Citrus Sinensis ID: 047603
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 259 | ||||||
| 225457321 | 223 | PREDICTED: uncharacterized protein LOC10 | 0.772 | 0.896 | 0.358 | 3e-22 | |
| 359491690 | 238 | PREDICTED: uncharacterized protein LOC10 | 0.853 | 0.928 | 0.330 | 1e-16 | |
| 351703677 | 595 | Zinc finger RNA-binding protein 2 [Heter | 0.413 | 0.179 | 0.290 | 1e-08 | |
| 226500844 | 323 | uncharacterized protein LOC100277679 [Ze | 0.413 | 0.331 | 0.290 | 1e-06 | |
| 384250223 | 1114 | hypothetical protein COCSUDRAFT_66058 [C | 0.474 | 0.110 | 0.282 | 2e-06 | |
| 357495437 | 532 | Zinc finger RNA-binding protein [Medicag | 0.328 | 0.159 | 0.346 | 3e-06 | |
| 388521031 | 532 | unknown [Medicago truncatula] | 0.328 | 0.159 | 0.346 | 3e-06 | |
| 242096554 | 601 | hypothetical protein SORBIDRAFT_10g02579 | 0.567 | 0.244 | 0.276 | 3e-06 | |
| 359494712 | 824 | PREDICTED: uncharacterized protein LOC10 | 0.378 | 0.118 | 0.262 | 5e-06 | |
| 125605735 | 341 | hypothetical protein OsJ_29403 [Oryza sa | 0.440 | 0.334 | 0.305 | 8e-06 |
| >gi|225457321|ref|XP_002284718.1| PREDICTED: uncharacterized protein LOC100250232 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 111 bits (278), Expect = 3e-22, Method: Compositional matrix adjust.
Identities = 86/240 (35%), Positives = 121/240 (50%), Gaps = 40/240 (16%)
Query: 10 SRGRMITAELAILRELAFRRKVFLLRSQHDDGLEKKEKGLAPLQERPTPQSSLCMSPSQI 69
RG ++ ELA+ RELA+R+KV L Q G+ ++ + +
Sbjct: 4 GRGEVMPLELAMKRELAYRKKVDRLLLQLHGGVSRE---------------------NPV 42
Query: 70 PGPSPPSSSSPRLSGMKRPTPTSTADAECSSPELPESLDSHPEHAIQADSNFCSICHVPC 129
P SP SS + SG+KR PTS+ + C ++ + +D Q D FC +C VPC
Sbjct: 43 PSSSPRPSSGSKFSGIKRKAPTSSFN--CQPRQMLQPVDHSNTLKTQRDDLFCKVCQVPC 100
Query: 130 SSAFNYNQHLKGRKHKAKLQELKLDGNSLVKMSLVKVGEKQ-TWCRLCNIGFSSEELFRL 188
S A + QHL G+KHK +LQ L M + + G KQ WC LC I ++ F+
Sbjct: 101 SGANSLKQHLLGQKHKDRLQNLT------PSMGIGEEGAKQRLWCELCKIWCMNKNSFKD 154
Query: 189 HLNAKKHKALQRAKCTLKG--GGE-----QKWCKLCDVWCPNGDAFKMHLDGKNHILRLY 241
HL KKH++ +A L G GGE K+CK+C +WC DAF HL+ K HIL L+
Sbjct: 155 HLKGKKHQSRAQA-VELHGTDGGEIANQMNKYCKVCKIWCM--DAFNQHLESKRHILNLH 211
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359491690|ref|XP_003634307.1| PREDICTED: uncharacterized protein LOC100853199 [Vitis vinifera] gi|297733926|emb|CBI15173.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351703677|gb|EHB06596.1| Zinc finger RNA-binding protein 2 [Heterocephalus glaber] | Back alignment and taxonomy information |
|---|
| >gi|226500844|ref|NP_001144654.1| uncharacterized protein LOC100277679 [Zea mays] gi|195645234|gb|ACG42085.1| hypothetical protein [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|384250223|gb|EIE23703.1| hypothetical protein COCSUDRAFT_66058 [Coccomyxa subellipsoidea C-169] | Back alignment and taxonomy information |
|---|
| >gi|357495437|ref|XP_003618007.1| Zinc finger RNA-binding protein [Medicago truncatula] gi|355519342|gb|AET00966.1| Zinc finger RNA-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388521031|gb|AFK48577.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|242096554|ref|XP_002438767.1| hypothetical protein SORBIDRAFT_10g025790 [Sorghum bicolor] gi|241916990|gb|EER90134.1| hypothetical protein SORBIDRAFT_10g025790 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|359494712|ref|XP_003634825.1| PREDICTED: uncharacterized protein LOC100853636 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|125605735|gb|EAZ44771.1| hypothetical protein OsJ_29403 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 259 | ||||||
| UNIPROTKB|Q96KR1 | 1074 | ZFR "Zinc finger RNA-binding p | 0.297 | 0.071 | 0.285 | 7.1e-08 | |
| UNIPROTKB|F1NLI6 | 1075 | LOC427010 "Uncharacterized pro | 0.297 | 0.071 | 0.272 | 1.2e-07 | |
| UNIPROTKB|J9NWA2 | 981 | ZFR "Uncharacterized protein" | 0.297 | 0.078 | 0.272 | 1.3e-07 | |
| UNIPROTKB|F1N0Y9 | 1030 | ZFR "Uncharacterized protein" | 0.297 | 0.074 | 0.272 | 1.5e-07 | |
| UNIPROTKB|E2R6T6 | 1073 | ZFR "Uncharacterized protein" | 0.297 | 0.071 | 0.272 | 1.8e-07 | |
| MGI|MGI:1341890 | 1074 | Zfr "zinc finger RNA binding p | 0.297 | 0.071 | 0.272 | 1.8e-07 | |
| UNIPROTKB|F6XZ19 | 1076 | ZFR "Uncharacterized protein" | 0.297 | 0.071 | 0.272 | 1.8e-07 | |
| UNIPROTKB|F1N855 | 1025 | LOC427010 "Uncharacterized pro | 0.297 | 0.075 | 0.272 | 3.6e-07 | |
| ZFIN|ZDB-GENE-030131-378 | 1074 | zfr "zinc finger RNA binding p | 0.297 | 0.071 | 0.275 | 2.1e-06 | |
| ZFIN|ZDB-GENE-070209-152 | 301 | znf346 "zinc finger protein 34 | 0.355 | 0.305 | 0.33 | 1.5e-05 |
| UNIPROTKB|Q96KR1 ZFR "Zinc finger RNA-binding protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 136 (52.9 bits), Expect = 7.1e-08, Sum P(3) = 7.1e-08
Identities = 22/77 (28%), Positives = 40/77 (51%)
Query: 120 NFCSICHVPCSSAFNYNQHLKGRKHKAKLQELKLDGNSLVKMSLVKVGEKQTWCRLCNIG 179
++C +C + C+ Y +HL+G+KHK K LK N+ S + + Q C LC++
Sbjct: 331 HYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTSSSNSSTRGTQNQLRCELCDVS 390
Query: 180 FSSEELFRLHLNAKKHK 196
+ + + H+ KH+
Sbjct: 391 CTGADAYAAHIRGAKHQ 407
|
|
| UNIPROTKB|F1NLI6 LOC427010 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NWA2 ZFR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N0Y9 ZFR "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R6T6 ZFR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1341890 Zfr "zinc finger RNA binding protein" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XZ19 ZFR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N855 LOC427010 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-378 zfr "zinc finger RNA binding protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070209-152 znf346 "zinc finger protein 346" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 259 | |||
| smart00451 | 35 | smart00451, ZnF_U1, U1-like zinc finger | 1e-05 | |
| pfam12874 | 25 | pfam12874, zf-met, Zinc-finger of C2H2 type | 2e-04 | |
| pfam12874 | 25 | pfam12874, zf-met, Zinc-finger of C2H2 type | 3e-04 | |
| smart00451 | 35 | smart00451, ZnF_U1, U1-like zinc finger | 6e-04 | |
| pfam12171 | 27 | pfam12171, zf-C2H2_jaz, Zinc-finger double-strande | 0.002 |
| >gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger | Back alignment and domain information |
|---|
Score = 41.1 bits (97), Expect = 1e-05
Identities = 10/31 (32%), Positives = 19/31 (61%)
Query: 121 FCSICHVPCSSAFNYNQHLKGRKHKAKLQEL 151
+C +C+V + + HLKG+KHK +++
Sbjct: 5 YCKLCNVTFTDEISVEAHLKGKKHKKNVKKR 35
|
Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins. Length = 35 |
| >gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type | Back alignment and domain information |
|---|
| >gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type | Back alignment and domain information |
|---|
| >gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 259 | |||
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 98.61 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 98.57 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 98.42 | |
| KOG3792 | 816 | consensus Transcription factor NFAT, subunit NF90 | 98.39 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 98.37 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 98.28 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 97.94 | |
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 97.67 | |
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 97.63 | |
| KOG4727 | 193 | consensus U1-like Zn-finger protein [General funct | 97.6 | |
| KOG2785 | 390 | consensus C2H2-type Zn-finger protein [General fun | 97.45 | |
| KOG4727 | 193 | consensus U1-like Zn-finger protein [General funct | 96.82 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 96.8 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 96.54 | |
| KOG3408 | 129 | consensus U1-like Zn-finger-containing protein, pr | 96.52 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 96.44 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 96.36 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 96.3 | |
| PF14968 | 336 | CCDC84: Coiled coil protein 84 | 96.23 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 96.18 | |
| KOG2785 | 390 | consensus C2H2-type Zn-finger protein [General fun | 96.05 | |
| PF14968 | 336 | CCDC84: Coiled coil protein 84 | 95.9 | |
| KOG3792 | 816 | consensus Transcription factor NFAT, subunit NF90 | 95.88 | |
| KOG3454 | 165 | consensus U1 snRNP-specific protein C [RNA process | 95.69 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 95.4 | |
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 95.25 | |
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 95.2 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 94.66 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 94.61 | |
| KOG0227 | 222 | consensus Splicing factor 3a, subunit 2 [RNA proce | 94.47 | |
| COG5188 | 470 | PRP9 Splicing factor 3a, subunit 3 [RNA processing | 94.36 | |
| KOG3408 | 129 | consensus U1-like Zn-finger-containing protein, pr | 94.28 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 94.15 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 94.02 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 93.92 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 93.52 | |
| KOG0150 | 336 | consensus Spliceosomal protein FBP21 [RNA processi | 93.5 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 93.48 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 93.3 | |
| KOG4722 | 672 | consensus Zn-finger protein [General function pred | 93.21 | |
| PF04988 | 165 | AKAP95: A-kinase anchoring protein 95 (AKAP95); In | 93.16 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 93.08 | |
| PHA00733 | 128 | hypothetical protein | 93.04 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 93.03 | |
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 92.91 | |
| KOG3032 | 264 | consensus Uncharacterized conserved protein [Funct | 92.75 | |
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 92.67 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 92.57 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 92.43 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 92.33 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 92.31 | |
| COG5112 | 126 | UFD2 U1-like Zn-finger-containing protein [General | 91.65 | |
| COG5112 | 126 | UFD2 U1-like Zn-finger-containing protein [General | 91.43 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 91.14 | |
| COG5188 | 470 | PRP9 Splicing factor 3a, subunit 3 [RNA processing | 90.26 | |
| COG5246 | 222 | PRP11 Splicing factor 3a, subunit 2 [RNA processin | 90.21 | |
| KOG4722 | 672 | consensus Zn-finger protein [General function pred | 90.02 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 89.57 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 88.72 | |
| KOG0227 | 222 | consensus Splicing factor 3a, subunit 2 [RNA proce | 88.49 | |
| KOG3454 | 165 | consensus U1 snRNP-specific protein C [RNA process | 88.01 | |
| PF04988 | 165 | AKAP95: A-kinase anchoring protein 95 (AKAP95); In | 87.71 | |
| KOG0150 | 336 | consensus Spliceosomal protein FBP21 [RNA processi | 87.31 | |
| KOG3032 | 264 | consensus Uncharacterized conserved protein [Funct | 87.1 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 87.07 | |
| COG5136 | 188 | U1 snRNP-specific protein C [RNA processing and mo | 86.45 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 85.29 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 84.32 | |
| COG5246 | 222 | PRP11 Splicing factor 3a, subunit 2 [RNA processin | 83.55 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 83.38 | |
| PHA00732 | 79 | hypothetical protein | 81.12 |
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
Probab=98.61 E-value=2.6e-08 Score=63.15 Aligned_cols=33 Identities=30% Similarity=0.546 Sum_probs=30.5
Q ss_pred CcccCCccccccCCHHHHHHhhcchHHHHHHHH
Q 047603 210 EQKWCKLCDVWCPNGDAFKMHLDGKNHILRLYE 242 (259)
Q Consensus 210 ~~~~C~lCnV~~~Se~~m~~HL~GkKH~~~lk~ 242 (259)
..|||++|++.|++...+.+|++|++|+.+++.
T Consensus 2 ~~~~C~~C~~~~~~~~~~~~H~~gk~H~~~~~~ 34 (35)
T smart00451 2 GGFYCKLCNVTFTDEISVEAHLKGKKHKKNVKK 34 (35)
T ss_pred cCeEccccCCccCCHHHHHHHHChHHHHHHHHc
Confidence 358999999999999999999999999999864
|
Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins. |
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4727 consensus U1-like Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4727 consensus U1-like Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF14968 CCDC84: Coiled coil protein 84 | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14968 CCDC84: Coiled coil protein 84 | Back alignment and domain information |
|---|
| >KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3454 consensus U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0227 consensus Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >KOG4722 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04988 AKAP95: A-kinase anchoring protein 95 (AKAP95); InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3032 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4722 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >KOG0227 consensus Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3454 consensus U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04988 AKAP95: A-kinase anchoring protein 95 (AKAP95); InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex | Back alignment and domain information |
|---|
| >KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3032 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >COG5136 U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 259 | |||
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 2e-10 |
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Length = 127 | Back alignment and structure |
|---|
Score = 56.5 bits (135), Expect = 2e-10
Identities = 21/118 (17%), Positives = 38/118 (32%), Gaps = 11/118 (9%)
Query: 96 AECSSPELPESLDSHP-EHAIQADSNFCSICHVPCSSAFNYNQHLKGRKHKAKL------ 148
P ++++S E++ C +C S H + RKH K+
Sbjct: 8 DALDLPVGKDAVNSLIRENSHIFSDTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAI 67
Query: 149 ----QELKLDGNSLVKMSLVKVGEKQTWCRLCNIGFSSEELFRLHLNAKKHKALQRAK 202
+ + ++ C +CN+ FSS + H K H R +
Sbjct: 68 NQGEDSVPAKKFKAAPAEISDGEDRSKCCPVCNMTFSSPVVAESHYIGKTHIKNLRLR 125
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 259 | |||
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 99.6 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 99.58 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 98.23 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 98.2 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 98.05 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 98.01 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 97.95 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 97.93 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 97.92 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 97.89 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 97.84 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 97.8 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 97.75 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 97.72 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 97.65 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 97.65 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 97.57 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 97.54 | |
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 97.5 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 97.45 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 97.45 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 97.44 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 97.43 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 97.37 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 97.36 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 97.36 | |
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 97.33 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 97.24 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 97.05 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 96.99 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 96.91 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 96.9 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 96.9 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 96.89 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 96.83 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 96.82 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 96.81 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 96.79 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 96.77 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 96.69 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 96.68 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 96.54 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 96.52 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 96.45 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 96.43 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 96.41 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 96.41 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 96.41 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 96.38 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 96.36 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 96.29 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 96.27 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 96.27 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 96.24 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 96.23 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 96.18 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 96.17 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 96.15 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 96.09 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 96.06 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 96.05 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 95.85 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 95.81 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 95.81 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 95.78 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 95.72 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 95.69 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 95.6 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 95.57 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 95.49 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 95.32 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 95.12 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 95.02 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 94.79 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 94.61 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 94.57 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 94.55 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 94.54 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 94.48 | |
| 4dgw_A | 402 | PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A | 94.32 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 94.3 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 94.3 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 94.22 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 93.88 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 93.67 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 93.28 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 93.17 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 93.08 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 92.73 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 92.55 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 92.41 | |
| 4dgw_A | 402 | PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A | 92.26 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 92.18 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 91.27 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 90.98 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 90.91 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 90.27 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 89.98 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 89.74 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 89.69 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.47 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.25 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 89.17 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 89.16 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 89.0 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.89 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 88.83 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.63 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.6 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 88.48 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 88.4 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 88.34 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 88.27 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.19 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 88.13 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.0 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.99 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 87.94 | |
| 2jvx_A | 28 | NF-kappa-B essential modulator; CCHC classical zin | 87.86 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 87.82 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 87.8 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.79 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 87.74 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 87.69 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.68 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 87.67 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 87.6 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.57 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.52 | |
| 4f9c_B | 144 | Protein DBF4 homolog A; Ser/Thr protein kinase, tr | 87.41 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.32 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 87.32 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.29 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.25 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.13 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 86.98 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 86.92 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.91 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 86.89 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 86.87 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.86 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 86.81 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.76 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.75 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 86.57 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.56 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 86.53 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.37 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.31 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.31 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 86.3 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.24 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 86.03 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 86.03 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 85.97 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 85.96 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 85.95 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 85.94 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 85.91 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 85.87 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 85.64 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 85.61 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 85.31 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 85.28 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 85.2 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 85.43 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 85.16 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 85.16 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 85.14 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 85.04 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 84.83 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 84.69 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 84.58 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 84.56 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.46 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.11 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.07 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 84.04 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 84.01 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.99 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 83.95 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 83.82 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 83.72 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 83.66 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 83.65 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 83.63 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 83.61 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 83.56 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 83.56 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.42 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 83.4 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 83.38 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 83.35 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 83.34 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 83.3 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 83.28 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 83.85 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 83.17 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 83.17 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 83.07 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.07 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 83.07 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 83.0 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 82.99 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 82.95 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 82.81 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 83.47 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 82.8 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 82.79 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 82.7 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 82.61 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 82.56 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 82.56 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 82.54 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 82.53 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.45 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 82.39 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 82.34 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 82.3 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 82.11 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 82.09 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 82.09 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 82.08 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.07 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 82.02 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 82.02 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 81.95 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 81.93 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 81.76 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 81.76 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 81.65 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.59 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 81.57 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 81.55 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 81.49 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 81.48 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 81.46 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.45 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 81.43 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 81.37 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 81.36 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 81.27 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.26 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 81.21 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 81.21 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.13 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.12 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 81.08 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.05 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 80.98 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.9 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.86 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.8 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 80.8 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 80.78 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 80.73 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 80.63 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 80.61 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.6 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 80.6 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.55 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 80.54 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.52 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 80.47 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 80.46 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 80.46 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 80.46 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 80.45 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 80.43 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 80.24 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 80.2 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.17 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.16 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 80.12 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.09 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.08 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 80.08 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 80.04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.01 |
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
Probab=99.60 E-value=1e-15 Score=123.93 Aligned_cols=76 Identities=26% Similarity=0.402 Sum_probs=64.6
Q ss_pred cccccccccCccCCHHHHHHHhchhhHHHHHHHhhhc--------------------cCCCCcccCCccccccCCHHHHH
Q 047603 169 KQTWCRLCNIGFSSEELFRLHLNAKKHKALQRAKCTL--------------------KGGGEQKWCKLCDVWCPNGDAFK 228 (259)
Q Consensus 169 ~~~~C~lCnv~~~S~~~l~sHl~GkKH~~~~k~~e~l--------------------~g~~~~~~C~lCnV~~~Se~~m~ 228 (259)
..++|.+|++.|+|..++..|+.|++|+.+++..... ......|||++|++.|+|+.++.
T Consensus 31 ~~~~C~~C~v~~~S~s~~~~H~~gkkH~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~~~ 110 (127)
T 1zu1_A 31 SDTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAINQGEDSVPAKKFKAAPAEISDGEDRSKCCPVCNMTFSSPVVAE 110 (127)
T ss_dssp CSSEETTTTEECCSHHHHHHHHHCHHHHHHHHHHHHHTTCCCCCSCCCCSCCSSCCSSCCCTTTEETTTTEECSSHHHHH
T ss_pred CCCcCcCCCCEeCCHHHHHHHHCcHHHHHHHHHHhcccCcccCCCCCccCCCccccccCCCCCeEcCCCCCEeCCHHHHH
Confidence 3578999999999999999999999999987643210 11244889999999999999999
Q ss_pred HhhcchHHHHHHHHHH
Q 047603 229 MHLDGKNHILRLYEIE 244 (259)
Q Consensus 229 ~HL~GkKH~~~lk~~~ 244 (259)
+|++|++|++++++++
T Consensus 111 ~H~~gk~H~~~~~~~~ 126 (127)
T 1zu1_A 111 SHYIGKTHIKNLRLRE 126 (127)
T ss_dssp HHHTSHHHHHHHHHHH
T ss_pred HHHCCHHHHHHHHHhc
Confidence 9999999999998874
|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 259 | ||||
| d1zr9a1 | 67 | g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 | 0.002 |
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: Zinc finger protein 593, ZNF593 species: Human (Homo sapiens) [TaxId: 9606]
Score = 33.9 bits (78), Expect = 0.002
Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 7/55 (12%)
Query: 208 GGEQKWCKLCDVWCPNGDAFKMHLDGKNHILRL-------YEIEKNRRAENLGSY 255
GG C C + + K H K+H RL Y E+ RA +GSY
Sbjct: 12 GGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSY 66
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 259 | |||
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 98.92 | |
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 98.55 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 98.41 | |
| d1zu1a1 | 72 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 97.96 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 97.74 | |
| d1zu1a1 | 72 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 97.21 | |
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 97.2 | |
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 96.96 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 96.49 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 95.62 | |
| d1fu9a_ | 36 | U-shaped transcription factor, different fingers { | 93.51 | |
| d1fu9a_ | 36 | U-shaped transcription factor, different fingers { | 93.08 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 92.81 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 92.42 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 92.34 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 91.73 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 91.03 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 89.29 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 89.24 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 88.9 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 87.62 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 87.54 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 87.1 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 86.63 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 86.5 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 86.01 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 85.62 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 85.37 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 83.94 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 83.86 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 83.71 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 83.13 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 82.88 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 82.68 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 81.82 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 81.32 |
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: dsRNA-binding protein ZFa (ZNF346, JAZ) species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Probab=98.92 E-value=4.9e-10 Score=75.91 Aligned_cols=31 Identities=26% Similarity=0.543 Sum_probs=29.3
Q ss_pred CCCCCCcccCCCHHHHHHHhcCCchHHHHHH
Q 047603 120 NFCSICHVPCSSAFNYNQHLKGRKHKAKLQE 150 (259)
Q Consensus 120 ~~C~lC~V~~tSe~~l~~Hl~GKKHkkk~~~ 150 (259)
.||.||+++|+|+.++++||.||+|+++++.
T Consensus 22 k~C~lCn~~Fns~~~AqsHY~GK~H~K~lk~ 52 (55)
T d1zu1a2 22 KCCPVCNMTFSSPVVAESHYIGKTHIKNLRL 52 (55)
T ss_dssp TEETTTTEECSSHHHHHHHHTSHHHHHHHHH
T ss_pred hhhhhhhcccCCHHHHHHHhhhhHHHHHHHH
Confidence 5799999999999999999999999999974
|
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|