and structure

class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pectin lyase-like
family: Dextranase, catalytic domain
domain: Dextranase, catalytic domain
species: Penicillium minioluteum [TaxId: 28574]

 Score = 53.9 bits (129), Expect = 1e-09
 Identities = 15/131 (11%), Positives = 28/131 (21%), Gaps = 13/131 (9%)

Query: 2   HGSITYITSRDSKNFHFNTFKIN---------IQAPENSPHTDGIHIANSNNIQILNSEI 52
                  T         +    +          Q       TDG  I    N  + +   
Sbjct: 133 TWYCVGPTINAPPFNTMDFNGNSGISSQISDYKQVGAFFFQTDGPEI--YPNSVVHDVFW 190

Query: 53  STGDDCASMDPGSQNVNISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTS 112
              DD   +       ++S        N   I +       +      + V +     + 
Sbjct: 191 HVNDDAIKI--YYSGASVSRATIWKCHNDPIIQMGWTSRDISGVTIDTLNVIHTRYIKSE 248

Query: 113 NGGTSSTKVAV 123
               S+   A 
Sbjct: 249 TVVPSAIIGAS 259
>d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Length = 339 Back     information, alignment and structure
>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]} Length = 333 Back     information, alignment and structure
>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]} Length = 335 Back     information, alignment and structure
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Length = 376 Back     information, alignment and structure
>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} Length = 422 Back     information, alignment and structure
>d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]} Length = 336 Back     information, alignment and structure
>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]} Length = 349 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
d1ia5a_339 Polygalacturonase {Fungus (Aspergillus aculeatus) 100.0
d1rmga_422 Rhamnogalacturonase A {Aspergillus aculeatus [TaxI 100.0
d1czfa_335 Polygalacturonase {Fungus (Aspergillus niger), end 100.0
d1nhca_336 Polygalacturonase {Fungus (Aspergillus niger), end 100.0
d1hg8a_349 Polygalacturonase {Fusarium moniliforme [TaxId: 11 100.0
d1bhea_376 Polygalacturonase {Erwinia carotovora, subsp. caro 99.98
d1k5ca_333 Polygalacturonase {Fungus (Stereum purpureum), end 99.97
d1ogmx2373 Dextranase, catalytic domain {Penicillium miniolut 99.91
d1hg8a_349 Polygalacturonase {Fusarium moniliforme [TaxId: 11 98.4
d1bhea_376 Polygalacturonase {Erwinia carotovora, subsp. caro 98.26
d1ia5a_339 Polygalacturonase {Fungus (Aspergillus aculeatus) 98.13
d1czfa_335 Polygalacturonase {Fungus (Aspergillus niger), end 98.09
d1nhca_336 Polygalacturonase {Fungus (Aspergillus niger), end 98.09
d1o88a_353 Pectate lyase {Erwinia chrysanthemi, type C [TaxId 98.07
d1k5ca_333 Polygalacturonase {Fungus (Stereum purpureum), end 97.95
d1rmga_ 422 Rhamnogalacturonase A {Aspergillus aculeatus [TaxI 97.72
d1pxza_346 Major pollen allergen Jun a 1 {Ozark white cedar ( 97.7
d1ogmx2 373 Dextranase, catalytic domain {Penicillium miniolut 97.38
d1bn8a_399 Pectate lyase {Bacillus subtilis [TaxId: 1423]} 96.87
d1qcxa_359 Pectin lyase {Aspergillus niger, type B [TaxId: 50 96.87
d1idka_359 Pectin lyase {Aspergillus niger, type A [TaxId: 50 96.81
d1pcla_355 Pectate lyase {Erwinia chrysanthemi, type E [TaxId 96.61
d1pe9a_361 Pectate lyase {Erwinia chrysanthemi, type A [TaxId 96.41
d1idka_ 359 Pectin lyase {Aspergillus niger, type A [TaxId: 50 95.84
d1qcxa_ 359 Pectin lyase {Aspergillus niger, type B [TaxId: 50 95.49
d1pxza_346 Major pollen allergen Jun a 1 {Ozark white cedar ( 95.03
d1o88a_ 353 Pectate lyase {Erwinia chrysanthemi, type C [TaxId 94.47
d1pcla_ 355 Pectate lyase {Erwinia chrysanthemi, type E [TaxId 94.05
d1pe9a_ 361 Pectate lyase {Erwinia chrysanthemi, type A [TaxId 93.73
d1bn8a_399 Pectate lyase {Bacillus subtilis [TaxId: 1423]} 93.52
>d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pectin lyase-like
family: Galacturonase
domain: Polygalacturonase
species: Fungus (Aspergillus aculeatus) [TaxId: 5053]

Probab=100.00  E-value=2.4e-37  Score=262.15  Aligned_cols=152  Identities=20%  Similarity=0.295  Sum_probs=133.7

Q ss_pred             cEEEEeeEEeCCCCceEEEeE--------EEEEcCC----CCCCCCeEEecceecEEEEeeEEecCCceEEecCCCeeEE
Q 047599            2 HGSITYITSRDSKNFHFNTFK--------INIQAPE----NSPHTDGIHIANSNNIQILNSEISTGDDCASMDPGSQNVN   69 (165)
Q Consensus         2 nv~i~gitl~nsp~w~i~i~~--------v~I~~~~----~~~NtDGidi~~s~nV~I~n~~i~~gDDcIaiks~s~nI~   69 (165)
                      |++|+||+|+|||+|++++.+        |+|.++.    .+|||||||+++|+||+|+||+|++||||||+|++ +||+
T Consensus       114 nv~i~gitl~nsp~w~~~~~~s~nv~i~~v~I~~~~~~~~~~~NtDGidi~~s~nV~I~n~~i~~gDDcIaiks~-~ni~  192 (339)
T d1ia5a_         114 NSVISGLKIVNSPVQVFSVAGSDYLTLKDITIDNSDGDDNGGHNTDAFDIGTSTYVTISGATVYNQDDCVAVNSG-ENIY  192 (339)
T ss_dssp             EEEEESCEEECCSSCCEEEESCEEEEEESCEEECGGGTTTTCCSCCSEEEESCEEEEEESCEEECSSCSEEESSE-EEEE
T ss_pred             CCEEeceEEEcCCceEEEEecccEEEEEEEEEecccCCccCCCCCCccccCCCCeEEEeeeEEEcCCCeEEecCc-cEEE
Confidence            789999999999999998854        7777763    45899999999999999999999999999999996 6999


Q ss_pred             EEeCeEEcCCCcceEEEeecCCCCCCCCeeeEEEEeeEEeCCCCC-----------------------------------
Q 047599           70 ISSNVKIWPSNVESISIRSLGGTPNEKEAREITVQNCNLKGTSNG-----------------------------------  114 (165)
Q Consensus        70 i~~n~~~~~g~~hGisiGS~g~~~~~~~v~nV~v~n~~~~~t~~g-----------------------------------  114 (165)
                      |+ |++|+++  ||++|||+|++ +.+.|+||+|+||+|.++.+|                                   
T Consensus       193 i~-n~~c~~g--hG~sigslG~~-~~~~v~nV~v~n~~~~~t~~GirIKt~~g~~G~v~nV~f~ni~~~~v~~~pI~I~~  268 (339)
T d1ia5a_         193 FS-GGYCSGG--HGLSIGSVGGR-SDNTVKNVTFVDSTIINSDNGVRIKTNIDTTGSVSDVTYKDITLTSIAKYGIVVQQ  268 (339)
T ss_dssp             EE-SCEEESS--SCEEEEEECSS-SCCEEEEEEEEEEEEESCSEEEEEEEETTCCCEEEEEEEEEEEEEEESSEEEEEEE
T ss_pred             EE-EeEEecc--ccceecccccC-ccccEEEEEEECCcccCCcceeEEeeeCCCCEEEEEEEEEEEEEeccccccEEEEe
Confidence            99 9999999  99999999876 457899999999999999876                                   


Q ss_pred             ------------------------cccCccceEEEEcCCCCCeEeEEEEeEEEEecCCCCCCcCceeeEeeEec
Q 047599          115 ------------------------GTSSTKVAVDLQCSKVKPRDKIELRDIDMACHGAGGGQAAVSNYSNVHGV  164 (165)
Q Consensus       115 ------------------------Gt~~~~~a~~l~c~~~~pc~~i~~~dv~l~~~~~~~~~~~~~~C~nv~g~  164 (165)
                                              |+...+.+..+.|++..||+||+|+||+|...      ++.+.|.||+|.
T Consensus       269 ~Y~~~~~~~~~~v~i~nI~~~Ni~gt~~~~~~~~~~~~~~~p~~ni~~~nV~itg~------~~~~~C~nv~~~  336 (339)
T d1ia5a_         269 NYGDTSSTPTTGVPITDFVLDNVHGSVVSSGTNILISCGSGSCSDWTWTDVSVSGG------KTSSKCTNVPSG  336 (339)
T ss_dssp             EETCTTSCCCSSSCEEEEEEEEEEEEECTTSEEEEEECCTTCEEEEEEEEEEEESS------BCCSCCBSCCTT
T ss_pred             ecCCCCCCCCCCcEEEeEEEEeEEEEecccCceEEEeCCCCCEeceEEEeEEEcCC------CcceEeECCCcc
Confidence                                    33455778889999999999999999999732      456889999875
>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]} Back     information, alignment and structure
>d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]} Back     information, alignment and structure
>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]} Back     information, alignment and structure
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Back     information, alignment and structure
>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]} Back     information, alignment and structure
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Back     information, alignment and structure
>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]} Back     information, alignment and structure
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Back     information, alignment and structure
>d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]} Back     information, alignment and structure
>d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]} Back     information, alignment and structure
>d1o88a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C [TaxId: 556]} Back     information, alignment and structure
>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]} Back     information, alignment and structure
>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
>d1pxza_ b.80.1.1 (A:) Major pollen allergen Jun a 1 {Ozark white cedar (Juniperus ashei) [TaxId: 13101]} Back     information, alignment and structure
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Back     information, alignment and structure
>d1bn8a_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]} Back     information, alignment and structure
>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]} Back     information, alignment and structure
>d1pcla_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type E [TaxId: 556]} Back     information, alignment and structure
>d1pe9a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]} Back     information, alignment and structure
>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]} Back     information, alignment and structure
>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]} Back     information, alignment and structure
>d1pxza_ b.80.1.1 (A:) Major pollen allergen Jun a 1 {Ozark white cedar (Juniperus ashei) [TaxId: 13101]} Back     information, alignment and structure
>d1o88a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C [TaxId: 556]} Back     information, alignment and structure
>d1pcla_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type E [TaxId: 556]} Back     information, alignment and structure
>d1pe9a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]} Back     information, alignment and structure
>d1bn8a_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure