Citrus Sinensis ID: 047644
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 314 | ||||||
| 147812093 | 607 | hypothetical protein VITISV_040899 [Viti | 0.923 | 0.477 | 0.344 | 1e-27 | |
| 15231646 | 520 | F-box/LRR-repeat protein [Arabidopsis th | 0.812 | 0.490 | 0.333 | 4e-23 | |
| 296086764 | 348 | unnamed protein product [Vitis vinifera] | 0.853 | 0.770 | 0.330 | 1e-21 | |
| 15229834 | 427 | putative FBD-associated F-box protein [A | 0.847 | 0.622 | 0.321 | 2e-21 | |
| 297819758 | 426 | F-box family protein [Arabidopsis lyrata | 0.847 | 0.624 | 0.307 | 3e-21 | |
| 297803460 | 418 | F-box family protein [Arabidopsis lyrata | 0.738 | 0.555 | 0.335 | 2e-20 | |
| 297817218 | 478 | predicted protein [Arabidopsis lyrata su | 0.799 | 0.525 | 0.322 | 3e-20 | |
| 238478373 | 403 | F-box domain-containing protein [Arabido | 0.936 | 0.729 | 0.294 | 3e-20 | |
| 238478375 | 461 | F-box domain-containing protein [Arabido | 0.936 | 0.637 | 0.294 | 4e-20 | |
| 240254023 | 477 | F-box domain-containing protein [Arabido | 0.936 | 0.616 | 0.294 | 4e-20 |
| >gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 130 bits (326), Expect = 1e-27, Method: Compositional matrix adjust.
Identities = 109/316 (34%), Positives = 154/316 (48%), Gaps = 26/316 (8%)
Query: 17 SEDRISCLPDSILCQILSVPPTKDAVATSILSPRWKHAWTSVRNLCFDDELSVMGDEVSG 76
S D IS LPD +LC ILS PTK AV TSILS RW++ W SV L FDDEL + +
Sbjct: 8 SRDIISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNPSTLVE 67
Query: 77 IT--VAAFEKFVHSVLARTHPSSVEKFSLRCSYL-RSLGMFDYWVSSAISRNVREIEIDL 133
+ + F+ FV VL + S ++KF R Y +L W+ A+ R V+E+++ L
Sbjct: 68 LEERIIMFQNFVDGVLRHSEVSCIKKF--RLGYRDNNLDSVYSWICIALERRVQELDLHL 125
Query: 134 RDHERIPLPASIYRSITLEVLRLRSYFALTLPPDGVCFPRLKTFHLM-LQQPTNHLPHNL 192
R+ LP + TL V++L L +P V P LK HL ++ + L
Sbjct: 126 LIDWRVELPPMFFICKTLVVVKLSCALFLDIPT-TVWLPSLKALHLKSVEYSDDDSIQKL 184
Query: 193 FSRCPCLQHLSLTVYFTAANPASNLIISSATLKTFVLEVMYCSHSSA------PNQHTVT 246
S CP L+ L + N +S+ +LK +L + + + A + V
Sbjct: 185 LSGCPVLEELVIEREERDNQWVVN--VSNPSLK--ILRIFFFTDGFAHPYEQEDQDYKVV 240
Query: 247 IVAPNLEFLDITDDLAVSYAVHQLPSLHKAVYYV-----MFSEWP---PIDRRPPV-QLL 297
+ APNLE+L ITD L+ Y V LPSL KA V F E P I P+ +LL
Sbjct: 241 VDAPNLEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPIYELL 300
Query: 298 AGMTKTKCLTLSAGVL 313
++ KCL+L+ L
Sbjct: 301 GRISNVKCLSLTGVTL 316
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15231646|ref|NP_191479.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264308|sp|Q9LX51.1|FBL64_ARATH RecName: Full=F-box/LRR-repeat protein At3g59200 gi|7801670|emb|CAB91590.1| putative protein [Arabidopsis thaliana] gi|26450835|dbj|BAC42525.1| unknown protein [Arabidopsis thaliana] gi|29028916|gb|AAO64837.1| At3g59200 [Arabidopsis thaliana] gi|332646367|gb|AEE79888.1| F-box/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|296086764|emb|CBI32913.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15229834|ref|NP_190640.1| putative FBD-associated F-box protein [Arabidopsis thaliana] gi|75265626|sp|Q9SCQ5.1|FBD10_ARATH RecName: Full=Putative FBD-associated F-box protein At3g50710 gi|6561974|emb|CAB62440.1| putative protein [Arabidopsis thaliana] gi|332645179|gb|AEE78700.1| putative FBD-associated F-box protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297819758|ref|XP_002877762.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297323600|gb|EFH54021.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297803460|ref|XP_002869614.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297315450|gb|EFH45873.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297817218|ref|XP_002876492.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322330|gb|EFH52751.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|238478373|ref|NP_001154312.1| F-box domain-containing protein [Arabidopsis thaliana] gi|125991852|sp|P0C2G0.1|FBL27_ARATH RecName: Full=F-box/LRR-repeat protein At1g06630 gi|119935969|gb|ABM06048.1| At1g06630 [Arabidopsis thaliana] gi|332189891|gb|AEE28012.1| F-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|238478375|ref|NP_001154313.1| F-box domain-containing protein [Arabidopsis thaliana] gi|332189892|gb|AEE28013.1| F-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|240254023|ref|NP_563769.4| F-box domain-containing protein [Arabidopsis thaliana] gi|332189890|gb|AEE28011.1| F-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 314 | ||||||
| TAIR|locus:2081157 | 520 | AT3G59200 "AT3G59200" [Arabido | 0.808 | 0.488 | 0.335 | 1.9e-25 | |
| TAIR|locus:2101674 | 427 | AT3G50710 "AT3G50710" [Arabido | 0.726 | 0.533 | 0.344 | 5.6e-25 | |
| TAIR|locus:2081172 | 484 | AT3G59210 "AT3G59210" [Arabido | 0.815 | 0.528 | 0.319 | 4.9e-24 | |
| TAIR|locus:2162489 | 450 | AT5G22660 "AT5G22660" [Arabido | 0.917 | 0.64 | 0.305 | 7.3e-24 | |
| TAIR|locus:2081297 | 388 | AT3G59190 "AT3G59190" [Arabido | 0.824 | 0.667 | 0.304 | 8.7e-24 | |
| TAIR|locus:2015681 | 449 | AT1G16930 "AT1G16930" [Arabido | 0.792 | 0.554 | 0.310 | 1.6e-23 | |
| TAIR|locus:2009125 | 477 | AT1G06630 "AT1G06630" [Arabido | 0.929 | 0.612 | 0.296 | 4.6e-23 | |
| TAIR|locus:2136834 | 419 | AT4G26340 "AT4G26340" [Arabido | 0.754 | 0.565 | 0.320 | 4.9e-23 | |
| TAIR|locus:2162499 | 443 | AT5G22670 "AT5G22670" [Arabido | 0.805 | 0.571 | 0.332 | 9.1e-23 | |
| TAIR|locus:2162454 | 437 | AT5G22700 "AT5G22700" [Arabido | 0.888 | 0.638 | 0.318 | 1.8e-22 |
| TAIR|locus:2081157 AT3G59200 "AT3G59200" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 294 (108.6 bits), Expect = 1.9e-25, P = 1.9e-25
Identities = 91/271 (33%), Positives = 136/271 (50%)
Query: 13 VDNGSEDRISCLPDSILCQILSVPPTKDAVATSILSPRWKHAWTSVRNLCFDDELSVMGD 72
+D S DRIS LP+ ++ ILS PTK+A +TS+LS +W++ + V NL FDD G
Sbjct: 1 MDFVSRDRISSLPNPVVSHILSFLPTKEAASTSVLSKKWRYLFAYVTNLDFDDSDYQDGK 60
Query: 73 EVSGITVA-AFEKFVHSVLARTHPSSVEKFSLRCS-YLRSLGMFDYWVSSAISRNVREIE 130
S + ++ +F +FV VLA SV KFSL CS Y L W+ + + R V E++
Sbjct: 61 PKSDVELSRSFMEFVDRVLALQGNGSVNKFSLECSNYDVDLARVTGWILNVLGRGVSELD 120
Query: 131 IDLRDHERIPLPASIYRSITLEVLRL--RSYFALTLPPDGVCFPRLKTFHL--MLQQPTN 186
+ + ++ PLP+ I+ S TL L+L + LTL V P+LKT ++ + Q
Sbjct: 121 LSILEY---PLPSEIFVSKTLVRLKLGPANDLTLTLDRKDVFLPKLKTLYIDCVDVQERG 177
Query: 187 HLPHNLFSRCPCLQHLSLTVYFTAANPA-SNLIISSATLKTFVLEVMYCSHSSAPNQHTV 245
L S CP L+ L L N N S ++KT +C + N +V
Sbjct: 178 FGFVKLLSGCPVLEELVLM------NIGWENWKFCSVSVKTLKRLTFFCEETYE-NPKSV 230
Query: 246 TIVAPNLEFLDITDDLAVSYAVHQLPSLHKA 276
+ PNL +L+ +D +A Y SL +A
Sbjct: 231 SFDTPNLVYLEYSDAIASKYPKVNFNSLVEA 261
|
|
| TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081172 AT3G59210 "AT3G59210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162489 AT5G22660 "AT5G22660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081297 AT3G59190 "AT3G59190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009125 AT1G06630 "AT1G06630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136834 AT4G26340 "AT4G26340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162499 AT5G22670 "AT5G22670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162454 AT5G22700 "AT5G22700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 314 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.84 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.45 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.87 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.43 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.38 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.31 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.29 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.23 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.22 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.05 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.92 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.89 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.84 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.67 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.65 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.59 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.47 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 97.46 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.36 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.23 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.22 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.15 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.07 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.94 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 96.93 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.51 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.44 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.39 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.36 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.26 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.26 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.09 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.06 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.98 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 95.91 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.9 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.69 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.61 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 95.27 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 94.94 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 94.93 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 94.91 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 94.64 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 94.39 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.37 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 94.36 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 93.66 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 93.65 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 93.1 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 92.91 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 92.74 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 92.31 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 91.55 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 91.25 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 90.79 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 90.64 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 90.39 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 90.38 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 89.95 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 89.5 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 87.83 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 86.77 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 86.55 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 85.34 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.84 E-value=3.5e-23 Score=173.36 Aligned_cols=239 Identities=17% Similarity=0.157 Sum_probs=166.1
Q ss_pred cCCCChHHHHHHhcCCChhhhhhhhccccccccccccce---eEEEecccccCCCccccccHHHHHHHHHHHHccCCCCC
Q 047644 21 ISCLPDSILCQILSVPPTKDAVATSILSPRWKHAWTSVR---NLCFDDELSVMGDEVSGITVAAFEKFVHSVLARTHPSS 97 (314)
Q Consensus 21 ~~~LPd~ll~~Ils~L~~~d~~~~~~vskrWr~l~~~~~---~l~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~~~ 97 (314)
++.|||||+..||+.|+.+|+.+++.|||||.++-+... .++.......+ +...++ .+++
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p-------------~~l~~l-~~rg--- 160 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIHP-------------DVLGRL-LSRG--- 160 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccCh-------------hHHHHH-HhCC---
Confidence 789999999999999999999999999999998754433 23333333332 223333 3332
Q ss_pred eeEEEEEeccCCCcchHHHHHHH--HHhCCceEEEEEecCCCccccCCcccccCCeeEEEEcceeecccC-CCCcCCCCc
Q 047644 98 VEKFSLRCSYLRSLGMFDYWVSS--AISRNVREIEIDLRDHERIPLPASIYRSITLEVLRLRSYFALTLP-PDGVCFPRL 174 (314)
Q Consensus 98 l~~l~l~~~~~~~~~~~~~w~~~--~~~~~l~~L~l~~~~~~~~~l~~~~~~c~~L~~L~L~~~~~~~~~-~~~~~~~~L 174 (314)
|..|++--.....+ +...+ ....+++++||+....+..++...+..|.+|+.|+|.+....|.. ...+...+|
T Consensus 161 V~v~Rlar~~~~~p----rlae~~~~frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSlEg~~LdD~I~~~iAkN~~L 236 (419)
T KOG2120|consen 161 VIVFRLARSFMDQP----RLAEHFSPFRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSLEGLRLDDPIVNTIAKNSNL 236 (419)
T ss_pred eEEEEcchhhhcCc----hhhhhhhhhhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccccccccCcHHHHHHhccccc
Confidence 55555542211111 11222 234579999999988777788888889999999999997555432 244578999
Q ss_pred ceEEeeeEEc-CCCcHHHHhcCCccccceeeeeeeccCCCCCcEE--EecCCcceEEEEeeeeCCC-CCCCcceEEEEcC
Q 047644 175 KTFHLMLQQP-TNHLPHNLFSRCPCLQHLSLTVYFTAANPASNLI--ISSATLKTFVLEVMYCSHS-SAPNQHTVTIVAP 250 (314)
Q Consensus 175 ~~L~L~~~~~-~~~~l~~ll~~cp~Le~L~L~~c~~~~~~~~~~~--i~~~~Lk~L~i~~~~c~~~-~~~~~~~l~~~~p 250 (314)
++|+|..|.. +..++.-++++|..|.+|+|++|....+. ..+. --+++|+.|+++ .|..+ .......+.-.||
T Consensus 237 ~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~-Vtv~V~hise~l~~LNls--G~rrnl~~sh~~tL~~rcp 313 (419)
T KOG2120|consen 237 VRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEK-VTVAVAHISETLTQLNLS--GYRRNLQKSHLSTLVRRCP 313 (419)
T ss_pred eeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchh-hhHHHhhhchhhhhhhhh--hhHhhhhhhHHHHHHHhCC
Confidence 9999999987 99999999999999999999999762221 1122 256889999998 45432 2233455566889
Q ss_pred CccEEEeeccccc----ceeecCCCCceeEEEeEEec
Q 047644 251 NLEFLDITDDLAV----SYAVHQLPSLHKAVYYVMFS 283 (314)
Q Consensus 251 ~L~~L~l~~~~~~----~~~~~~~p~L~~l~l~~~~~ 283 (314)
+|..|+++++... ...+-+++.|+++.++-|+.
T Consensus 314 ~l~~LDLSD~v~l~~~~~~~~~kf~~L~~lSlsRCY~ 350 (419)
T KOG2120|consen 314 NLVHLDLSDSVMLKNDCFQEFFKFNYLQHLSLSRCYD 350 (419)
T ss_pred ceeeeccccccccCchHHHHHHhcchheeeehhhhcC
Confidence 9999998887543 22345677777777776643
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 314 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 47.5 bits (112), Expect = 4e-06
Identities = 50/307 (16%), Positives = 96/307 (31%), Gaps = 93/307 (30%)
Query: 55 WTSVR-------------NLC--FDDELSVMGDEVSGI---TVAAFEKFVHSVLARTHPS 96
W +++ L D + D S I + + + ++ + +
Sbjct: 186 WLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYEN 245
Query: 97 S------------VEKFSLRCSYL---RSLGMFDYWVSSAISRNVREIEIDLRDHERIPL 141
F+L C L R + D+ +S+A + ++ DH + L
Sbjct: 246 CLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDF-LSAATTTHISL------DHHSMTL 298
Query: 142 PASIYRSITLEVLRLRSYFALTLPPDGV-CFPR-LKTFHLMLQQPTNH---LPHNLFSRC 196
+S+ L+ L R LP + + PR L ++ H +
Sbjct: 299 TPDEVKSLLLKYLDCR---PQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKL 355
Query: 197 P-----CLQHL----------SLTVYFTAANPASNLIISSATLKTF--------VLEVMY 233
L L L+V F P + I + L V+ V+
Sbjct: 356 TTIIESSLNVLEPAEYRKMFDRLSV-F----P-PSAHIPTILLSLIWFDVIKSDVMVVVN 409
Query: 234 CSHSSA-----PNQHTVTIVAPNLEFLDITDDLAVSYAVHQLPSLHKAV--YYVMFSEWP 286
H + P + T++I I +L V + +LH+++ +Y + +
Sbjct: 410 KLHKYSLVEKQPKESTISI-------PSIYLELKVK--LENEYALHRSIVDHYNIPKTFD 460
Query: 287 PIDRRPP 293
D PP
Sbjct: 461 SDDLIPP 467
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 314 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.78 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.75 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.75 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.16 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.04 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.92 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.81 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.74 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.74 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.74 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.73 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.69 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.69 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.68 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.68 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.67 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.67 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.65 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.62 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.61 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.59 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.58 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.57 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.57 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.56 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.56 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.55 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.55 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.55 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.53 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.52 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.51 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.5 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.5 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.5 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.5 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.5 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.49 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.49 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.48 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.47 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.47 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.47 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.46 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.46 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.46 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.46 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.45 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.45 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.44 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.44 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.44 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.44 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.42 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.42 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.42 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.41 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.4 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.4 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.39 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.39 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.39 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.38 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.36 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.36 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.35 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.35 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.34 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.33 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.31 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.31 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.3 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.3 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.3 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.29 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.29 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.29 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.29 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.28 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.25 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.25 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.25 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.23 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.22 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.22 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.2 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.19 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.18 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.17 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.17 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.16 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.16 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.15 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.13 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.12 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.12 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.12 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.1 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.1 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.09 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.07 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.05 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.05 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.03 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.01 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.97 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.95 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.91 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.91 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.88 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.86 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.86 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.85 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.83 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.77 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.74 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.71 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.66 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.65 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.61 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.6 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.58 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.58 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.57 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.55 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.54 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.47 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.3 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.3 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.29 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.2 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.13 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.08 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.92 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.91 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.75 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.72 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.55 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.51 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.49 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.43 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.24 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.02 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.02 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 95.96 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.78 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 95.68 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 95.65 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.64 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.03 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.47 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 93.02 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 92.75 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 86.22 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 84.26 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 80.33 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.78 E-value=3e-22 Score=178.34 Aligned_cols=167 Identities=17% Similarity=0.137 Sum_probs=85.2
Q ss_pred CcccCCCChHHHHHHhcCCChhhhhhhhcccccccccccc---ceeEEEecccccCCCccccccHHHHHHHHHHHHccCC
Q 047644 18 EDRISCLPDSILCQILSVPPTKDAVATSILSPRWKHAWTS---VRNLCFDDELSVMGDEVSGITVAAFEKFVHSVLARTH 94 (314)
Q Consensus 18 ~d~~~~LPd~ll~~Ils~L~~~d~~~~~~vskrWr~l~~~---~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~ 94 (314)
...+++||||++.+||+||+.+|+++++.|||+|+++... ...+++...... .. .+...+..
T Consensus 6 ~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~---------~~----~~~~~~~~-- 70 (336)
T 2ast_B 6 GVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLH---------PD----VTGRLLSQ-- 70 (336)
T ss_dssp -CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCC---------HH----HHHHHHHT--
T ss_pred cCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCC---------HH----HHHhhhhc--
Confidence 4558999999999999999999999999999999988531 224444332221 11 22222111
Q ss_pred CCCeeEEEEEeccCCCc-chHHHHHHHHHhCCceEEEEEecCCCccccCCcccccCCeeEEEEcceeecc-cCCCCcCCC
Q 047644 95 PSSVEKFSLRCSYLRSL-GMFDYWVSSAISRNVREIEIDLRDHERIPLPASIYRSITLEVLRLRSYFALT-LPPDGVCFP 172 (314)
Q Consensus 95 ~~~l~~l~l~~~~~~~~-~~~~~w~~~~~~~~l~~L~l~~~~~~~~~l~~~~~~c~~L~~L~L~~~~~~~-~~~~~~~~~ 172 (314)
.++.+.+....-... .. .....++++|+++.+......++..+..|++|++|+|+++...+ .+.....++
T Consensus 71 --~l~~L~l~~n~l~~~~~~------~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~l~~~~ 142 (336)
T 2ast_B 71 --GVIAFRCPRSFMDQPLAE------HFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNS 142 (336)
T ss_dssp --TCSEEECTTCEECSCCCS------CCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCT
T ss_pred --cceEEEcCCccccccchh------hccCCCCCEEEccCCCcCHHHHHHHHhhCCCCCEEeCcCcccCHHHHHHHhcCC
Confidence 144443332110000 00 00013455555554432212233344445555555555553221 111223355
Q ss_pred CcceEEeeeE-EcCCCcHHHHhcCCccccceeeeee
Q 047644 173 RLKTFHLMLQ-QPTNHLPHNLFSRCPCLQHLSLTVY 207 (314)
Q Consensus 173 ~L~~L~L~~~-~~~~~~l~~ll~~cp~Le~L~L~~c 207 (314)
+|++|+|.++ .+++..+..++..||.|++|++.+|
T Consensus 143 ~L~~L~L~~~~~l~~~~l~~~~~~~~~L~~L~l~~~ 178 (336)
T 2ast_B 143 NLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWC 178 (336)
T ss_dssp TCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCC
T ss_pred CCCEEECCCCCCCCHHHHHHHHhcCCCCCEEcCCCC
Confidence 5555555555 3344445555555555555555555
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 314 | ||||
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 2e-04 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 2e-04 |
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Cdc4 F-box and linker domains species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 38.1 bits (88), Expect = 2e-04
Identities = 16/95 (16%), Positives = 32/95 (33%), Gaps = 14/95 (14%)
Query: 19 DRISCLPDSILCQILSVPPTKDAVATSILSPRWKHAWTSV----RNLCFDDELSVMGDEV 74
D I+ LP I +I + +D + + +S W + L +
Sbjct: 4 DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWKKLLISE--------- 54
Query: 75 SGITVAAFEKFVHSVLARTHPSSVEKFSLRCSYLR 109
+ ++ F + + S + LR S+L
Sbjct: 55 NFVSPKGFNSLNLKLSQKYPKLSQQD-RLRLSFLE 88
|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 314 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.28 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.83 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.8 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.74 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.55 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.51 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.5 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.44 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.43 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.32 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.22 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.16 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.13 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.07 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.02 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.98 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.85 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.8 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.8 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.71 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.62 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.56 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.53 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.46 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.33 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.18 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.09 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.03 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.89 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.84 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.48 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.26 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.23 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.07 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.53 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.28 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 94.98 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 94.86 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 94.7 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 94.64 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 94.13 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 92.32 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 89.58 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 89.41 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 84.73 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.28 E-value=3.6e-15 Score=127.55 Aligned_cols=84 Identities=18% Similarity=0.148 Sum_probs=39.7
Q ss_pred CceEEEEEecCCCccccCCcccccCCeeEEEEcceeeccc-CCCCcCCCCcceEEeeeEEc-CCCcHHHHhcCCccccce
Q 047644 125 NVREIEIDLRDHERIPLPASIYRSITLEVLRLRSYFALTL-PPDGVCFPRLKTFHLMLQQP-TNHLPHNLFSRCPCLQHL 202 (314)
Q Consensus 125 ~l~~L~l~~~~~~~~~l~~~~~~c~~L~~L~L~~~~~~~~-~~~~~~~~~L~~L~L~~~~~-~~~~l~~ll~~cp~Le~L 202 (314)
++++|+++.+......+...+..|++|++|.|++|...+. +.....+++|++|+|.+|.. ++.++..++.+||.|++|
T Consensus 47 ~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L 126 (284)
T d2astb2 47 RVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDEL 126 (284)
T ss_dssp CCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEE
T ss_pred CCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhcccc
Confidence 4555555444322222333334455555555555532211 11223455555555555432 555555555555555555
Q ss_pred eeeeee
Q 047644 203 SLTVYF 208 (314)
Q Consensus 203 ~L~~c~ 208 (314)
++++|.
T Consensus 127 ~ls~c~ 132 (284)
T d2astb2 127 NLSWCF 132 (284)
T ss_dssp ECCCCT
T ss_pred cccccc
Confidence 555553
|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|