Citrus Sinensis ID: 047625


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDKHHTGVFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK
ccccEEEcccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHccccHHHHHHHHccccccccEEEEcccccccccccccccccEEEccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccEEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEc
ccEEEEEEcccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHcHHHHHHHHHHHcccccccEEEEEccccccccccccccEEEEEEHHHHHHHHccccHHcccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHHcccccHHHHcccccccccccHHHHHHHHHHcccEEEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEc
MQVEQVLFmnggegdnsyaknsappreAILKAKPLLHESLFDlysngfpdcirftdmgcssgpnaflpTWQAIEALDTICSrlkhkppilhaflndlpgndfntlskSLPSFYERLKtekrnddfgscfigvapgslygrlfppcflnLVYSSFCLNWLSQVPkelvsecgipllnkrdvcvaktcspsnvhKAYLDQFESDFTSFLNFRWEELKIGGRMILNfigndkhhtGVFELMGMVLNDMVYEGLIeesklesfnypiyypcvEEVRQVIEREGSFNIHQLETSHISwsvgyenddkglefnkhARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK
MQVEQVLFmnggegdnsyaknSAPPREAILKAKPLLHESLFDLYSNGFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTekrnddfgsCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDKHHTGVFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK
MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDKHHTGVFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK
****************************ILKAKPLLHESLFDLYSNGFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDKHHTGVFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLI**
*Q*EQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYE*L******DDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDKHHTGVFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK
MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDKHHTGVFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK
*QVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDKHHTGVFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVG*******LEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDKHHTGVFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query368 2.2.26 [Sep-21-2011]
Q9AVK0372 7-methylxanthosine syntha N/A no 0.975 0.965 0.442 4e-80
A4GE69372 7-methylxanthosine syntha N/A no 0.975 0.965 0.442 6e-80
Q9AVL9385 Probable caffeine synthas N/A no 0.991 0.948 0.429 7e-80
Q9AVK1385 Probable caffeine synthas N/A no 0.991 0.948 0.434 9e-80
A4GE70384 3,7-dimethylxanthine N-me N/A no 0.989 0.947 0.424 3e-77
Q8H0D2384 3,7-dimethylxanthine N-me N/A no 0.986 0.945 0.428 5e-77
Q8H0D3384 Caffeine synthase 1 OS=Co N/A no 0.989 0.947 0.424 5e-77
Q8H0G0384 Theobromine synthase 2 OS N/A no 0.989 0.947 0.421 6e-74
Q9AVJ9378 Monomethylxanthine methyl N/A no 0.989 0.962 0.425 1e-73
Q84PP7384 Monomethylxanthine methyl N/A no 0.989 0.947 0.418 9e-73
>sp|Q9AVK0|XMT1_COFAR 7-methylxanthosine synthase 1 OS=Coffea arabica GN=XMT1 PE=1 SV=1 Back     alignment and function desciption
 Score =  298 bits (763), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 166/375 (44%), Positives = 229/375 (61%), Gaps = 16/375 (4%)

Query: 1   MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPD---CIRFTDM 57
           M++++VL MNGGEGD SYAKNSA  +  + K KP+L + + +L     P+   CI+  D+
Sbjct: 1   MELQEVLRMNGGEGDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADL 60

Query: 58  GCSSGPNAFLPTWQAIEALDTICSRLKHK--PPILHAFLNDLPGNDFNTLSKSLPSFYER 115
           GC+SGPN  L     ++++D +    K++   P +  FLNDL  NDFN++ K LPSFY +
Sbjct: 61  GCASGPNTLLTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLFPNDFNSVFKLLPSFYRK 120

Query: 116 LKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLL 175
           L+ E      GSC IG  PGS Y RLFP   ++ ++S +CL WLSQVP  LV+E GI   
Sbjct: 121 LEKE-NGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELGIST- 178

Query: 176 NKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFI--GNDKHHTG 233
           NK  +  +K  S   V KAYLDQF  DFT+FL    EEL   GRM+L  I  G +     
Sbjct: 179 NKGSIYSSKA-SRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARN 237

Query: 234 VFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISW 293
             +L+ M +ND+V EG +EE KL+SFN P+Y P  EEV+ ++E EGSF I  LET  + +
Sbjct: 238 AIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLY 297

Query: 294 SVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEM 353
             G+  DD      +H +A+ VA+++RAV E +LA+HFG AI+ D+FHRF    +  L +
Sbjct: 298 DAGFSIDD------EHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPL 351

Query: 354 GLGAHTVLFIYLIKK 368
           G G +  L I L KK
Sbjct: 352 GKGFYNNLIISLAKK 366




Involved in the biosynthesis of caffeine. Specific for xanthosine and could not use xanthosine 5'-monophosphate (XMP) as substrate. Catalyzes the 7-N-methylation activity of xanthosine, but does not have 1-N- or 3-N-methylation activity.
Coffea arabica (taxid: 13443)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 5EC: 8
>sp|A4GE69|XMT1_COFCA 7-methylxanthosine synthase 1 OS=Coffea canephora GN=XMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9AVL9|CS4_COFAR Probable caffeine synthase 4 OS=Coffea arabica GN=CS4 PE=2 SV=1 Back     alignment and function description
>sp|Q9AVK1|CS3_COFAR Probable caffeine synthase 3 OS=Coffea arabica GN=CS3 PE=2 SV=1 Back     alignment and function description
>sp|A4GE70|DXMT1_COFCA 3,7-dimethylxanthine N-methyltransferase OS=Coffea canephora GN=DXMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8H0D2|DXMT1_COFAR 3,7-dimethylxanthine N-methyltransferase OS=Coffea arabica GN=DXMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8H0D3|CCS1_COFAR Caffeine synthase 1 OS=Coffea arabica GN=CCS1 PE=1 SV=1 Back     alignment and function description
>sp|Q8H0G0|CTS2_COFAR Theobromine synthase 2 OS=Coffea arabica GN=CTS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9AVJ9|MXMT1_COFAR Monomethylxanthine methyltransferase 1 OS=Coffea arabica GN=MXMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q84PP7|MXMT2_COFAR Monomethylxanthine methyltransferase 2 OS=Coffea arabica GN=MXMT2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query368
255587606375 Jasmonate O-methyltransferase, putative 0.991 0.973 0.501 7e-99
225447527383 PREDICTED: probable caffeine synthase 4- 0.989 0.950 0.472 6e-93
296085033 549 unnamed protein product [Vitis vinifera] 0.983 0.659 0.474 7e-93
255587698310 Benzoate carboxyl methyltransferase, put 0.817 0.970 0.525 3e-85
209956793380 S-adenosyl-L-methionine:salicylic acid c 0.991 0.960 0.476 1e-83
359475119376 PREDICTED: LOW QUALITY PROTEIN: salicyla 0.975 0.954 0.469 4e-83
357467353369 Salicylic acid/benzoic acid carboxyl met 0.934 0.932 0.46 1e-79
388516431369 unknown [Medicago truncatula] 0.934 0.932 0.46 1e-79
255543743328 Benzoate carboxyl methyltransferase, put 0.880 0.987 0.463 5e-79
167613941366 carboxyl methyltransferase 4 [Humulus lu 0.975 0.980 0.423 6e-79
>gi|255587606|ref|XP_002534327.1| Jasmonate O-methyltransferase, putative [Ricinus communis] gi|223525486|gb|EEF28055.1| Jasmonate O-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  366 bits (940), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 188/375 (50%), Positives = 254/375 (67%), Gaps = 10/375 (2%)

Query: 1   MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPDCIRFTDMGCS 60
           M+V QVL MNGGEG NSY +NS   ++ ILKAKP+L ES+ +L     P C+   +MGCS
Sbjct: 4   MEVPQVLHMNGGEGTNSYYRNSLFQKKVILKAKPILDESITELCRANLPKCLTMVEMGCS 63

Query: 61  SGPNAFLPTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKS-LPSFYERLKTE 119
           SGPNA LP W+ IE +D+ C+ +K KPP+L  FLNDLPG DFNT+ +S +P+F E++  E
Sbjct: 64  SGPNALLPLWEIIERIDSTCNEMKKKPPMLQVFLNDLPGTDFNTIFRSSVPNFQEKVVQE 123

Query: 120 KRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRD 179
           K N  FG  FI   PGS YGRLFPP  L+LV+SS  ++W SQVP+ LV+E GI  +NK +
Sbjct: 124 KGNK-FGPIFISACPGSFYGRLFPPQSLHLVHSSCSVHWCSQVPEGLVTESGIA-MNKGN 181

Query: 180 VCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGND------KHHTG 233
           +C+A+T SP +VHKAYLDQFE DFT+ L  R EE+  GG MIL     +      K+ + 
Sbjct: 182 ICIAET-SPPSVHKAYLDQFERDFTTLLKLRSEEIVPGGHMILTITAKNNDNPYCKYGSE 240

Query: 234 VFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISW 293
            + L+GM LNDMV EGL++ SKL+S+N P+YYP  EEV  +I++E SF I ++E    SW
Sbjct: 241 FWPLIGMTLNDMVEEGLVQRSKLDSWNIPLYYPSAEEVTDLIQKENSFTISRVEEFVQSW 300

Query: 294 SVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEM 353
               E+ +  L F+K  R K+VAN +RA +ES+L   FG+AI+DDLF+R + K + +LE 
Sbjct: 301 DDNIEDGNSNLVFDKWERGKHVANYMRAAAESMLVTQFGNAIIDDLFNRLSAKAAYYLEN 360

Query: 354 GLGAHTVLFIYLIKK 368
           G+G    L I + +K
Sbjct: 361 GMGLFNHLVISMTRK 375




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225447527|ref|XP_002267308.1| PREDICTED: probable caffeine synthase 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085033|emb|CBI28448.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255587698|ref|XP_002534362.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis] gi|223525428|gb|EEF28019.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|209956793|gb|ABU88887.2| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase [Chimonanthus praecox] Back     alignment and taxonomy information
>gi|359475119|ref|XP_003631590.1| PREDICTED: LOW QUALITY PROTEIN: salicylate O-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357467353|ref|XP_003603961.1| Salicylic acid/benzoic acid carboxyl methyltransferase [Medicago truncatula] gi|355493009|gb|AES74212.1| Salicylic acid/benzoic acid carboxyl methyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388516431|gb|AFK46277.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255543743|ref|XP_002512934.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis] gi|223547945|gb|EEF49437.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|167613941|gb|ABZ89568.1| carboxyl methyltransferase 4 [Humulus lupulus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query368
TAIR|locus:2154845354 AT5G66430 [Arabidopsis thalian 0.934 0.971 0.413 2e-65
TAIR|locus:2080747379 BSMT1 [Arabidopsis thaliana (t 0.932 0.905 0.398 2e-63
TAIR|locus:2179929415 NAMT1 [Arabidopsis thaliana (t 0.934 0.828 0.405 5.5e-61
TAIR|locus:2144466368 AT5G38020 [Arabidopsis thalian 0.953 0.953 0.386 3.5e-59
TAIR|locus:2179969385 AT5G04380 "AT5G04380" [Arabido 0.940 0.898 0.364 1.2e-58
TAIR|locus:2095572368 AT3G21950 [Arabidopsis thalian 0.953 0.953 0.378 1.7e-57
TAIR|locus:2013149389 JMT "jasmonic acid carboxyl me 0.883 0.835 0.406 2.5e-56
TAIR|locus:2115400371 AT4G36470 [Arabidopsis thalian 0.961 0.954 0.372 3.3e-56
TAIR|locus:2053458359 AT2G14060 [Arabidopsis thalian 0.902 0.924 0.372 7.8e-55
TAIR|locus:504956193351 AT1G15125 [Arabidopsis thalian 0.850 0.891 0.360 7.5e-41
TAIR|locus:2154845 AT5G66430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 666 (239.5 bits), Expect = 2.0e-65, P = 2.0e-65
 Identities = 153/370 (41%), Positives = 215/370 (58%)

Query:     9 MNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSN-GFPDCIRFTDMGCSSGPNAFL 67
             M+GG+GDNSY+ NS   ++ + KAKP+L ++   +  N  FP+ I+  D+GC++G N FL
Sbjct:     1 MSGGDGDNSYSTNSLLQKKVLSKAKPVLVKNTKGMMINLNFPNYIKVADLGCATGENTFL 60

Query:    68 PTWQAIEALDTICSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGS 127
                + +  ++ +C +   KPP +   LNDLP NDFNT  K +P F +R+K+++       
Sbjct:    61 TMAEIVNTINVLCQQCNQKPPEIDCCLNDLPDNDFNTTFKFVPFFNKRVKSKRL------ 114

Query:   128 CFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCS 187
             CF+   PGS Y RLFP   L+ V+SS+ L+WLS+VPK L         N   V +  T S
Sbjct:   115 CFVSGVPGSFYSRLFPRKSLHFVHSSYSLHWLSKVPKGLEK-------NSSSVYIT-TSS 166

Query:   188 PSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIG----NDKHHTGV---FELMGM 240
             P N +KAYL+QF+SDF SFL  R EE+   GRM+L FIG    +D  H      + L+  
Sbjct:   167 PPNAYKAYLNQFQSDFKSFLEMRSEEMVSNGRMVLTFIGRKTLDDPLHRDCCHFWTLLST 226

Query:   241 VLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYEND 300
              L D+VYEGL+  SK++SFN P Y P  EEV ++I  EGSF I+ LE  H  + +G  N 
Sbjct:   227 SLRDLVYEGLVSASKVDSFNIPFYDPSKEEVMEMIRNEGSFEINDLEI-H-GFELGLSNH 284

Query:   301 DKGLEFNKH-ARA-KNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAH 358
             D+    +   ++A +  AN IRAVSES+L   FG  IMD LF +F   +S H        
Sbjct:   285 DEDYMLHSQISKAGQREANCIRAVSESMLVADFGVDIMDTLFKKFAYHVSQHASCTNKTT 344

Query:   359 TVLFIYLIKK 368
               L + LI+K
Sbjct:   345 VTLVVSLIRK 354




GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016114 "terpenoid biosynthetic process" evidence=RCA
TAIR|locus:2080747 BSMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179929 NAMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144466 AT5G38020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179969 AT5G04380 "AT5G04380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095572 AT3G21950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013149 JMT "jasmonic acid carboxyl methyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115400 AT4G36470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053458 AT2G14060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956193 AT1G15125 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query368
pfam03492331 pfam03492, Methyltransf_7, SAM dependent carboxyl 1e-114
PLN02668386 PLN02668, PLN02668, indole-3-acetate carboxyl meth 5e-52
>gnl|CDD|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase Back     alignment and domain information
 Score =  335 bits (862), Expect = e-114
 Identities = 147/345 (42%), Positives = 198/345 (57%), Gaps = 26/345 (7%)

Query: 36  LHESLFDLYS-NGFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTICSRLKHKPPI-LHAF 93
           L E++ +L   N FP+ I+  D+GCSSGPN FL     I+ ++    +     P     F
Sbjct: 1   LEEAISELLLRNLFPNSIKIADLGCSSGPNTFLAVSNIIDTVEKKYQKENILEPPEFQVF 60

Query: 94  LNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSS 153
            NDLP NDFNTL K LP F ++           S F+   PGS YGRLFP   L+ V+SS
Sbjct: 61  FNDLPSNDFNTLFKLLPPFQKK---------KRSYFVSGVPGSFYGRLFPRNSLHFVHSS 111

Query: 154 FCLNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEE 213
           + L+WLSQVPK L  +   P  NK ++ ++   SP  V+KAYLDQF+ DF+ FL  R EE
Sbjct: 112 YSLHWLSQVPKGLEDKES-PAWNKGNIYISGA-SPEEVYKAYLDQFKKDFSLFLRARAEE 169

Query: 214 LKIGGRMILNFIG---NDKHHTG---VFELMGMVLNDMVYEGLIEESKLESFNYPIYYPC 267
           L  GG M+L F+G    D   T     ++L+G  LND+V EGLIEE KL+SFN PIY P 
Sbjct: 170 LVSGGLMVLTFLGRPSVDPSETECGIFWDLLGDALNDLVSEGLIEEEKLDSFNIPIYAPS 229

Query: 268 VEEVRQVIEREGSFNIHQLET-SHISWSVGYENDDKGLEFNKHARAKNVANNIRAVSESL 326
            EEV+++IE+EGSF I +LE   H +  V ++  D     +K    + VA+++RAV E +
Sbjct: 230 PEEVKEIIEKEGSFTIERLEIIKHPNGEVPWDESDSE---DKVEDGRFVASSVRAVVEPM 286

Query: 327 LANHFGSAIMDDLFHRFTIKISAHLEMGLGAH---TVLFIYLIKK 368
           L  HFG  IMD LF R+  K+S HL   L        + + L +K
Sbjct: 287 LVAHFGEDIMDKLFDRYAKKLSEHLSKELQNAKKTINVVVSLSRK 331


This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331

>gnl|CDD|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 368
PLN02668386 indole-3-acetate carboxyl methyltransferase 100.0
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 100.0
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.56
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.53
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.39
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.38
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.04
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.94
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.88
PRK08317241 hypothetical protein; Provisional 98.87
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.85
PLN02233261 ubiquinone biosynthesis methyltransferase 98.82
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.82
PLN02244340 tocopherol O-methyltransferase 98.81
PLN02336475 phosphoethanolamine N-methyltransferase 98.81
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.77
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.74
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.69
TIGR00452314 methyltransferase, putative. Known examples to dat 98.69
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.68
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.63
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.56
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.56
PLN02490340 MPBQ/MSBQ methyltransferase 98.55
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.52
KOG2940325 consensus Predicted methyltransferase [General fun 98.51
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.51
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.5
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.45
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.38
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.37
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.33
PRK06202232 hypothetical protein; Provisional 98.31
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.3
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.28
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.26
PRK11207197 tellurite resistance protein TehB; Provisional 98.26
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.22
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.18
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.15
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.14
PRK06922677 hypothetical protein; Provisional 98.13
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.11
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.07
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.05
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.03
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.03
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.02
PRK05785226 hypothetical protein; Provisional 98.01
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.0
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.99
PRK12335287 tellurite resistance protein TehB; Provisional 97.97
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.97
PLN02336 475 phosphoethanolamine N-methyltransferase 97.97
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 97.94
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.89
TIGR03438301 probable methyltransferase. This model represents 97.87
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 97.86
KOG3010261 consensus Methyltransferase [General function pred 97.83
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 97.81
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 97.76
COG4123248 Predicted O-methyltransferase [General function pr 97.72
KOG2361264 consensus Predicted methyltransferase [General fun 97.7
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.67
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.67
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.64
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.63
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 97.63
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.61
PLN02585315 magnesium protoporphyrin IX methyltransferase 97.6
PLN02232160 ubiquinone biosynthesis methyltransferase 97.57
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 97.53
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 97.42
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 97.42
TIGR00438188 rrmJ cell division protein FtsJ. 97.4
PRK14967223 putative methyltransferase; Provisional 97.37
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 97.37
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 97.35
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.33
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.32
PRK04266226 fibrillarin; Provisional 97.28
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 97.26
PTZ00146293 fibrillarin; Provisional 97.25
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 97.23
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.19
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 97.13
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 97.13
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 97.12
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.05
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.04
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.01
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.01
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 96.99
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.97
PHA03411279 putative methyltransferase; Provisional 96.94
PLN03075296 nicotianamine synthase; Provisional 96.9
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 96.89
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 96.83
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 96.83
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 96.78
PRK10901427 16S rRNA methyltransferase B; Provisional 96.78
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 96.7
TIGR00536284 hemK_fam HemK family putative methylases. The gene 96.69
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 96.64
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 96.59
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.58
PRK00811283 spermidine synthase; Provisional 96.57
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 96.56
PRK14968188 putative methyltransferase; Provisional 96.53
PRK14903431 16S rRNA methyltransferase B; Provisional 96.52
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 96.49
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 96.49
KOG4300252 consensus Predicted methyltransferase [General fun 96.41
KOG3045325 consensus Predicted RNA methylase involved in rRNA 96.34
PRK04457262 spermidine synthase; Provisional 96.33
PRK14902444 16S rRNA methyltransferase B; Provisional 96.3
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 96.23
PRK14904445 16S rRNA methyltransferase B; Provisional 96.18
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 96.16
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 96.07
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 95.9
PRK07402196 precorrin-6B methylase; Provisional 95.87
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 95.83
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.8
PRK14901434 16S rRNA methyltransferase B; Provisional 95.78
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 95.47
COG2890280 HemK Methylase of polypeptide chain release factor 95.42
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 95.37
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 95.28
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 95.25
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 95.18
PRK01581374 speE spermidine synthase; Validated 95.06
PLN02366308 spermidine synthase 95.02
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 94.98
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 94.3
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 94.19
KOG2899288 consensus Predicted methyltransferase [General fun 93.99
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 93.8
PRK03612521 spermidine synthase; Provisional 93.49
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 93.47
KOG1499346 consensus Protein arginine N-methyltransferase PRM 92.95
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 92.85
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 92.81
KOG1331293 consensus Predicted methyltransferase [General fun 92.69
PLN02672 1082 methionine S-methyltransferase 92.24
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 92.21
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 92.1
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 91.43
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 91.0
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 90.68
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 89.67
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 88.37
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 87.92
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 86.75
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 86.63
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 86.07
PHA03412241 putative methyltransferase; Provisional 85.91
PF13679141 Methyltransf_32: Methyltransferase domain 85.71
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 85.66
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 85.35
PRK13256226 thiopurine S-methyltransferase; Reviewed 84.86
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 83.43
PTZ00338294 dimethyladenosine transferase-like protein; Provis 83.33
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 83.11
COG2263198 Predicted RNA methylase [Translation, ribosomal st 82.83
smart00650169 rADc Ribosomal RNA adenine dimethylases. 82.45
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 81.84
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 81.17
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 80.21
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 80.07
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
Probab=100.00  E-value=1.3e-97  Score=729.57  Aligned_cols=359  Identities=31%  Similarity=0.485  Sum_probs=321.3

Q ss_pred             CCccceeeccCCCCCchHHhhCHHHHHHHHHhHHHHHHHHHhhhcCCCC-CceEEeeecCCCCCCchHHHHHHHHHHHHH
Q 047625            1 MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFP-DCIRFTDMGCSSGPNAFLPTWQAIEALDTI   79 (368)
Q Consensus         1 ~~~~~~~~m~gG~g~~sY~~nS~~Q~~~~~~~~~~l~~a~~~~~~~~~~-~~~~IaD~GCs~G~ns~~~~~~ii~~l~~~   79 (368)
                      |+++++|||+||+|++||++||.+|++++..++|+|+++|++++....+ ++++|||||||+|+||+.+|+.||++|+++
T Consensus        13 m~~~~~l~M~gG~g~~SYa~nS~~Q~~~~~~~k~~leeai~~~~~~~~p~~~~~iaDlGcs~G~ntl~~vs~iI~~i~~~   92 (386)
T PLN02668         13 MKLEKLLCMKGGKGEGSYANNSQAQALHARSMLHLLEETLDNVHLNSSPEVPFTAVDLGCSSGSNTIHIIDVIVKHMSKR   92 (386)
T ss_pred             ceeccccccCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCCcceeEEEecCCCCccHHHHHHHHHHHHHHH
Confidence            7899999999999999999999999999999999999999988654334 689999999999999999999999999999


Q ss_pred             hhhcCCCCCcceEEecCCCCCchhhhhhcChhhHHHhh-hhcc--CCCCCceeeeecCCCcccccCCCCccceEEccccc
Q 047625           80 CSRLKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLK-TEKR--NDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCL  156 (368)
Q Consensus        80 ~~~~~~~~p~~~v~~nDLp~NDfn~lf~~l~~~~~~~~-~~~~--~~~~~~~f~~~vp~SFy~~l~P~~sid~~~S~~al  156 (368)
                      |...+.++||+||||||||+||||+||++|+++.+.+. ...+  ....++||++|||||||+||||++|+||+||++||
T Consensus        93 ~~~~~~~~pe~qv~~nDLP~NDFNtlF~~L~~~~~~~~~~~~~~~~~~~~~~f~~gvpGSFY~RLfP~~Slh~~~Ss~sl  172 (386)
T PLN02668         93 YESAGLDPPEFSAFFSDLPSNDFNTLFQLLPPLANYGGSMEECLAASGHRSYFAAGVPGSFYRRLFPARSIDVFHSAFSL  172 (386)
T ss_pred             hhhcCCCCCcceEEecCCCCCCHHHHHhhchhhhhhhcchhhhccccCCCceEEEecCccccccccCCCceEEEEeeccc
Confidence            98877778899999999999999999999998765320 0000  01124699999999999999999999999999999


Q ss_pred             ccccCCcccccccCCCCCcCcccEEEcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccCceEEEEeecCCC------c
Q 047625          157 NWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDK------H  230 (368)
Q Consensus       157 hWls~~P~~~~~~~~~~~~nk~~i~~~~~s~~~~v~~ay~~Q~~~D~~~FL~~Ra~ELkpGG~lvl~~~g~~~------e  230 (368)
                      ||||++|+.+.|..+ +.||||+||++.++  ++|.+||++||++||..||++||+||+|||+||+++.||.+      +
T Consensus       173 HWLS~vP~~l~d~~s-~~~Nkg~iyi~~~s--~~v~~aY~~Qf~~D~~~FL~~Ra~ELvpGG~mvl~~~Gr~~~~~~~~~  249 (386)
T PLN02668        173 HWLSQVPESVTDKRS-AAYNKGRVFIHGAS--ESTANAYKRQFQADLAGFLRARAQEMKRGGAMFLVCLGRTSVDPTDQG  249 (386)
T ss_pred             eecccCchhhccCCc-ccccCCceEecCCC--HHHHHHHHHHHHHHHHHHHHHHHHHhccCcEEEEEEecCCCCCcccCC
Confidence            999999999987764 89999999999885  89999999999999999999999999999999999999965      1


Q ss_pred             -cchHHHH-HHHHHHHHHHcCCCchhhhccCCcccccCCHHHHHHHHHhcCceeEeEEEEEeecCCCCCCCCcccchhhh
Q 047625          231 -HTGVFEL-MGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYENDDKGLEFNK  308 (368)
Q Consensus       231 -~~~~~~~-l~~al~~l~~eGli~~e~~d~f~~P~y~ps~~E~~~~l~~~GsF~I~~le~~~~~~~~~~~~~~~~~d~~~  308 (368)
                       .+.+|+. +.++|++||.||+|++|++|+||+|+|+||++|++++|+++|+|+|+++|+++..|++ +.+..  .|  .
T Consensus       250 ~~~~~~~~~l~~al~dlv~eGlI~eek~dsFniP~Y~ps~eEv~~~Ie~~gsF~I~~le~~~~~~~~-~~~~~--~d--~  324 (386)
T PLN02668        250 GAGLLFGTHFQDAWDDLVQEGLVTSEKRDSFNIPVYAPSLQDFKEVVEANGSFAIDKLEVFKGGSPL-VVNEP--DD--A  324 (386)
T ss_pred             chhHHHHHHHHHHHHHHHHcCCCCHHHHhcccCcccCCCHHHHHHHHhhcCCEEeeeeEEeeccCcc-cccCc--cc--H
Confidence             3345665 9999999999999999999999999999999999999999999999999999988865 33221  23  4


Q ss_pred             hhhHHHHHHHHHHHHhhHHHhhhChHHHHHHHHHHHHHHHHhHhh--cCCCEEEEEEEEEe
Q 047625          309 HARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEM--GLGAHTVLFIYLIK  367 (368)
Q Consensus       309 ~~~~~~~~~~ira~~~p~l~~~~~~~i~delf~r~~~~~~~~l~~--~~~~~~~~~~~l~r  367 (368)
                      ...++.+++++||++||++.+|||++++|+||+||+++++++++.  ++.++.+++++|.-
T Consensus       325 ~~~g~~~a~~~RA~~E~ll~~HFG~~i~D~lF~r~~~~v~~~~~~~~~~~~~~~~~~sL~~  385 (386)
T PLN02668        325 AEVGRAMANSCRSVAGVLVDAHIGEELSNELFLRVERRATSHAKELLEKLQFFHIVASLSF  385 (386)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHhhcccCceEEEEEEEec
Confidence            567889999999999999999999999999999999999999988  88899999999864



>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query368
2eg5_A372 The Structure Of Xanthosine Methyltransferase Lengt 4e-81
2efj_A384 The Structure Of 1,7 Dimethylxanthine Methyltransfe 2e-78
1m6e_X359 Crystal Structure Of Salicylic Acid Carboxyl Methyl 6e-68
3b5i_A374 Crystal Structure Of Indole-3-Acetic Acid Methyltra 8e-39
>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372 Back     alignment and structure

Iteration: 1

Score = 298 bits (762), Expect = 4e-81, Method: Compositional matrix adjust. Identities = 166/375 (44%), Positives = 229/375 (61%), Gaps = 16/375 (4%) Query: 1 MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPD---CIRFTDM 57 M++++VL MNGGEGD SYAKNSA + + K KP+L + + +L P+ CI+ D+ Sbjct: 1 MELQEVLRMNGGEGDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADL 60 Query: 58 GCSSGPNAFLPTWQAIEALDTICSRLKHK--PPILHAFLNDLPGNDFNTLSKSLPSFYER 115 GC+SGPN L ++++D + K++ P + FLNDL NDFN++ K LPSFY + Sbjct: 61 GCASGPNTLLTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLFPNDFNSVFKLLPSFYRK 120 Query: 116 LKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLL 175 L+ E GSC IG PGS Y RLFP ++ ++S +CL WLSQVP LV+E GI Sbjct: 121 LEKE-NGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELGIGT- 178 Query: 176 NKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFI--GNDKHHTG 233 NK + +K S V KAYLDQF DFT+FL EEL GRM+L I G + Sbjct: 179 NKGSIYSSKA-SRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARN 237 Query: 234 VFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISW 293 +L+ M +ND+V EG +EE KL+SFN P+Y P EEV+ ++E EGSF I LET + + Sbjct: 238 AIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLY 297 Query: 294 SVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEM 353 G+ DD +H +A+ VA+++RAV E +LA+HFG AI+ D+FHRF + L + Sbjct: 298 DAGFSIDD------EHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPL 351 Query: 354 GLGAHTVLFIYLIKK 368 G G + L I L KK Sbjct: 352 GKGFYNNLIISLAKK 366
>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384 Back     alignment and structure
>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359 Back     alignment and structure
>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query368
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 1e-116
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 1e-113
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 1e-109
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384 Back     alignment and structure
 Score =  341 bits (876), Expect = e-116
 Identities = 162/382 (42%), Positives = 230/382 (60%), Gaps = 18/382 (4%)

Query: 1   MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPD---CIRFTDM 57
           M++++VL MNGGEGD SYAKNS+     +++ KP+L + + +L     P+   C +  D+
Sbjct: 1   MELQEVLHMNGGEGDTSYAKNSSYNL-FLIRVKPVLEQCIQELLRANLPNINKCFKVGDL 59

Query: 58  GCSSGPNAFLPTWQAIEALDTICSRLKHK--PPILHAFLNDLPGNDFNTLSKSLPSFYER 115
           GC+SGPN F      ++++D +    K++   P +  FLNDL  NDFN++ K LPSFY  
Sbjct: 60  GCASGPNTFSTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLFQNDFNSVFKLLPSFYRN 119

Query: 116 LKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLL 175
           L+ E      GSC IG  PGS Y RLFP   ++ ++S +CL+WLSQVP  LV+E GI + 
Sbjct: 120 LEKEN-GRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLHWLSQVPSGLVTELGISV- 177

Query: 176 NKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDK--HHTG 233
           NK  +  +K  S   + KAYLDQF  DFT+FL    EEL   GRM+L FI  +    H  
Sbjct: 178 NKGCIYSSKA-SRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFICKEDEFDHPN 236

Query: 234 VFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISW 293
             +L+ M +ND+V EG +EE KL+SFN PIY P  EEV++++E EGSF I  LET +  +
Sbjct: 237 SMDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPY 296

Query: 294 SVGYENDD-------KGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIK 346
             G+  DD         +  ++HARA +VA+ +R++ E +LA+HFG AI+ DL HR    
Sbjct: 297 DAGFSIDDDYQGRSHSPVSCDEHARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKN 356

Query: 347 ISAHLEMGLGAHTVLFIYLIKK 368
            +  L  G G +  + I L KK
Sbjct: 357 AAKVLRSGKGFYDSVIISLAKK 378


>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374 Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query368
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 100.0
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 100.0
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 100.0
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.54
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.54
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.4
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.3
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.22
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.16
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.1
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.08
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.07
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.06
3f4k_A257 Putative methyltransferase; structural genomics, P 99.05
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.04
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.03
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.02
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.99
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.99
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.97
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.94
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.94
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.91
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.91
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.91
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.85
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.84
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.83
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.83
3lcc_A235 Putative methyl chloride transferase; halide methy 98.83
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.81
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.81
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.8
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.8
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.78
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.77
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.77
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.77
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.76
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.76
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.75
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.75
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.75
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.75
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.75
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.73
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.73
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.73
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.73
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.71
3cc8_A230 Putative methyltransferase; structural genomics, j 98.71
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.71
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.71
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.66
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.66
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.65
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.64
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.64
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.64
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.63
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.62
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.62
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.57
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.55
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.54
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.53
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.52
3ocj_A305 Putative exported protein; structural genomics, PS 98.52
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.52
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.52
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.51
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.51
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.5
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.49
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.48
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.47
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.46
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.44
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.44
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.42
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.42
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.39
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.39
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.38
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.38
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.35
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.35
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.32
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.28
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.24
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.24
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.23
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.21
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.18
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.17
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.15
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.11
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.11
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.05
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.02
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.01
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.0
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 97.93
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.92
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 97.91
3m70_A286 Tellurite resistance protein TEHB homolog; structu 97.9
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.89
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.87
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.87
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.87
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 97.84
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 97.83
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.83
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.83
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 97.82
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 97.78
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 97.75
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 97.75
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 97.69
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.68
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.66
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 97.65
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.64
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 97.63
2fyt_A340 Protein arginine N-methyltransferase 3; structural 97.63
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 97.61
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 97.6
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 97.59
3m33_A226 Uncharacterized protein; structural genomics, PSI- 97.59
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.55
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.54
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 97.52
1jsx_A207 Glucose-inhibited division protein B; methyltransf 97.46
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.42
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 97.42
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.42
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 97.4
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 97.4
3lpm_A259 Putative methyltransferase; structural genomics, p 97.39
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 97.39
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 97.38
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 97.36
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.33
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.32
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.32
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 97.31
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.29
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.27
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.27
3gjy_A317 Spermidine synthase; APC62791, structural genomics 97.26
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.26
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.26
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.24
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.23
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.23
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.21
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.21
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.15
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.12
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.09
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 97.07
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 97.06
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.06
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.04
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 97.03
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 97.03
2b25_A336 Hypothetical protein; structural genomics, methyl 97.02
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 97.02
2h00_A254 Methyltransferase 10 domain containing protein; st 97.02
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 97.0
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 97.0
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 96.97
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.96
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 96.95
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.94
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 96.92
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.92
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 96.91
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 96.91
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.9
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 96.87
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 96.86
2o07_A304 Spermidine synthase; structural genomics, structur 96.85
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 96.84
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 96.83
1ws6_A171 Methyltransferase; structural genomics, riken stru 96.79
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 96.78
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 96.75
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 96.75
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 96.71
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 96.71
2esr_A177 Methyltransferase; structural genomics, hypothetic 96.69
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.66
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.65
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 96.64
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.64
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 96.62
2i7c_A283 Spermidine synthase; transferase, structural genom 96.6
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 96.59
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.59
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 96.59
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 96.57
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 96.56
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 96.54
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.53
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 96.52
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 96.51
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 96.45
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 96.43
1xj5_A334 Spermidine synthase 1; structural genomics, protei 96.43
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 96.42
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 96.4
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 96.35
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 96.34
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 96.34
2fpo_A202 Methylase YHHF; structural genomics, putative meth 96.31
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 96.26
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 96.25
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 96.24
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 96.22
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 96.16
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.16
3duw_A223 OMT, O-methyltransferase, putative; alternating of 96.13
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 96.1
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 96.09
2pt6_A321 Spermidine synthase; transferase, structural genom 96.07
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 96.04
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 95.99
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 95.92
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 95.86
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 95.71
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 95.6
2avd_A229 Catechol-O-methyltransferase; structural genomics, 95.48
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 95.42
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 95.23
2cmg_A262 Spermidine synthase; transferase, putrescine amino 95.17
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 95.07
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 94.98
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 94.94
2b78_A385 Hypothetical protein SMU.776; structure genomics, 94.72
3khk_A544 Type I restriction-modification system methylation 94.45
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 93.68
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 93.38
2qm3_A373 Predicted methyltransferase; putative methyltransf 93.35
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 92.98
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 92.82
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 92.45
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 92.37
3lkd_A542 Type I restriction-modification system methyltrans 92.19
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 91.28
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 91.02
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 90.85
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 90.35
3fut_A271 Dimethyladenosine transferase; methyltransferase, 90.21
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 89.44
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 89.34
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 88.76
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 87.9
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 86.78
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 85.51
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 85.33
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 85.25
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 85.2
1ne2_A200 Hypothetical protein TA1320; structural genomics, 84.67
2zig_A297 TTHA0409, putative modification methylase; methylt 84.16
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 81.02
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
Probab=100.00  E-value=3e-97  Score=732.30  Aligned_cols=363  Identities=43%  Similarity=0.753  Sum_probs=314.6

Q ss_pred             CCccceeeccCCCCCchHHhhCHHHHHHHHHhHHHHHHHHHhhhcCCCCC---ceEEeeecCCCCCCchHHHHHHHHHHH
Q 047625            1 MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSNGFPD---CIRFTDMGCSSGPNAFLPTWQAIEALD   77 (368)
Q Consensus         1 ~~~~~~~~m~gG~g~~sY~~nS~~Q~~~~~~~~~~l~~a~~~~~~~~~~~---~~~IaD~GCs~G~ns~~~~~~ii~~l~   77 (368)
                      |+++++|||+||+|++||++||. |++++..++|++++||++++....++   +++|||||||+|+||+++++.||++|+
T Consensus         1 m~~~~~~~M~gg~G~~sY~~nS~-Q~~~~~~~~~~~~~ai~~l~~~~~~~~~~~~~IaDlGCssG~NT~~~v~~ii~~i~   79 (384)
T 2efj_A            1 MELQEVLHMNGGEGDTSYAKNSS-YNLFLIRVKPVLEQCIQELLRANLPNINKCFKVGDLGCASGPNTFSTVRDIVQSID   79 (384)
T ss_dssp             --CTTTCCCCC----CCHHHHCC-TTTTHHHHHHHHHHHHHHHHHTTCTTTTTEEEEEEETCCSSHHHHHHHHHHHHHHT
T ss_pred             CCcccccccCCCCChhhHHHhHH-HHHHHHHHHHHHHHHHHHhhhcccCCcCCceEEEecCCCCCchHHHHHHHHHHHHH
Confidence            89999999999999999999999 99999999999999999998765555   899999999999999999999999999


Q ss_pred             HHhhh--cCCCCCcceEEecCCCCCchhhhhhcChhhHHHhhhhccCCCCCceeeeecCCCcccccCCCCccceEEcccc
Q 047625           78 TICSR--LKHKPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFC  155 (368)
Q Consensus        78 ~~~~~--~~~~~p~~~v~~nDLp~NDfn~lf~~l~~~~~~~~~~~~~~~~~~~f~~~vp~SFy~~l~P~~sid~~~S~~a  155 (368)
                      ++|..  .+.++|++||+|||||+||||+||++|+.+.+++.+..+ .++++||++|||||||+||||++|+|++||++|
T Consensus        80 ~~~~~~~~~~~~pe~~v~~nDLp~NDFN~lF~~L~~~~~~~~~~~g-~~~~~~f~~gvpgSFy~rlfp~~S~d~v~Ss~a  158 (384)
T 2efj_A           80 KVGQEKKNELERPTIQIFLNDLFQNDFNSVFKLLPSFYRNLEKENG-RKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYC  158 (384)
T ss_dssp             CC----------CEEEEEEECCTTSCHHHHHHHHHHHHHHHHHHTC-CCTTSEEEEECCSCTTSCCSCTTCEEEEEEESC
T ss_pred             HHhhhcccCCCCCceEEEecCCCccchHHHHhhhhhhHhhhhhhcc-CCCCceEEEecchhhhhccCCCCceEEEEecce
Confidence            98865  455678999999999999999999999999988876665 456799999999999999999999999999999


Q ss_pred             cccccCCcccccccCCCCCcCcccEEEcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccCceEEEEeecCCCc--cch
Q 047625          156 LNWLSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDKH--HTG  233 (368)
Q Consensus       156 lhWls~~P~~~~~~~~~~~~nk~~i~~~~~s~~~~v~~ay~~Q~~~D~~~FL~~Ra~ELkpGG~lvl~~~g~~~e--~~~  233 (368)
                      |||||++|+.+.++.+ ++||||+||++.++ |++|.+||++||++||.+||++|++||||||+||++++|+++.  ...
T Consensus       159 LHWls~~p~~l~~~~s-~~~nkg~i~i~~~s-p~~v~~ay~~Qf~~D~~~FL~~Ra~eL~pGG~mvl~~~gr~~~~~~~~  236 (384)
T 2efj_A          159 LHWLSQVPSGLVTELG-ISVNKGCIYSSKAS-RPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFICKEDEFDHPN  236 (384)
T ss_dssp             TTBCSSSCCC-------CCCCTTCSSSCTTS-CHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEECCCTTTCCCC
T ss_pred             eeecCCCchhhhcccc-ccccCCceEecCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHhccCCeEEEEEecCCCcccCcc
Confidence            9999999999988764 99999999999999 9999999999999999999999999999999999999999982  212


Q ss_pred             HHHHHHHHHHHHHHcCCCchhhhccCCcccccCCHHHHHHHHHhcCceeEeEEEEEeecCCCCC---CCCcc-cchh---
Q 047625          234 VFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGY---ENDDK-GLEF---  306 (368)
Q Consensus       234 ~~~~l~~al~~l~~eGli~~e~~d~f~~P~y~ps~~E~~~~l~~~GsF~I~~le~~~~~~~~~~---~~~~~-~~d~---  306 (368)
                      ..+.+.++|++|+.+|+|+++++|+|++|+|+||++||+.+|+++|+|+|+++|+++.+|++ +   ++... ..|.   
T Consensus       237 ~~~~l~~al~~lv~eGli~~ek~dsf~~P~y~ps~~E~~~~le~~g~F~i~~le~~~~~~~~-~~~~~~~~~~~~~~~~~  315 (384)
T 2efj_A          237 SMDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYDA-GFSIDDDYQGRSHSPVS  315 (384)
T ss_dssp             HHHHHHHHHHHHHHHTSSCHHHHHTCCCSBCCCCHHHHHHHHHHHCSEEEEEEEEEEEETTT-TCCC---------CCSH
T ss_pred             cHHHHHHHHHHHHHhCCcchhhhcccCCcccCCCHHHHHHHHHHcCCceEEEEEEEeecccc-ccccccccccccccccc
Confidence            23488999999999999999999999999999999999999999999999999999999976 4   32100 0110   


Q ss_pred             -hhhhhHHHHHHHHHHHHhhHHHhhhChHHHHHHHHHHHHHHHHhHhhcCCCEEEEEEEEEeC
Q 047625          307 -NKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK  368 (368)
Q Consensus       307 -~~~~~~~~~~~~ira~~~p~l~~~~~~~i~delf~r~~~~~~~~l~~~~~~~~~~~~~l~r~  368 (368)
                       +....++.+++++||+++|++.+|||++++|++|+||++++++++..++++|++++++|+||
T Consensus       316 ~d~~~~g~~~a~~iRa~~epll~~hfG~~i~d~lF~ry~~~~~~~~~~~~~~~~~~~~~L~k~  378 (384)
T 2efj_A          316 CDEHARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKNAAKVLRSGKGFYDSVIISLAKK  378 (384)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHCSTTHHHHHHHHHHHHHHHHHHTCCEEEEEEEEEEEC
T ss_pred             chHhHhHHHhhhhhHHhhhhhhHHhccHHHHHHHHHHHHHHHHHHHhhCCCceEEEEEEEEEc
Confidence             14568899999999999999999999999999999999999999999999999999999997



>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 368
d1m6ex_359 c.66.1.35 (X:) Salicylic acid carboxyl methyltrans 1e-124
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]
 Score =  359 bits (923), Expect = e-124
 Identities = 151/376 (40%), Positives = 206/376 (54%), Gaps = 27/376 (7%)

Query: 1   MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLY-SNGFPDCIRFTDMGC 59
           M V QVL M GG G+NSYA NS   R+ I   KP+   ++  LY  +     +   D+GC
Sbjct: 1   MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGC 60

Query: 60  SSGPNAFLPTWQAIEALDTICSRLKHKP-PILHAFLNDLPGNDFNTLSKSLPSFYERLKT 118
           SSGPNA     + I+ ++ +  ++  +  P    FLNDLPGNDFN + +SLP        
Sbjct: 61  SSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIE------ 114

Query: 119 EKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNWLSQVPKELVSECGIPLLNKR 178
              ND  G CFI   PGS YGRLFP   L+ ++SS+ L WLSQVP  + S       NK 
Sbjct: 115 ---NDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIES-------NKG 164

Query: 179 DVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIG---NDKHHTG-- 233
           ++ +A TC  S V  AY  QF+ D   FL  R +E+  GGRM+L  +G    D+  T   
Sbjct: 165 NIYMANTCPQS-VLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECC 223

Query: 234 -VFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHIS 292
            +++L+ M LN MV EGLIEE K++ FN P Y P   EV   I +EGSF I  +E S I 
Sbjct: 224 LIWQLLAMALNQMVSEGLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDHIEASEIY 283

Query: 293 WSVGYENDDKGLEFNKHARAKNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLE 352
           WS   ++ D G   +      NVA  +RAV+E LL +HFG AI++D+FHR+ + I   + 
Sbjct: 284 WSSCTKDGDGG--GSVEEEGYNVARCMRAVAEPLLLDHFGEAIIEDVFHRYKLLIIERMS 341

Query: 353 MGLGAHTVLFIYLIKK 368
                   + + LI+K
Sbjct: 342 KEKTKFINVIVSLIRK 357


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query368
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.2
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.16
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.14
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.13
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.13
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.12
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.1
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.09
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.05
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.04
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.04
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.95
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.92
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.92
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.91
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.89
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.85
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.72
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.7
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.64
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.63
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.56
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.54
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.48
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.47
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.37
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.37
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.37
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.32
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.3
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.2
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.07
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 97.91
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.89
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.83
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.73
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.72
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 97.68
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 97.67
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.63
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.62
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.55
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 97.51
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 97.48
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.43
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 97.37
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.32
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.25
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 97.01
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 96.87
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 96.79
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 96.78
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 96.59
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 96.41
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 96.16
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 95.11
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 94.81
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 94.45
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 93.15
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 92.99
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 92.96
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 92.22
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 91.56
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 88.8
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 87.44
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 87.01
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 86.45
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 86.13
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 84.6
d2h00a1250 Methyltransferase 10 domain containing protein MET 83.84
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 83.39
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 82.82
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 80.42
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]
Probab=100.00  E-value=2.1e-104  Score=772.81  Aligned_cols=349  Identities=43%  Similarity=0.718  Sum_probs=323.3

Q ss_pred             CCccceeeccCCCCCchHHhhCHHHHHHHHHhHHHHHHHHHhhhcC-CCCCceEEeeecCCCCCCchHHHHHHHHHHHHH
Q 047625            1 MQVEQVLFMNGGEGDNSYAKNSAPPREAILKAKPLLHESLFDLYSN-GFPDCIRFTDMGCSSGPNAFLPTWQAIEALDTI   79 (368)
Q Consensus         1 ~~~~~~~~m~gG~g~~sY~~nS~~Q~~~~~~~~~~l~~a~~~~~~~-~~~~~~~IaD~GCs~G~ns~~~~~~ii~~l~~~   79 (368)
                      |+|++||||+||+|++||++||..|++++..++|+|++||.+++.. ..+++++|||||||+|+||+.+|+.||++|+++
T Consensus         1 m~~~~~l~M~gG~G~~SYa~NS~~Q~~~i~~~kp~leeai~~~~~~~~~~~~~~IADlGCS~G~Ntl~~v~~iI~~i~~~   80 (359)
T d1m6ex_           1 MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGCSSGPNALFAVTELIKTVEEL   80 (359)
T ss_dssp             CCCHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSSSSSSEECCEEESCCSSTTTTTGGGTTHHHHHHH
T ss_pred             CCccEeeccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCCceEEEEeCCCCCccHHHHHHHHHHHHHHH
Confidence            8999999999999999999999999999999999999999998654 356789999999999999999999999999999


Q ss_pred             hhhcCC-CCCcceEEecCCCCCchhhhhhcChhhHHHhhhhccCCCCCceeeeecCCCcccccCCCCccceEEccccccc
Q 047625           80 CSRLKH-KPPILHAFLNDLPGNDFNTLSKSLPSFYERLKTEKRNDDFGSCFIGVAPGSLYGRLFPPCFLNLVYSSFCLNW  158 (368)
Q Consensus        80 ~~~~~~-~~p~~~v~~nDLp~NDfn~lf~~l~~~~~~~~~~~~~~~~~~~f~~~vp~SFy~~l~P~~sid~~~S~~alhW  158 (368)
                      |++.+. ++|+|||||||||+||||+||++|+...         +..++||++|||||||+||||++||||+||++||||
T Consensus        81 ~~~~~~~~~pe~qvf~nDLP~NDFNtLF~~L~~~~---------~~~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~alHW  151 (359)
T d1m6ex_          81 RKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIEN---------DVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMW  151 (359)
T ss_dssp             HHSSSCSSCCEEEEEEEECTTSCHHHHHTTTTTSC---------SCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTB
T ss_pred             HHhcCCCCCCeEEEEeCCCCcchHHHHHHhccccc---------cCCCCeEEEecCCchhhhcCCCCceEEeeehhhhhh
Confidence            987664 5689999999999999999999998542         344789999999999999999999999999999999


Q ss_pred             ccCCcccccccCCCCCcCcccEEEcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccCceEEEEeecCCC------ccc
Q 047625          159 LSQVPKELVSECGIPLLNKRDVCVAKTCSPSNVHKAYLDQFESDFTSFLNFRWEELKIGGRMILNFIGNDK------HHT  232 (368)
Q Consensus       159 ls~~P~~~~~~~~~~~~nk~~i~~~~~s~~~~v~~ay~~Q~~~D~~~FL~~Ra~ELkpGG~lvl~~~g~~~------e~~  232 (368)
                      ||++|+.+.+       |||+||+..++ |++|.+||++||++||.+||++||+||+|||+||+.++||++      ++.
T Consensus       152 LS~vP~~l~~-------n~~~i~~~~~~-~~~v~~ay~~Qf~~D~~~FL~~Ra~ELv~GG~mvl~~~gr~~~~~~~~~~~  223 (359)
T d1m6ex_         152 LSQVPIGIES-------NKGNIYMANTC-PQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECC  223 (359)
T ss_dssp             CSSCCSCCCC-------CTTTTSSCSSS-CCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSSTTTS
T ss_pred             hhcCCccccC-------CCCcEEEcCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcEEEEEEeccCCCCCCCCccc
Confidence            9999998754       89999999888 999999999999999999999999999999999999999977      345


Q ss_pred             hHHHHHHHHHHHHHHcCCCchhhhccCCcccccCCHHHHHHHHHhcCceeEeEEEEEeecCCCCCCCCcccchhhhhhhH
Q 047625          233 GVFELMGMVLNDMVYEGLIEESKLESFNYPIYYPCVEEVRQVIEREGSFNIHQLETSHISWSVGYENDDKGLEFNKHARA  312 (368)
Q Consensus       233 ~~~~~l~~al~~l~~eGli~~e~~d~f~~P~y~ps~~E~~~~l~~~GsF~I~~le~~~~~~~~~~~~~~~~~d~~~~~~~  312 (368)
                      .+|+++.++|++||.+|+|++|++|+||+|+|+||++|++++|+++|+|+|+++|+++.+|.+..++.....|  +..+|
T Consensus       224 ~~~~~l~~al~dmv~eGlI~eek~dsfn~P~Y~ps~eEv~~~ie~~gsF~i~~~e~~~~~~~~~~~~~~~~~d--~~~~~  301 (359)
T d1m6ex_         224 LIWQLLAMALNQMVSEGLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDHIEASEIYWSSCTKDGDGGGS--VEEEG  301 (359)
T ss_dssp             TTTHHHHHHHHHHHHTTCSCCSTTGGGCCCCBCCCSHHHHHHHHHTTTBCCEEEEEEEEETTCCSSCTTCCSS--TTTTT
T ss_pred             hHHHHHHHHHHHHHHcCCCCHHHHHhccCccccCCHHHHHHHhccCCCeeeeeeEeeeccccccccccccccc--HHHHH
Confidence            6899999999999999999999999999999999999999999999999999999999999873332222334  56789


Q ss_pred             HHHHHHHHHHHhhHHHhhhChHHHHHHHHHHHHHHHHhHhhcCCCEEEEEEEEEeC
Q 047625          313 KNVANNIRAVSESLLANHFGSAIMDDLFHRFTIKISAHLEMGLGAHTVLFIYLIKK  368 (368)
Q Consensus       313 ~~~~~~ira~~~p~l~~~~~~~i~delf~r~~~~~~~~l~~~~~~~~~~~~~l~r~  368 (368)
                      +.+++++|||++|++.+|||++|+|+||+||++++++++++++++|++++++|+||
T Consensus       302 ~~~a~~~RA~~e~~l~~hfg~~i~D~lF~r~~~~v~~~~~~~~~~~~~~~~sL~rK  357 (359)
T d1m6ex_         302 YNVARCMRAVAEPLLLDHFGEAIIEDVFHRYKLLIIERMSKEKTKFINVIVSLIRK  357 (359)
T ss_dssp             THHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHSSCCEEEEEEEEEEBC
T ss_pred             HHHHHHHHHHHHHHHHHHcChHHHHHHHHHHHHHHHhhHhhcCCceEEEEEEEEec
Confidence            99999999999999999999999999999999999999999999999999999998



>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure