Citrus Sinensis ID: 047726
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1297 | ||||||
| 359488845 | 2164 | PREDICTED: methyl-CpG-binding domain-con | 0.951 | 0.570 | 0.577 | 0.0 | |
| 255552612 | 2145 | DNA binding protein, putative [Ricinus c | 0.921 | 0.557 | 0.571 | 0.0 | |
| 297832794 | 2183 | methyl-CpG-binding domain 9 [Arabidopsis | 0.977 | 0.580 | 0.509 | 0.0 | |
| 15232121 | 2176 | methyl-CPG-binding domain 9 [Arabidopsis | 0.976 | 0.582 | 0.508 | 0.0 | |
| 449446853 | 2131 | PREDICTED: methyl-CpG-binding domain-con | 0.929 | 0.565 | 0.519 | 0.0 | |
| 296087685 | 1907 | unnamed protein product [Vitis vinifera] | 0.703 | 0.478 | 0.613 | 0.0 | |
| 296086550 | 1789 | unnamed protein product [Vitis vinifera] | 0.712 | 0.516 | 0.537 | 0.0 | |
| 359473443 | 2060 | PREDICTED: methyl-CpG-binding domain-con | 0.723 | 0.455 | 0.510 | 0.0 | |
| 255568758 | 1794 | DNA binding protein, putative [Ricinus c | 0.682 | 0.493 | 0.511 | 0.0 | |
| 222622353 | 1949 | hypothetical protein OsJ_05715 [Oryza sa | 0.777 | 0.517 | 0.451 | 0.0 |
| >gi|359488845|ref|XP_002274643.2| PREDICTED: methyl-CpG-binding domain-containing protein 9-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1439 bits (3726), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 772/1337 (57%), Positives = 930/1337 (69%), Gaps = 103/1337 (7%)
Query: 2 EASDSSRSPLGIDLNEIPSGSTSSSETT-------------------------------S 30
++ +RS LGIDLNEIPS S + S
Sbjct: 12 DSKSETRSVLGIDLNEIPSSSFVEASHDVPDAYAVVRSFHGELSPAAGAAAGLPGEGWGS 71
Query: 31 LCGACGVAAEAEGDVVVCDACERGFHLECAGILMCCHQQQQQQPYHHNLLEWVCADCVKN 90
+C CG A E V+VCD CERGFHL C G M Q L EWVC +CV++
Sbjct: 72 VCAVCG-APEVGAQVLVCDGCERGFHLVCVG--MPGRQAGM-------LEEWVCGECVRS 121
Query: 91 GAKSKLWPLGRKKRILDMNASPPSDVDADATDDVLDFRKHSPGDNSFGGNAFVAPVTSSK 150
G SK WPLG K+R+LD+NASPPS+ + + ++ D RKHSPGDNSFGGN+F AP T S
Sbjct: 122 GVGSKRWPLGSKRRLLDINASPPSEGEGE---ELPDSRKHSPGDNSFGGNSFGAPETYSN 178
Query: 151 FLHAGSGFGFQKASAITTNTGRKGFEANKQSTDRSFQEVELRFPLGKCSRSFTPAIRFPS 210
F AG+GFGF KAS I T+ + G E T+RSF+EV+ FPLG+ S A R P
Sbjct: 179 FRCAGNGFGFPKASGILTHAVKLGLEDILHHTNRSFEEVDSGFPLGRLRSSNNTACRLPP 238
Query: 211 QNPSEILLQALREFISERHGVLEEGWSVELRHSTNSYELYAVYCAPDGRTFDSMSEVACY 270
Q PSE+LLQAL+EFISERHGVLEEGW VEL+ S + EL V+CAPDGR F+SMSEVA Y
Sbjct: 239 QEPSEMLLQALKEFISERHGVLEEGWRVELKQSVRAGELCPVFCAPDGRIFESMSEVAVY 298
Query: 271 LGLTSSYNSLDTRVKTEESP-LHDRVPVCKKRKPTKFPFANGFAENKGFISLNNIK-FSS 328
LGLTS+ NS+DT ++++ S L R + K+RK T+ AN AENK + + K SS
Sbjct: 299 LGLTSNCNSVDTEIRSDGSASLKKRSHLSKRRKSTRLSIANSSAENKDALLTDFCKDISS 358
Query: 329 YNQHMGNFNSRSNSMVEIIESGGAENDCAGFLQNYDGLPVQFEDFFILSLGHVDGRPSYH 388
Q M S + V++ E+ EN G Q+ +GLPVQFEDFF+LSLG VD RPSYH
Sbjct: 359 DVQSMELCASNLGNSVKVTEAAPEENGGTGLQQHNNGLPVQFEDFFVLSLGEVDVRPSYH 418
Query: 389 NVNVIYPVGYTSCWHDKITGSLFICEVLDGGDSGPVFKVTRCSCSALPIPDGSTILFRPN 448
+VN ++PVGY SCWHDK+TGSLF+C+V DGGDSGP+FKV RC+CSA+P+P+GST+L RPN
Sbjct: 419 DVNQLWPVGYKSCWHDKLTGSLFMCDVSDGGDSGPIFKVKRCACSAIPLPNGSTVLCRPN 478
Query: 449 FVQCSGRDHEANGDFTSYSKDYDSDVNIQMILSDPCLPVDNDILTCLGSCSNKSC-DDDI 507
Q +G+D E + D S S DYD D ++Q +L+DP P++NDIL+C+ S SN SC +
Sbjct: 479 LGQSNGQDKEKSNDMISLSMDYDEDGSLQTLLADPSPPMENDILSCIRSSSNGSCCVQTL 538
Query: 508 GEISVEDRSLSSAWRRLSQKFVDACFEICKQKGVLKFSCKHIENSREFANWDMVDEKEKM 567
+ +ED SL +
Sbjct: 539 NSLLLEDNSL-----------------------------------------------HER 551
Query: 568 RFTSLNKFCGSSVSVSIPSEFRGDNELDMLADVLLKWLDQDRFGLEAEFVQEVIEQLPGV 627
+TSL+KFC S SV +PS +G+NEL +VL KWLDQDRFGL+ EFVQE++EQLPGV
Sbjct: 552 SYTSLDKFCSSPGSVCMPSVIQGENELQTQCEVLAKWLDQDRFGLDVEFVQEMLEQLPGV 611
Query: 628 KDCSQYEFLIDRSCYLSFLTVGNGSLMVKMKGGVGS-AEEGLDGSFGRSKKRR--LVED- 683
CSQY+ L +RS + + LTVGNG L+ + + GV S EE LD FG SK+ R V D
Sbjct: 612 CACSQYKLLNNRSYHSTLLTVGNGLLLAETENGVQSKGEEALDCLFGGSKRARKYTVGDP 671
Query: 684 --HDHWPPPGNALCSRLPPQIVGDFFQVCQFLWRFHEVLGLKESFSLEELEEELINPWID 741
D PPPGN L SRLPP +VGD QV + LWRF+E+LGLKE FS+EELEEELI PW D
Sbjct: 672 LMDDFCPPPGNPLGSRLPPDLVGDVIQVWESLWRFYEILGLKEPFSIEELEEELICPWSD 731
Query: 742 GCSS-EKCEKKLQGTEPVSLHQCDIVGGKILSASDESHQAVSRENPHAFINLENGAAREA 800
+ EK + Q ++ + G I S+S +S VS NPHAFI +E G +EA
Sbjct: 732 DLNLLEKFGTETQENRDITPTRPSGASGHIPSSSTDSGPEVSTGNPHAFIQMETGQKKEA 791
Query: 801 AQDEMGFVSYSRCSGVVLTKAHSSLLEVLIAELQSKVAALVDPNFDSGESKPRRGRKKDA 860
AQ ++ V+YSRCSGV LTKAH+SLL+VL++ELQ KVAALVDPNFDSGESK RRGRKKDA
Sbjct: 792 AQAKLASVTYSRCSGVTLTKAHNSLLKVLVSELQFKVAALVDPNFDSGESKSRRGRKKDA 851
Query: 861 DNSIPHKRGKLNMLPINELTWPELARRYILAFLSMDGILDSPEITARESGRVFRCLQGDG 920
DN+IP K+ KLNMLPINELTWPELARRYIL LSMDG LDS EIT RESG+VFRCLQGDG
Sbjct: 852 DNAIPTKKTKLNMLPINELTWPELARRYILCVLSMDGNLDSAEITIRESGKVFRCLQGDG 911
Query: 921 GVLCGSLTGVAGMEADALLLAEATKKIFGSLNRENDVLTIEEEVSDASGTCEKNIVNDGT 980
GVLC SLTGVAGM+ADALL AEA K+IFGSLNRE+D+LTIEE+ SDA+G ++ +VNDG
Sbjct: 912 GVLCDSLTGVAGMQADALLFAEARKQIFGSLNREDDILTIEEKGSDATGDHDRIVVNDGN 971
Query: 981 LPEWAKMLEPVRKLPTNVGTRIRKCVYEALERNPPDWARKILEHSISKEVYKGNASGPTK 1040
+PEWA++LEPVRKLPTNVGTRIRKC+YEALE++PP+WA+KIL HSISKEVYKGNASGPTK
Sbjct: 972 IPEWAQVLEPVRKLPTNVGTRIRKCIYEALEKDPPEWAKKILAHSISKEVYKGNASGPTK 1031
Query: 1041 KAVVSVLADVK-ERLPQNSEKGCKKKTVISISSIIMKQCRIVLRQAAAADDEKVFCNLLG 1099
KAV+SVL V E L +K K+K VISI IIMKQCRI LR+ AAADD KVFC LLG
Sbjct: 1032 KAVLSVLGIVHDEGLKSKPDKERKRKRVISIPDIIMKQCRITLRRGAAADDAKVFCTLLG 1091
Query: 1100 RKPLSSTDNDDEGFLGSPAMVSRPLDFRTIDLRLAVGAYDGSHDSFLQDVREFWNNVRTA 1159
K ++S DNDDEG LG+PAMVSRPLDFRTIDLRLAVGAY GS ++FL+DVRE WNN+ TA
Sbjct: 1092 SKLINSIDNDDEGLLGTPAMVSRPLDFRTIDLRLAVGAYGGSWETFLEDVRELWNNIHTA 1151
Query: 1160 FGDQPDFVDLAEKLSRNFESLYENEIVTLLQKLVGYAKLESLSEETTKEINDILVQTSEI 1219
+ DQPD V+LA LS+NFES++E E++ L+QK YAK E LS ET KEI+D LV SEI
Sbjct: 1152 YADQPDSVELARTLSQNFESMFEKEVLPLVQKFTEYAKSECLSAETEKEIDDFLVSASEI 1211
Query: 1220 PKAPWDEGICKVCGVDKDDDSVLLCDTCDAEYHTYCLEPPLVRIPEGNWYCPSCVVRNSM 1279
PKAPWDEG+CKVCG+DKDDDSVLLCD CDAEYHTYCL PPL RIPEGNWYCPSCV SM
Sbjct: 1212 PKAPWDEGVCKVCGIDKDDDSVLLCDMCDAEYHTYCLNPPLARIPEGNWYCPSCVAGISM 1271
Query: 1280 VQGASEHSQVGGQHKGK 1296
V SEH+ V Q +GK
Sbjct: 1272 VD-VSEHTHVIAQRQGK 1287
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255552612|ref|XP_002517349.1| DNA binding protein, putative [Ricinus communis] gi|223543360|gb|EEF44891.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297832794|ref|XP_002884279.1| methyl-CpG-binding domain 9 [Arabidopsis lyrata subsp. lyrata] gi|297330119|gb|EFH60538.1| methyl-CpG-binding domain 9 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15232121|ref|NP_186795.1| methyl-CPG-binding domain 9 [Arabidopsis thaliana] gi|75337201|sp|Q9SGH2.1|MBD9_ARATH RecName: Full=Methyl-CpG-binding domain-containing protein 9; Short=AtMBD9; Short=MBD09; AltName: Full=Histone acetyl tranferase MBD9; AltName: Full=Methyl-CpG-binding protein MBD9 gi|6692266|gb|AAF24616.1|AC010870_9 unknown protein [Arabidopsis thaliana] gi|332640148|gb|AEE73669.1| methyl-CPG-binding domain 9 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449446853|ref|XP_004141185.1| PREDICTED: methyl-CpG-binding domain-containing protein 9-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296087685|emb|CBI34941.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296086550|emb|CBI32139.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359473443|ref|XP_002264500.2| PREDICTED: methyl-CpG-binding domain-containing protein 9-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255568758|ref|XP_002525350.1| DNA binding protein, putative [Ricinus communis] gi|223535313|gb|EEF36988.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|222622353|gb|EEE56485.1| hypothetical protein OsJ_05715 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1297 | ||||||
| TAIR|locus:2096672 | 2176 | MBD9 "methyl-CPG-binding domai | 0.609 | 0.363 | 0.576 | 0.0 | |
| UNIPROTKB|F1NFV8 | 1522 | BAZ1A "Uncharacterized protein | 0.056 | 0.047 | 0.412 | 2.7e-11 | |
| UNIPROTKB|H7C212 | 228 | MLL3 "Histone-lysine N-methylt | 0.036 | 0.206 | 0.531 | 1e-10 | |
| TAIR|locus:2195945 | 522 | AT1G77250 "AT1G77250" [Arabido | 0.043 | 0.107 | 0.464 | 1.1e-10 | |
| WB|WBGene00000482 | 1787 | chd-3 [Caenorhabditis elegans | 0.046 | 0.033 | 0.461 | 8.3e-10 | |
| UNIPROTKB|Q22516 | 1787 | chd-3 "Chromodomain-helicase-D | 0.046 | 0.033 | 0.461 | 8.3e-10 | |
| UNIPROTKB|H0YDG9 | 276 | RSF1 "Remodeling and spacing f | 0.034 | 0.163 | 0.555 | 9.7e-10 | |
| POMBASE|SPBP19A11.06 | 1513 | lid2 "Lid2 complex subunit, pr | 0.120 | 0.103 | 0.324 | 1.8e-09 | |
| ZFIN|ZDB-GENE-060810-94 | 1578 | kdm5c "lysine (K)-specific dem | 0.038 | 0.031 | 0.52 | 8.4e-09 | |
| UNIPROTKB|F1STY8 | 1344 | RSF1 "Uncharacterized protein" | 0.037 | 0.036 | 0.530 | 1e-08 |
| TAIR|locus:2096672 MBD9 "methyl-CPG-binding domain 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2330 (825.3 bits), Expect = 0., Sum P(3) = 0.
Identities = 466/808 (57%), Positives = 577/808 (71%)
Query: 500 NKSCDDD----IGEISVEDRSLSSAWRRLSQKFVDACFEICKQKGVLKFSCKHIENSREF 555
N S D D IG+I VE+ SLS AW+++SQK VDAC + KQKG L F CKH++
Sbjct: 558 NLSYDQDHGVEIGDIVVEEDSLSDAWKKVSQKLVDACSIVLKQKGTLNFLCKHVDRETSE 617
Query: 556 ANWDMVDEKEKMRFTSLNKFCGSSVSVSIPSEFRGDNELDMLADVLLKWLDQDRFGLEAE 615
NWD ++EK+ + SL+KFC S S+ + +E + D L +WLDQ+RFGL+A+
Sbjct: 618 INWDTMNEKDNV-ILSLSKFCCSLAPCSVTCGEKDKSEFAAVVDALSRWLDQNRFGLDAD 676
Query: 616 FVQEVIEQLPGVKDCSQYEFLIDRSCYLSFLTVGNGSLMVKMKGGVGSAEEGLDGSFGR- 674
FVQE+IE +PG + C+ Y L RS +TV G+L+VK KGG +E + G R
Sbjct: 677 FVQEMIEHMPGAESCTNYRTLKSRSSSSVPITVAEGALVVKPKGGENVKDE-VFGEISRK 735
Query: 675 SKKRRLVEDHD----HWPPPGNALCSRLPPQIVGDFFQVCQFLWRFHEVLGLKESFSXXX 730
+KK +L H H PPPG +C RLPP +VGDF QV + WRFHE+LG +E+FS
Sbjct: 736 AKKPKLNGGHGVRNLH-PPPGRPMCLRLPPGLVGDFLQVSEVFWRFHEILGFEEAFSPEN 794
Query: 731 XXXXXINPWIDGCSSEKCEKKLQGTEPVSLHQCDIVGGKILSASDESHQAVSRENPHAFI 790
INP DG +K K + +E ++ D K+ S DES Q +N A
Sbjct: 795 LEQELINPVFDGLFLDKPGKDDKRSE-INFTDKDSTATKLFSLFDESRQPFPAKNTSAS- 852
Query: 791 NLENGAAREAAQDEMGFVSYSRCSGVVLTKAHSSLLEVLIAELQSKVAALVDPNFDSGES 850
L+ A +++ ++ S C G +LT+AH SLL+VLI ELQSKVAA VDPNFDSGES
Sbjct: 853 ELKEKKAGDSSDFKISDSSRGSCVGALLTRAHISLLQVLICELQSKVAAFVDPNFDSGES 912
Query: 851 KPRRGRKKDADNSIPHKRGKLNMLPINELTWPELARRYILAFLSMDGILDSPEITARESG 910
+ RRGRKKD D+++ KR KL+MLP+NE TWPELARRYIL+ LSMDG L+S EI ARESG
Sbjct: 913 RSRRGRKKD-DSTLSAKRNKLHMLPVNEFTWPELARRYILSLLSMDGNLESAEIAARESG 971
Query: 911 RVFRCLQGDGGVLCGSLTGVAGMEADALLLAEATKKIFGSLNRENDVLTIEEEVSDASGT 970
+VFRCLQGDGG+LCGSLTGVAGMEAD++LLAEA KKI GSL ENDVL++E++ SD
Sbjct: 972 KVFRCLQGDGGLLCGSLTGVAGMEADSMLLAEAIKKISGSLTSENDVLSVEDDDSDGLDA 1031
Query: 971 CEKNIVNDGTLPEWAKMLEPVRKLPTNVGTRIRKCVYEALERNPPDWARKILEHSISKEV 1030
E N + G +PEWA++LEPV+KLPTNVGTRIRKCVYEALERNPP+WA+KILEHSISKE+
Sbjct: 1032 TETNTCS-GDIPEWAQVLEPVKKLPTNVGTRIRKCVYEALERNPPEWAKKILEHSISKEI 1090
Query: 1031 YKGNASGPTKKAVVSVLADVKER-LPQNSEKGCKKKTVXXXXXXXMKQCRIVLRQAAAAD 1089
YKGNASGPTKKAV+S+LAD++ L Q S KG KK+T MK+CR VLR AAAD
Sbjct: 1091 YKGNASGPTKKAVLSLLADIRGGDLVQRSIKGTKKRTYISVSDVIMKKCRAVLRGVAAAD 1150
Query: 1090 DEKVFCNLLGRKPLSSTDNDDEGFLGSPAMVSRPLDFRTIDLRLAVGAYDGSHDSFLQDV 1149
++KV C LLGRK L+S+DNDD+G LGSPAMVSRPLDFRTIDLRLA GAYDGS ++FL+DV
Sbjct: 1151 EDKVLCTLLGRKLLNSSDNDDDGLLGSPAMVSRPLDFRTIDLRLAAGAYDGSTEAFLEDV 1210
Query: 1150 REFWNNVRTAFGDQPDFVDLAEKLSRNFESLYENEIVTLLQKLVGYAKLESLSEETTKEI 1209
E W+++R + DQPD VDL LS F+SLYE E+V L+QKL Y KLE LS E KEI
Sbjct: 1211 LELWSSIRVMYADQPDCVDLVATLSEKFKSLYEAEVVPLVQKLKDYRKLECLSAEMKKEI 1270
Query: 1210 NDILVQTSEIPKAPWDEGICKVCGVDKDDDSVLLCDTCDAEYHTYCLEPPLVRIPEGNWY 1269
DI+V +++PKAPWDEG+CKVCGVDKDDDSVLLCDTCDAEYHTYCL PPL+RIP+GNWY
Sbjct: 1271 KDIVVSVNKLPKAPWDEGVCKVCGVDKDDDSVLLCDTCDAEYHTYCLNPPLIRIPDGNWY 1330
Query: 1270 CPSCVVRNSMVQGASEHSQVGGQHKGKK 1297
CPSCV+ M Q A E ++ + KG+K
Sbjct: 1331 CPSCVIAKRMAQEALESYKLVRRRKGRK 1358
|
|
| UNIPROTKB|F1NFV8 BAZ1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7C212 MLL3 "Histone-lysine N-methyltransferase MLL3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195945 AT1G77250 "AT1G77250" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000482 chd-3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q22516 chd-3 "Chromodomain-helicase-DNA-binding protein 3 homolog" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YDG9 RSF1 "Remodeling and spacing factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBP19A11.06 lid2 "Lid2 complex subunit, predicted histone demethylase Lid2" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060810-94 kdm5c "lysine (K)-specific demethylase 5C" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STY8 RSF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00020759001 | SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (1750 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1297 | |||
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 2e-12 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 2e-10 | |
| pfam05964 | 54 | pfam05964, FYRN, F/Y-rich N-terminus | 5e-10 | |
| pfam01429 | 75 | pfam01429, MBD, Methyl-CpG binding domain | 1e-06 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 6e-05 | |
| cd04718 | 148 | cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol | 1e-04 | |
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 1e-04 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 0.001 | |
| pfam05965 | 84 | pfam05965, FYRC, F/Y rich C-terminus | 0.001 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 0.002 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Score = 62.5 bits (152), Expect = 2e-12
Identities = 27/51 (52%), Positives = 30/51 (58%), Gaps = 2/51 (3%)
Query: 1228 ICKVCGVDKDDDSVLLCDTCDAEYHTYCLEPPLVR--IPEGNWYCPSCVVR 1276
C VCG DD +LLCD CD +H CL PPL IPEG WYCP C +
Sbjct: 1 YCAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKPK 51
|
PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51 |
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|218830 pfam05964, FYRN, F/Y-rich N-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|216497 pfam01429, MBD, Methyl-CpG binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|218831 pfam05965, FYRC, F/Y rich C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1297 | |||
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 99.59 | |
| PF05964 | 54 | FYRN: F/Y-rich N-terminus; InterPro: IPR003888 The | 99.47 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.45 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 99.41 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.4 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.39 | |
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.35 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.35 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.34 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.32 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.32 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.32 | |
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.31 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.29 | |
| PF05965 | 86 | FYRC: F/Y rich C-terminus; InterPro: IPR003889 The | 99.28 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.28 | |
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.27 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.25 | |
| smart00542 | 86 | FYRC "FY-rich" domain, C-terminal region. is somet | 99.2 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.17 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.13 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.12 | |
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.1 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.09 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.08 | |
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.06 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.05 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.02 | |
| smart00297 | 107 | BROMO bromo domain. | 99.0 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 98.98 | |
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 98.96 | |
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 98.96 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 98.95 | |
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 98.94 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 98.92 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 98.9 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 98.85 | |
| smart00541 | 44 | FYRN "FY-rich" domain, N-terminal region. is somet | 98.76 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 98.75 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 98.72 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 98.71 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 98.69 | |
| PF01429 | 77 | MBD: Methyl-CpG binding domain; InterPro: IPR00173 | 98.64 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.61 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 98.5 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 98.45 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 98.39 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.34 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 98.32 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.24 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.11 | |
| cd00122 | 62 | MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and | 98.1 | |
| cd01396 | 77 | MeCP2_MBD MeCP2, MBD1, MBD2, MBD3, and MBD4 are me | 98.08 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.03 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.02 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.96 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 97.93 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.9 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.86 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 97.85 | |
| smart00391 | 77 | MBD Methyl-CpG binding domain. Methyl-CpG binding | 97.81 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.77 | |
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 97.72 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.51 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.47 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 97.39 | |
| PF02791 | 61 | DDT: DDT domain; InterPro: IPR004022 This domain i | 97.3 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.24 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 97.24 | |
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 97.02 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 96.98 | |
| smart00571 | 63 | DDT domain in different transcription and chromoso | 96.85 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 96.73 | |
| cd01397 | 73 | HAT_MBD Methyl-CpG binding domains (MBD) present i | 96.71 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 96.67 | |
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 96.43 | |
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 96.4 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 96.38 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 96.16 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 96.04 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 95.89 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 95.73 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 95.7 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 95.61 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 95.22 | |
| cd01395 | 60 | HMT_MBD Methyl-CpG binding domains (MBD) present i | 94.57 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 94.4 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 94.27 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 93.67 | |
| KOG4161 | 272 | consensus Methyl-CpG binding transcription regulat | 93.41 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 93.23 | |
| KOG1246 | 904 | consensus DNA-binding protein jumonji/RBP2/SMCY, c | 93.12 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 92.99 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 91.38 | |
| KOG0008 | 1563 | consensus Transcription initiation factor TFIID, s | 90.42 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 89.94 | |
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 87.11 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.26 | |
| KOG1246 | 904 | consensus DNA-binding protein jumonji/RBP2/SMCY, c | 83.96 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 82.16 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 80.6 |
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
Probab=99.59 E-value=1.1e-15 Score=185.09 Aligned_cols=107 Identities=24% Similarity=0.367 Sum_probs=98.9
Q ss_pred HHHHHHHHHHHHHHHhCCCchhhhhccCCCCCCCCCCCCCCCCCCCcccccCCChhhhhhhhcccccCCCchhHHHHHHH
Q 047726 1072 SIIMKQCRIVLRQAAAADDEKVFCNLLGRKPLSSTDNDDEGFLGSPAMVSRPLDFRTIDLRLAVGAYDGSHDSFLQDVRE 1151 (1297)
Q Consensus 1072 dlimKRCr~VLr~l~ss~~s~vF~~pv~~~~LdseD~i~qGllGYp~vVkRPMDLgTIDlRLAaGaY~GS~e~FaEDVre 1151 (1297)
..+|++|..||++++++..+++|+.|||. +..||++|+.||++|||||||+.+|..|.|. ++..|++|||+
T Consensus 221 ~~~lk~C~~iLk~l~~~k~awpF~~PVD~--------v~LgLpDY~~IIK~PMDLgTIK~kL~~~~Y~-~~~eF~~DVRL 291 (640)
T KOG1474|consen 221 VELLKQCLSILKRLMKHKHAWPFNEPVDV--------VKLGLPDYHDIIKHPMDLGTIKKKLEKGEYK-SAEEFAADVRL 291 (640)
T ss_pred HHHHHHHHHHHHHHHhccCCCCcCCCcCH--------HhcCCcchhhhcCCCccHHHHHhhhcccccC-CHHHHHHHHHH
Confidence 45999999999999999998888887765 6667999999999999999999999999999 78889999999
Q ss_pred HHhhhhhccCCCchHHHHHHHhhhhhhhhhhhhhHh
Q 047726 1152 FWNNVRTAFGDQPDFVDLAEKLSRNFESLYENEIVT 1187 (1297)
Q Consensus 1152 VWsN~~Tyn~dg~dVv~LAEsLSq~FESrYekqvL~ 1187 (1297)
+|+||++||..+.+|+.||..|...||.+|....+.
T Consensus 292 ~F~Ncm~YNp~g~dV~~Ma~~L~~~Fe~rw~~~~~~ 327 (640)
T KOG1474|consen 292 TFDNCMTYNPEGSDVYAMAKKLQEVFEERWASMPLE 327 (640)
T ss_pred HHHHHHhcCCCCCHHHHHHHHHHHHHHHHHhhcccc
Confidence 999999999999999999999999999999975553
|
|
| >PF05964 FYRN: F/Y-rich N-terminus; InterPro: IPR003888 The "FY-rich" domain N-terminal region is sometimes closely juxtaposed with the C-terminal region (IPR003889 from INTERPRO), but sometimes is far distant | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >PF05965 FYRC: F/Y rich C-terminus; InterPro: IPR003889 The "FY-rich" domain C-terminal region is sometimes closely juxtaposed with the N-terminal region (IPR003888 from INTERPRO), but sometimes is far distant | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >smart00542 FYRC "FY-rich" domain, C-terminal region | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >smart00541 FYRN "FY-rich" domain, N-terminal region | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >PF01429 MBD: Methyl-CpG binding domain; InterPro: IPR001739 Methylation at CpG dinucleotide, the most common DNA modification in eukaryotes, has been correlated with gene silencing associated with various phenomena such as genomic imprinting, transposon and chromosome X inactivation, differentiation, and cancer | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD) | Back alignment and domain information |
|---|
| >cd01396 MeCP2_MBD MeCP2, MBD1, MBD2, MBD3, and MBD4 are members of a protein family that share the methyl-CpG-binding domain (MBD) | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00391 MBD Methyl-CpG binding domain | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02791 DDT: DDT domain; InterPro: IPR004022 This domain is predicted to be a DNA binding domain | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >smart00571 DDT domain in different transcription and chromosome remodeling factors | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01397 HAT_MBD Methyl-CpG binding domains (MBD) present in putative chromatin remodelling factor such as BAZ2A; BAZ2A contains a MBD, DDT, PHD-type zinc finger and Bromo domain suggesting that BAZ2A might be associated with histone acetyltransferase (HAT) activity | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >cd01395 HMT_MBD Methyl-CpG binding domains (MBD) present in putative histone methyltransferases (HMT) such as CLLD8 and SETDB1 proteins; CLLD8 contains a MBD, a PreSET and a bifurcated SET domain, suggesting that CLLD8 might be associated with methylation-mediated transcriptional repression | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4161 consensus Methyl-CpG binding transcription regulators [Transcription; Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1297 | ||||
| 2e6r_A | 92 | Solution Structure Of The Phd Domain In Smcy Protei | 7e-10 | ||
| 1f62_A | 51 | Wstf-Phd Length = 51 | 4e-09 | ||
| 3ask_A | 226 | Structure Of Uhrf1 In Complex With Histone Tail Len | 7e-09 | ||
| 4gy5_A | 241 | Crystal Structure Of The Tandem Tudor Domain And Pl | 7e-09 | ||
| 2kwj_A | 114 | Solution Structures Of The Double Phd Fingers Of Hu | 5e-08 | ||
| 3zvz_B | 57 | Phd Finger Of Human Uhrf1 Length = 57 | 9e-08 | ||
| 2e6s_A | 77 | Solution Structure Of The Phd Domain In Ring Finger | 1e-07 | ||
| 3zvy_A | 72 | Phd Finger Of Human Uhrf1 In Complex With Unmodifie | 1e-07 | ||
| 3shb_A | 77 | Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 | 1e-07 | ||
| 3t6r_A | 72 | Structure Of Uhrf1 In Complex With Unmodified H3 N- | 1e-07 | ||
| 2puy_A | 60 | Crystal Structure Of The Bhc80 Phd Finger Length = | 1e-07 | ||
| 3sou_A | 70 | Structure Of Uhrf1 Phd Finger In Complex With Histo | 2e-07 | ||
| 2lgg_A | 69 | Structure Of Phd Domain Of Uhrf1 In Complex With H3 | 2e-07 | ||
| 1mm2_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 3e-07 | ||
| 2ysm_A | 111 | Solution Structure Of The First And Second Phd Doma | 1e-06 | ||
| 2l5u_A | 61 | Structure Of The First Phd Finger (Phd1) From Chd4 | 2e-06 | ||
| 1mm3_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 3e-06 | ||
| 2yql_A | 56 | Solution Structure Of The Phd Domain In Phd Finger | 5e-06 | ||
| 3v43_A | 112 | Crystal Structure Of Moz Length = 112 | 8e-06 | ||
| 2ln0_A | 110 | Structure Of Moz Length = 110 | 1e-05 | ||
| 1xwh_A | 66 | Nmr Structure Of The First Phd Finger Of Autoimmune | 4e-05 | ||
| 2kft_A | 56 | Nmr Solution Structure Of The First Phd Finger Doma | 6e-05 |
| >pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 | Back alignment and structure |
|
| >pdb|1F62|A Chain A, Wstf-Phd Length = 51 | Back alignment and structure |
| >pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 | Back alignment and structure |
| >pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 | Back alignment and structure |
| >pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 | Back alignment and structure |
| >pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 | Back alignment and structure |
| >pdb|2E6S|A Chain A, Solution Structure Of The Phd Domain In Ring Finger Protein 107 Length = 77 | Back alignment and structure |
| >pdb|3ZVY|A Chain A, Phd Finger Of Human Uhrf1 In Complex With Unmodified Histone H3 N-Terminal Tail Length = 72 | Back alignment and structure |
| >pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 | Back alignment and structure |
| >pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 | Back alignment and structure |
| >pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 | Back alignment and structure |
| >pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 | Back alignment and structure |
| >pdb|2LGG|A Chain A, Structure Of Phd Domain Of Uhrf1 In Complex With H3 Peptide Length = 69 | Back alignment and structure |
| >pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 | Back alignment and structure |
| >pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 | Back alignment and structure |
| >pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 | Back alignment and structure |
| >pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 | Back alignment and structure |
| >pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 | Back alignment and structure |
| >pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 | Back alignment and structure |
| >pdb|2LN0|A Chain A, Structure Of Moz Length = 110 | Back alignment and structure |
| >pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 | Back alignment and structure |
| >pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1297 | |||
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 2e-22 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 3e-22 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 3e-20 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 3e-20 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 3e-04 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 2e-19 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 4e-19 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 5e-19 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 7e-19 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 3e-18 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 5e-15 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 4e-18 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 5e-18 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 1e-17 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 7e-07 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 2e-17 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 9e-04 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 3e-17 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 1e-16 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 2e-15 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 1e-14 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 8e-14 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 3e-13 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 2e-04 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 2e-12 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 4e-12 | |
| 2wzo_A | 146 | Transforming growth factor beta regulator 1; nucle | 1e-10 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 1e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 1e-07 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 3e-07 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 1e-06 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 8e-06 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 2e-05 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 1e-05 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 2e-05 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 7e-04 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 2e-05 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 3e-05 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 3e-05 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 4e-05 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 4e-05 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 5e-05 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-04 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 1e-04 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 1e-04 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 2e-04 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 2e-04 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 8e-04 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 3e-04 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 4e-04 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 4e-04 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 4e-04 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 4e-04 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 7e-04 |
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
Score = 90.1 bits (224), Expect = 2e-22
Identities = 21/47 (44%), Positives = 30/47 (63%)
Query: 1229 CKVCGVDKDDDSVLLCDTCDAEYHTYCLEPPLVRIPEGNWYCPSCVV 1275
CKVC +DD ++LCD C+ +H +CL P L +P+G W CP+C
Sbjct: 3 CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQP 49
|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2wzo_A Transforming growth factor beta regulator 1; nucleus, cell cycle, tumor suppressor; 1.60A {Homo sapiens} Length = 146 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1297 | |||
| 2wzo_A | 146 | Transforming growth factor beta regulator 1; nucle | 99.94 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.47 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.47 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.47 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.46 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 99.45 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 99.45 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.43 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.42 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.42 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.41 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.41 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.41 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.4 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.39 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.37 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.36 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.35 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 99.35 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.34 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.33 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.33 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.33 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.32 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.31 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.3 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.3 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.3 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.3 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.29 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 99.28 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.28 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.27 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.26 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.26 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.25 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.25 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.24 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.23 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.22 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.21 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.19 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.17 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.17 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.17 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.17 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.16 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.16 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 99.16 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 99.16 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.16 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.16 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.16 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 99.15 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.15 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 99.14 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.14 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.13 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 99.11 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 99.1 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.09 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.08 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.07 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.04 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 99.04 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.03 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.03 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 99.01 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 99.01 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.0 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.0 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 99.0 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.0 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.99 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.9 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 98.89 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.87 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.85 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.85 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 98.85 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.82 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 98.8 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.79 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 98.78 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.76 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.7 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.64 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 98.64 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.62 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 98.59 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.57 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 98.57 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.54 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.54 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 98.53 | |
| 3vxv_A | 69 | Methyl-CPG-binding domain protein 4; methyl CPG bi | 98.52 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.52 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.52 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.48 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 98.47 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.45 | |
| 1ub1_A | 133 | MECP2, attachment region binding protein; chicken | 98.39 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.37 | |
| 2ky8_A | 72 | Methyl-CPG-binding domain protein 2; DNA binding d | 98.35 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.32 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 98.32 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.31 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.31 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.29 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.27 | |
| 1d9n_A | 75 | Methyl-CPG-binding protein MBD1; PCM1, methylation | 98.27 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 98.23 | |
| 3c2i_A | 97 | Methyl-CPG-binding protein 2; water mediated recog | 98.21 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 98.19 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 98.16 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 98.11 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.0 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 98.0 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 97.99 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 97.93 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 97.91 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 97.84 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 97.81 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 97.79 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 97.78 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 97.76 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.74 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 97.72 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 97.7 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 97.55 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 97.53 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 97.49 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 97.44 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 97.41 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 97.31 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 97.23 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 97.23 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 97.18 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 97.11 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 97.04 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 97.02 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 96.98 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.91 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 96.72 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.6 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 96.55 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 95.71 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 95.48 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 95.44 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 95.34 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 93.22 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 93.0 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 91.45 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 90.45 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 89.61 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 89.22 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 87.91 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 81.51 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 80.99 |
| >2wzo_A Transforming growth factor beta regulator 1; nucleus, cell cycle, tumor suppressor; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.94 E-value=1.8e-27 Score=238.31 Aligned_cols=133 Identities=24% Similarity=0.494 Sum_probs=108.8
Q ss_pred CcCEEeccEEEEEeceecCC-CCCCCCCceecCCeEE---EeEc--CCCCeEEEEEEeeCCCCCCeEEEEeecCCCCCcC
Q 047726 365 GLPVQFEDFFILSLGHVDGR-PSYHNVNVIYPVGYTS---CWHD--KITGSLFICEVLDGGDSGPVFKVTRCSCSALPIP 438 (1297)
Q Consensus 365 g~P~~vg~l~v~SLGeI~~~-p~FHse~~IyPVGY~s---~~~~--~~~~~~y~C~IlDGG~~GP~F~I~~~~~~~~pi~ 438 (1297)
-||+++|+|+|+|||+|+++ ++||+++|||||||++ ||+. ++.+|.|+|+|+|+|+ +|+|+|++.+
T Consensus 4 ~lP~~~g~l~v~slG~i~~~~~~fh~~~~IyPvGy~~~R~y~s~~dp~~~~~Y~c~I~d~~~-~P~F~V~~e~------- 75 (146)
T 2wzo_A 4 VFPIGLGGLTVYSLGEIITDRPGFHDESAIYPVGYCSTRIYASMKCPDQKCLYTCQIKDGGV-QPQFEIVPED------- 75 (146)
T ss_dssp CCCEEETTEEEEEEEECCCSSGGGBCSSCBCCEEEEEEEEEECSSCTTSEEEEEEEEEECSS-SEEEEEEETT-------
T ss_pred eecEEECCEEEEEeeeEccCCCCccCCCceeCCCEEEEEEEecccCCCCeEEEEEEEEECCC-cceeEEEecC-------
Confidence 48999999999999999987 9999999999999999 8885 4555999999999986 7999999544
Q ss_pred CCCcccccCCcccccCCccccCCCccccCCCCCcccchhhhccCCCCCCccccccccCcCCCCCCCCCCCceEEecCCch
Q 047726 439 DGSTILFRPNFVQCSGRDHEANGDFTSYSKDYDSDVNIQMILSDPCLPVDNDILTCLGSCSNKSCDDDIGEISVEDRSLS 518 (1297)
Q Consensus 439 ~~Sti~~~~n~~~~~~q~~~~~~~~~~~~~d~d~~~n~~~ll~d~~~~~~dd~~~c~~~~~~~~~~~~ige~~~e~~s~~ 518 (1297)
+ -+..++|.|+.
T Consensus 76 -------------------------------------------------------------------~-~~~~~~g~Sp~ 87 (146)
T 2wzo_A 76 -------------------------------------------------------------------D-PQNAIVSSSAD 87 (146)
T ss_dssp -------------------------------------------------------------------C-GGGCEEESSHH
T ss_pred -------------------------------------------------------------------C-CCceEEeCChH
Confidence 1 13467899999
Q ss_pred HHHHHHHHHHHHHHHHHHhhcCceeeeccccccccccccccchhhhhhhhhhhhhhccCCCCc-cccCcccCCcchhhhH
Q 047726 519 SAWRRLSQKFVDACFEICKQKGVLKFSCKHIENSREFANWDMVDEKEKMRFTSLNKFCGSSVS-VSIPSEFRGDNELDML 597 (1297)
Q Consensus 519 s~W~~v~~k~~~~c~~~~k~~g~l~~~c~h~~~~~~~~~~~~~~~~~~~~~~~~~~fc~~~~p-~~i~~~~~~~~~~~~~ 597 (1297)
.+|++|.+++ .+++ |. .+ | ..+.
T Consensus 88 ~~W~~il~~i----~~~~---~~--~~-----------------------------------~~~~~s------------ 111 (146)
T 2wzo_A 88 ACHAELLRTI----STTM---GK--LM-----------------------------------PNLLPA------------ 111 (146)
T ss_dssp HHHHHHHHHH----HHHH---TC--CC-----------------------------------TTCCCC------------
T ss_pred HHHHHHHHHH----HHHh---cC--cC-----------------------------------CCCCCC------------
Confidence 9995555554 4443 21 11 1 1345
Q ss_pred HHHHhhhcccccccCCHHHHHHHHHhCCCCcccccchhhc
Q 047726 598 ADVLLKWLDQDRFGLEAEFVQEVIEQLPGVKDCSQYEFLI 637 (1297)
Q Consensus 598 ~~~l~~wl~qDrfGLd~~fVqeiiE~LPgv~~c~~Y~fl~ 637 (1297)
|+|.|||+.+.|+++||+|||++.|.+|+|+.
T Consensus 112 --------G~~~FGl~~p~V~~lie~Lpg~~~C~~Y~~~~ 143 (146)
T 2wzo_A 112 --------GADFFGFSHPAIHNLIQSCPGARKCINYQWVK 143 (146)
T ss_dssp --------HHHHHTTTSHHHHHHHTTSTTGGGCTTCCCCC
T ss_pred --------hhheecCCCHHHHHHHHhCCCchhcccCCcEE
Confidence 89999999999999999999999999999874
|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >3vxv_A Methyl-CPG-binding domain protein 4; methyl CPG binding domain, protein-DNA complex, versatIle BA recognition, hydrolase-DNA complex; HET: DNA 5CM; 2.00A {Mus musculus} PDB: 3vxx_A* 3vyb_A* 3vyq_A* | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >1ub1_A MECP2, attachment region binding protein; chicken methyl-CPG-binding protein 2 (cmecp2), MAR-binding protein (ARBP), spectroscopy; NMR {Gallus gallus} SCOP: d.10.1.3 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2ky8_A Methyl-CPG-binding domain protein 2; DNA binding domain, transcription-DNA complex; HET: DNA 5CM TED; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1d9n_A Methyl-CPG-binding protein MBD1; PCM1, methylation, DNA binding domain, gene regulation; NMR {Homo sapiens} SCOP: d.10.1.3 PDB: 1ig4_A* | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3c2i_A Methyl-CPG-binding protein 2; water mediated recognition; HET: DNA 5CM; 2.50A {Homo sapiens} PDB: 1qk9_A | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1297 | ||||
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 1e-15 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 3e-15 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 5e-13 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 1e-04 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 1e-11 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 5e-04 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 8e-11 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 5e-05 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 3e-10 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 5e-06 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 3e-09 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 0.001 | |
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 6e-06 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 6e-06 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 0.002 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 2e-05 | |
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 2e-05 | |
| d1wesa_ | 71 | g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I | 3e-05 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 1e-04 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 1e-04 | |
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 3e-04 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 0.002 | |
| d1qk9a_ | 92 | d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 | 0.003 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 0.004 |
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Nuclear corepressor KAP-1 (TIF-1beta) species: Human (Homo sapiens) [TaxId: 9606]
Score = 70.4 bits (172), Expect = 1e-15
Identities = 13/50 (26%), Positives = 22/50 (44%)
Query: 1229 CKVCGVDKDDDSVLLCDTCDAEYHTYCLEPPLVRIPEGNWYCPSCVVRNS 1278
+C V + +++C+ C+ +H C P L +P W C C V
Sbjct: 7 ATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPD 56
|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1qk9a_ d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1297 | |||
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 99.4 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.34 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.34 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.33 | |
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.32 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 99.16 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 99.16 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.09 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.05 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.02 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.92 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.9 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.72 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.6 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 98.4 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.37 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.33 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.28 | |
| d1ig4a_ | 75 | Methylation-dependent transcriptional repressor MB | 98.2 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.19 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 98.16 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.1 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.06 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 98.03 | |
| d1qk9a_ | 92 | Methyl-CpG-binding protein 2, MECP2 {Human (Homo s | 98.03 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 97.96 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 97.83 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 97.74 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 97.56 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 97.31 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 95.33 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 89.77 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 84.02 |
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: GCN5 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.40 E-value=2.1e-13 Score=126.64 Aligned_cols=100 Identities=16% Similarity=0.207 Sum_probs=91.7
Q ss_pred HHHHHHHHHHHHHHHhCCCchhhhhccCCCCCCCCCCCCCCCCCCCcccccCCChhhhhhhhcccccCCCchhHHHHHHH
Q 047726 1072 SIIMKQCRIVLRQAAAADDEKVFCNLLGRKPLSSTDNDDEGFLGSPAMVSRPLDFRTIDLRLAVGAYDGSHDSFLQDVRE 1151 (1297)
Q Consensus 1072 dlimKRCr~VLr~l~ss~~s~vF~~pv~~~~LdseD~i~qGllGYp~vVkRPMDLgTIDlRLAaGaY~GS~e~FaEDVre 1151 (1297)
+.+...|+.||..+..++.+.+|..|++. ..+|+|..+|++||||+||..|+..|.|. +...|.+|+++
T Consensus 1 d~L~~~l~~il~~l~~~~~s~~F~~pv~~----------~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~-s~~~f~~D~~l 69 (102)
T d3d7ca1 1 DQLYTTLKNLLAQIKSHPSAWPFMEPVKK----------SEAPDYYEVIRFPIDLKTMTERLRSRYYV-TRKLFVADLQR 69 (102)
T ss_dssp HHHHHHHHHHHHHHHHSGGGGGGSSCCCT----------TTSTTHHHHCSSCCCHHHHHHHHHTTCCC-SHHHHHHHHHH
T ss_pred ChHHHHHHHHHHHHHhCCCCCccCCCCCh----------hhCcCHHHHcCCccCHHHHHHHhccCccC-CHHHHHHHHHH
Confidence 45788999999999999999999998754 34899999999999999999999999998 88889999999
Q ss_pred HHhhhhhccCCCchHHHHHHHhhhhhhhhhh
Q 047726 1152 FWNNVRTAFGDQPDFVDLAEKLSRNFESLYE 1182 (1297)
Q Consensus 1152 VWsN~~Tyn~dg~dVv~LAEsLSq~FESrYe 1182 (1297)
+|+||..||+.++.++.+|..|.+.|+.+++
T Consensus 70 i~~Na~~yN~~~s~~~~~A~~l~~~f~~~~k 100 (102)
T d3d7ca1 70 VIANCREYNPPDSEYCRCASALEKFFYFKLK 100 (102)
T ss_dssp HHHHHHHHSCTTSHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHh
Confidence 9999999999999999999999999887654
|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ig4a_ d.10.1.3 (A:) Methylation-dependent transcriptional repressor MBD1/PCM1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qk9a_ d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|