Citrus Sinensis ID: 047737

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MKQLQPFLDTLEIYNPLSLSLLLILLLTLVQLLKLSRSTNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVEDLEEENGSGESKFGELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIARDL
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEcccccEEEEccHHHHHHHHHHcccccccccccHHHHHHHcccccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHcHHHccHHHHHHHHHHHc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEcccEcHHHcccccHHHHHHHHHHHHccEEEEEEcccEEEEEccHHHHHHHHccccccccEEccHHHHHHHEEccccEEEccccHHHHHHHHHHHHHHHcHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHcc
mkqlqpfldtleiynPLSLSLLLILLLTLVQLLKLSrstnklnlppspprlpiignLHQIVQNVPHRSLKalsdrygpiilvyfgnspslVVSSAEVASEMMKthdiafsnrprsIATKILlydgkdlgfaEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRScinghggstiNLSEMILAVSNNIATRCIfgrkvedleeengsgeskfgelTKKNMILLARTCvgdlypslkwidflTGSIYHLHKIARDL
MKQLQPFLDTLEIYNPLSLSLLLILLLTLVQLLKLSRSTNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKThdiafsnrprsiATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVedleeengsgeskfgeltKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIARDL
MKQLQPFLDTLEIYNPlslslllillltlvqllklsrsTNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLvvssaevasemmKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVEDLEEENGSGESKFGELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIARDL
******FLDTLEIYNPLSLSLLLILLLTLVQLLKLSR************RLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVE**************ELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKI****
*****PF**TLEIYNPLSLSLLLILLLTLVQ******************RLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIR***********INLSEMILAVSNNIATRCIFGRKVEDLEEENGSGESKFGELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIAR**
MKQLQPFLDTLEIYNPLSLSLLLILLLTLVQLLKLSRSTNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVED**********KFGELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIARDL
**QLQPFLDTLEIYNPLSLSLLLILLLTLVQLLKLSRSTNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVEDLEEENGSGESKFGELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIARDL
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQLQPFLDTLEIYNPLSLSLLLILLLTLVQLLKLSRSTNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVEDLEEENGSGESKFGELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIARDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query265 2.2.26 [Sep-21-2011]
Q9STL2 490 Cytochrome P450 71A21 OS= yes no 0.860 0.465 0.448 8e-53
Q9STL1 490 Cytochrome P450 71A22 OS= no no 0.811 0.438 0.445 3e-50
Q9STK9 488 Cytochrome P450 71A24 OS= no no 0.830 0.450 0.448 4e-49
Q9STK8 490 Cytochrome P450 71A25 OS= no no 0.871 0.471 0.416 9e-49
Q9STK7 489 Cytochrome P450 71A26 OS= no no 0.8 0.433 0.451 4e-48
Q9SAB6 497 Cytochrome P450 71A18 OS= no no 0.818 0.436 0.434 1e-47
P24465 502 Cytochrome P450 71A1 OS=P N/A no 0.856 0.452 0.478 3e-46
P37118 505 Cytochrome P450 71A2 OS=S N/A no 0.875 0.459 0.408 6e-46
C0SJS4 476 Psoralen synthase (Fragme N/A no 0.860 0.478 0.414 8e-46
Q9T0K2 497 Cytochrome P450 71A20 OS= no no 0.773 0.412 0.427 1e-45
>sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 Back     alignment and function desciption
 Score =  207 bits (526), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 109/243 (44%), Positives = 159/243 (65%), Gaps = 15/243 (6%)

Query: 23  LILLLTLVQLLKLSRSTNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILV 82
           LI+ +T++   K  +   K N P SPPRLP+IGNLHQ+  + PHRSL +LS RYGP++L+
Sbjct: 12  LIIFITIL-FFKKQKRGKKSNTPRSPPRLPLIGNLHQLGHH-PHRSLCSLSHRYGPLMLL 69

Query: 83  YFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWK 142
           + G  P LVVSSA+VA +++KTHD  F++RPRS   + L YDG+D+ FA YGEYWRQ+  
Sbjct: 70  HLGRVPVLVVSSADVARDILKTHDRVFASRPRSKLFEKLFYDGRDVAFAPYGEYWRQIKS 129

Query: 143 ICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRC 202
           +CVL LLSNK V S +++R EE+S ++ KI++S         +N+SE++ +++N++ +R 
Sbjct: 130 VCVLRLLSNKMVTSFRNVRQEEISLMMEKIQKSS-----SLQVNVSELLGSLTNDVISRI 184

Query: 203 IFGRKVEDLEEENGSGESKFGELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIA 262
             GRK         SGE+   EL K+ M+L+    VG   P L WID+++G    L+K  
Sbjct: 185 ALGRKY--------SGETDSKELMKRLMMLMGEFSVGTYVPWLGWIDWISGLDGQLNKTG 236

Query: 263 RDL 265
            DL
Sbjct: 237 NDL 239

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 Back     alignment and function description
>sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 Back     alignment and function description
>sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 Back     alignment and function description
>sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 Back     alignment and function description
>sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 Back     alignment and function description
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function description
>sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 Back     alignment and function description
>sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 Back     alignment and function description
>sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query265
356516619 519 PREDICTED: cytochrome P450 71A1-like [Gl 0.883 0.450 0.512 3e-63
224139378 486 cytochrome P450 [Populus trichocarpa] gi 0.826 0.450 0.513 3e-62
224139376 486 cytochrome P450 [Populus trichocarpa] gi 0.826 0.450 0.508 3e-62
224135973 494 predicted protein [Populus trichocarpa] 0.815 0.437 0.517 5e-59
449469731 507 PREDICTED: cytochrome P450 71A1-like [Cu 0.901 0.471 0.466 8e-59
356513646 478 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.894 0.495 0.508 6e-58
357461739 521 Cytochrome P450 [Medicago truncatula] gi 0.905 0.460 0.463 2e-57
224139374 471 cytochrome P450 [Populus trichocarpa] gi 0.796 0.447 0.5 3e-57
449487825 528 PREDICTED: cytochrome P450 71A1-like [Cu 0.815 0.409 0.506 3e-56
449487831 479 PREDICTED: cytochrome P450 71A1-like, pa 0.8 0.442 0.475 1e-55
>gi|356516619|ref|XP_003526991.1| PREDICTED: cytochrome P450 71A1-like [Glycine max] Back     alignment and taxonomy information
 Score =  247 bits (631), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 170/250 (68%), Gaps = 16/250 (6%)

Query: 14  YNPLSLSLL--LILLLTLVQLLKLSRSTNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKA 71
           Y P S   L      ++L+ +LKL+R  NK N PPSPP+LPIIGNLHQ+   +PHRS +A
Sbjct: 13  YEPSSTHYLTAFFCFVSLLLMLKLTRR-NKSNFPPSPPKLPIIGNLHQL-GTLPHRSFQA 70

Query: 72  LSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFA 131
           LS +YGP++++  G +P+LVVSSA+VA E++KTHD+ FSNRP+  A KI LY+ KD+GFA
Sbjct: 71  LSRKYGPLMMLQLGQTPTLVVSSADVAREIIKTHDVVFSNRPQPTAAKIFLYNCKDVGFA 130

Query: 132 EYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGS------TI 185
            YGE WRQ  K CV+ELLS ++V+S + IR E VS L+  +R +C    GGS       +
Sbjct: 131 PYGEEWRQTKKTCVVELLSQRKVRSFRSIREEVVSELVEAVREAC----GGSERENRPCV 186

Query: 186 NLSEMILAVSNNIATRCIFGRKVEDLEEENGSGESKFGELTKKNMILLARTCVGDLYPSL 245
           NLSEM++A SNNI +RC+ GRK +       S    FGEL +K M L +  CVGD +PSL
Sbjct: 187 NLSEMLIAASNNIVSRCVIGRKCD--ATVGDSVNCSFGELGRKIMRLFSAFCVGDFFPSL 244

Query: 246 KWIDFLTGSI 255
            W+D+LTG I
Sbjct: 245 GWVDYLTGLI 254

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224139378|ref|XP_002323083.1| cytochrome P450 [Populus trichocarpa] gi|222867713|gb|EEF04844.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139376|ref|XP_002323082.1| cytochrome P450 [Populus trichocarpa] gi|222867712|gb|EEF04843.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224135973|ref|XP_002322207.1| predicted protein [Populus trichocarpa] gi|222869203|gb|EEF06334.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449469731|ref|XP_004152572.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356513646|ref|XP_003525522.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71A1-like [Glycine max] Back     alignment and taxonomy information
>gi|357461739|ref|XP_003601151.1| Cytochrome P450 [Medicago truncatula] gi|355490199|gb|AES71402.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224139374|ref|XP_002323081.1| cytochrome P450 [Populus trichocarpa] gi|222867711|gb|EEF04842.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449487825|ref|XP_004157819.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487831|ref|XP_004157822.1| PREDICTED: cytochrome P450 71A1-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query265
TAIR|locus:504955642 490 CYP71A21 ""cytochrome P450, fa 0.796 0.430 0.435 2.2e-43
TAIR|locus:504955640 490 CYP71A22 ""cytochrome P450, fa 0.796 0.430 0.422 5.2e-42
TAIR|locus:504955639 489 CYP71A26 ""cytochrome P450, fa 0.796 0.431 0.422 1.2e-40
TAIR|locus:2142055 490 CYP71A19 ""cytochrome P450, fa 0.815 0.440 0.385 2.3e-39
TAIR|locus:504955637 490 CYP71A25 ""cytochrome P450, fa 0.781 0.422 0.407 2.9e-39
TAIR|locus:2142075 497 CYP71A20 ""cytochrome P450, fa 0.781 0.416 0.407 6.1e-39
TAIR|locus:504955634 483 CYP71A23 ""cytochrome P450, fa 0.796 0.436 0.408 2.6e-38
TAIR|locus:2149383 497 CYP71A14 ""cytochrome P450, fa 0.777 0.414 0.376 1.9e-37
TAIR|locus:2152701 497 CYP71A16 "cytochrome P450, fam 0.8 0.426 0.389 1.3e-36
TAIR|locus:2149373 496 CYP71A15 ""cytochrome P450, fa 0.781 0.417 0.377 2.1e-36
TAIR|locus:504955642 CYP71A21 ""cytochrome P450, family 71, subfamily A, polypeptide 21"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 458 (166.3 bits), Expect = 2.2e-43, P = 2.2e-43
 Identities = 98/225 (43%), Positives = 139/225 (61%)

Query:    41 KLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLXXXXXXXXXX 100
             K N P SPPRLP+IGNLHQ+  + PHRSL +LS RYGP++L++ G  P L          
Sbjct:    29 KSNTPRSPPRLPLIGNLHQLGHH-PHRSLCSLSHRYGPLMLLHLGRVPVLVVSSADVARD 87

Query:   101 XXKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHI 160
               KTHD  F++RPRS   + L YDG+D+ FA YGEYWRQ+  +CVL LLSNK V S +++
Sbjct:    88 ILKTHDRVFASRPRSKLFEKLFYDGRDVAFAPYGEYWRQIKSVCVLRLLSNKMVTSFRNV 147

Query:   161 RVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVEDLEEENGSGES 220
             R EE+S ++ KI++S         +N+SE++ +++N++ +R   GRK         SGE+
Sbjct:   148 RQEEISLMMEKIQKS-----SSLQVNVSELLGSLTNDVISRIALGRKY--------SGET 194

Query:   221 KFGELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIARDL 265
                EL K+ M+L+    VG   P L WID+++G    L+K   DL
Sbjct:   195 DSKELMKRLMMLMGEFSVGTYVPWLGWIDWISGLDGQLNKTGNDL 239
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955639 CYP71A26 ""cytochrome P450, family 71, subfamily A, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142055 CYP71A19 ""cytochrome P450, family 71, subfamily A, polypeptide 19"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955637 CYP71A25 ""cytochrome P450, family 71, subfamily A, polypeptide 25"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142075 CYP71A20 ""cytochrome P450, family 71, subfamily A, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955634 CYP71A23 ""cytochrome P450, family 71, subfamily A, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149383 CYP71A14 ""cytochrome P450, family 71, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152701 CYP71A16 "cytochrome P450, family 71, subfamily A, polypeptide 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149373 CYP71A15 ""cytochrome P450, family 71, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP71AN2v1
cytochrome P450 (486 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 1e-45
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 3e-44
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-43
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-41
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 2e-32
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 7e-32
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-27
pfam00067 461 pfam00067, p450, Cytochrome P450 2e-26
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 9e-20
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 9e-14
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 9e-13
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-12
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 8e-12
PLN02196 463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 5e-07
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information 
 Score =  159 bits (404), Expect = 1e-45
 Identities = 74/236 (31%), Positives = 122/236 (51%), Gaps = 6/236 (2%)

Query: 16  PLSLSLLLILLLTLVQLLKL--SRSTNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALS 73
              LSLL  +L+  V + +   +     L LPP PPR PI+GNL Q+   +PHR L +L 
Sbjct: 3   SFLLSLLFSVLIFNVLIWRWLNASMRKSLRLPPGPPRWPIVGNLLQLGP-LPHRDLASLC 61

Query: 74  DRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLYDGKDLGFAEY 133
            +YGP++ +  G+  ++     E+  E++   D  F++RPR++A   L Y   D+  A  
Sbjct: 62  KKYGPLVYLRLGSVDAITTDDPELIREILLRQDDVFASRPRTLAAVHLAYGCGDVALAPL 121

Query: 134 GEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILA 193
           G +W+++ +IC+  LL+ KR++S    R EE   LI  +  +      G  +NL E++ A
Sbjct: 122 GPHWKRMRRICMEHLLTTKRLESFAKHRAEEARHLIQDVWEA---AQTGKPVNLREVLGA 178

Query: 194 VSNNIATRCIFGRKVEDLEEENGSGESKFGELTKKNMILLARTCVGDLYPSLKWID 249
            S N  TR + G++    E        +F  +T +   LL    +GD  P+ +W+D
Sbjct: 179 FSMNNVTRMLLGKQYFGAESAGPKEAMEFMHITHELFRLLGVIYLGDYLPAWRWLD 234

Length = 514
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 265
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN03234 499 cytochrome P450 83B1; Provisional 99.97
PLN02687 517 flavonoid 3'-monooxygenase 99.97
PLN03112 514 cytochrome P450 family protein; Provisional 99.97
PLN02183 516 ferulate 5-hydroxylase 99.97
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.97
PLN02966 502 cytochrome P450 83A1 99.97
PLN02971 543 tryptophan N-hydroxylase 99.96
PTZ00404 482 cytochrome P450; Provisional 99.96
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.95
PLN02394 503 trans-cinnamate 4-monooxygenase 99.95
PLN00168 519 Cytochrome P450; Provisional 99.95
PLN02655 466 ent-kaurene oxidase 99.95
PLN02290 516 cytokinin trans-hydroxylase 99.94
PLN02196 463 abscisic acid 8'-hydroxylase 99.93
PLN03018 534 homomethionine N-hydroxylase 99.93
PLN02500 490 cytochrome P450 90B1 99.92
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.92
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.91
PLN02774 463 brassinosteroid-6-oxidase 99.91
PLN02302 490 ent-kaurenoic acid oxidase 99.9
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.9
PLN02738 633 carotene beta-ring hydroxylase 99.89
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.89
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.89
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.89
PLN02936 489 epsilon-ring hydroxylase 99.88
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.87
PLN02648 480 allene oxide synthase 99.85
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.77
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.68
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.24
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-33  Score=235.76  Aligned_cols=214  Identities=40%  Similarity=0.732  Sum_probs=182.1

Q ss_pred             CCCCCCCCCCCCccccccccccCCC-chhHHHHHHhhcCCeEEEEeCCccEEEeccHHHHHHHHHhccccccCCCC-ccc
Q 047737           40 NKLNLPPSPPRLPIIGNLHQIVQNV-PHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPR-SIA  117 (265)
Q Consensus        40 ~~~~~~pgp~~~p~~G~~~~~~~~~-~~~~~~~~~~~yG~i~~~~~~~~~~v~v~~p~~i~~il~~~~~~~~~~~~-~~~  117 (265)
                      ++.+.||||+++|++||++++ ... +|..+.++.++|||++.+++|..++|+++|+++++|++++++..|++|+. ...
T Consensus        23 ~~~~lPPGP~~lPiIGnl~~l-~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~  101 (489)
T KOG0156|consen   23 KRRNLPPGPPPLPIIGNLHQL-GSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTAT  101 (489)
T ss_pred             CCCCCCcCCCCCCccccHHHc-CCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhh
Confidence            348899999999999999999 554 99999999999999999999999999999999999999999999999997 224


Q ss_pred             ccccccCCceeEecCCChhHHHHHHHHHHHhcChHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCccccHHHHHHHHHHH
Q 047737          118 TKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNN  197 (265)
Q Consensus       118 ~~~~~~~~~~~~~~~~g~~w~~~R~~l~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~vd~~~~~~~~t~~  197 (265)
                      ...+..++.|++++.+|+.||.+||+.....++.+.+++....-.++++.+++++.+.   .. ++++|+.+.+..++.+
T Consensus       102 ~~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~---~~-~~~vdl~~~l~~~~~n  177 (489)
T KOG0156|consen  102 LKYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKS---KK-GEPVDLSELLDLLVGN  177 (489)
T ss_pred             HHHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhc---CC-CceeeHHHHHHHHHHH
Confidence            4556656899999988999999999998999999999998888899999999999862   22 3899999999999999


Q ss_pred             HhhHHhccccccchhhcCC-cchhHHHHHHHHHHHHhccCCcccccc-ccccccchhchHHHHHHHH
Q 047737          198 IATRCIFGRKVEDLEEENG-SGESKFGELTKKNMILLARTCVGDLYP-SLKWIDFLTGSIYHLHKIA  262 (265)
Q Consensus       198 vi~~~~fG~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~P-~l~~~~~~~~~~~~~~~~~  262 (265)
                      ||++.+||.+++    ..+ +...++.+.+.+..+..+.+...+++| ++.++++..+..+..+...
T Consensus       178 vI~~~~fG~rf~----~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~  240 (489)
T KOG0156|consen  178 VICRMLFGRRFE----EEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVS  240 (489)
T ss_pred             HHHHHHhCCccc----cCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHH
Confidence            999999999998    322 344568888999999888888889999 6777665445555554443

>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 6e-12
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 6e-12
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 6e-12
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 6e-12
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 7e-12
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-08
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 3e-08
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-08
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-08
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-08
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 3e-08
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 3e-08
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 4e-08
3pm0_A 507 Structural Characterization Of The Complex Between 2e-07
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-06
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-06
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 5e-06
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 5e-06
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 3e-05
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 4e-04
3ibd_A 476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 7e-04
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure 
Iteration: 1

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 84/172 (48%), Gaps = 8/172 (4%)
Query: 39  TNKLNLPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLXXXXXXXX 98
           ++K  LPP P  LP++GNL Q+ +    RS   L ++YG +  VY G+ P +        
Sbjct: 6   SSKGKLPPGPSPLPVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAI 65
Query: 99  XXXXKTHDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQ 158
                    AFS R + IA    ++ G  + FA  GE WR L +  +  +      K + 
Sbjct: 66  REALVDQAEAFSGRGK-IAVVDPIFQGYGVIFAN-GERWRALRRFSLATMRDFGMGKRSV 123
Query: 159 HIRV-EEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVE 209
             R+ EE  CL+ ++R+S      G+ ++ + +  ++++NI    +FG++ +
Sbjct: 124 EERIQEEARCLVEELRKS-----KGALLDNTLLFHSITSNIICSIVFGKRFD 170
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-52
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 5e-47
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 6e-44
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 8e-43
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-36
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-32
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-31
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-31
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-30
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 7e-28
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-27
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-26
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-26
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 4e-26
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-26
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 9e-25
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-22
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-20
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 5e-18
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-15
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 3e-14
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 5e-14
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 8e-14
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-13
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-10
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 5e-07
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 6e-06
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-05
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  176 bits (449), Expect = 1e-52
 Identities = 37/219 (16%), Positives = 72/219 (32%), Gaps = 7/219 (3%)

Query: 36  SRSTNKLNLPPSPPRLPIIGNLHQIVQ---NVPHRSLKALSDRYGPIILVYFGNSPSLVV 92
           +RS    N  PSP     +   H   +   +  H        +YGPI     GN  S+ V
Sbjct: 2   TRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYV 61

Query: 93  SSAEVASEMMKTHDIAFSNRP-RSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSN 151
              E  + + K+                   Y        +    W++       E+++ 
Sbjct: 62  IDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAP 121

Query: 152 KRVKSAQHIRVEEVSCLINKIRRSCI-NGHGGSTINLSEMILAVSNNIATRCIFGRKVED 210
           +  K+   +        ++ + R     G G  + ++S+ +   +    T  IFG +   
Sbjct: 122 EATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGM 181

Query: 211 LEEENGSGESKFGELTKKNMILLARTCVGDLYPSLKWID 249
           LEE       +F +   +  +      + +L P L  + 
Sbjct: 182 LEEVVNPEAQRFIDAIYQ--MFHTSVPMLNLPPDLFRLF 218
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query265
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.96
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.96
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.95
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.95
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.95
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.95
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.94
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.94
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.94
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.94
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.94
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.93
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.93
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.93
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.92
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.92
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.91
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.9
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.9
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.89
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.88
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.88
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.86
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.86
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.84
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.82
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.82
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.81
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.81
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.81
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.79
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.78
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.77
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.76
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.75
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.75
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.75
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.73
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.73
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.71
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.7
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.7
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.7
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.68
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.67
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.67
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.67
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.66
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.66
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.65
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.65
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.65
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.64
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.64
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.63
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.62
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.62
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.61
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.61
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.58
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.58
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.58
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.58
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.55
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.55
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.54
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.52
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.51
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.49
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.49
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.46
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.41
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.37
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.35
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.3
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.08
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.06
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=99.96  E-value=1.1e-28  Score=211.08  Aligned_cols=200  Identities=21%  Similarity=0.360  Sum_probs=155.7

Q ss_pred             CCCCCCCCCCCCccccccccccC-CCchhHHHHHHhhcCCeEEEEeCCccEEEeccHHHHHHHHHhccccccCCCCcccc
Q 047737           40 NKLNLPPSPPRLPIIGNLHQIVQ-NVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIAT  118 (265)
Q Consensus        40 ~~~~~~pgp~~~p~~G~~~~~~~-~~~~~~~~~~~~~yG~i~~~~~~~~~~v~v~~p~~i~~il~~~~~~~~~~~~~~~~  118 (265)
                      ++.+.||||+++|++||++.+.. +.++..+.+|+++||+||++++|+.++|+++||+++++++.+++..|++++.....
T Consensus         5 ~~~~~PPgP~~lPliGnl~~l~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~~k~il~~~~~~f~~rp~~~~~   84 (494)
T 3swz_A            5 TGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATL   84 (494)
T ss_dssp             -------CCBCCCEEEEESSCTTSSCHHHHHHHTHHHHCSEEEEEETTEEEEEECSHHHHHHHHTTTTTTTBBCCCCHHH
T ss_pred             CCCCCCCCCCCCCeEcchHHhCCCCchhHHHHHHHHHcCCEEEEEeCCCCEEEECCHHHHHHHHHhCcHhhCCCCCcHHH
Confidence            45678999999999999998742 35788899999999999999999999999999999999999998899888776554


Q ss_pred             cccccCCceeEecCCChhHHHHHHHHHHHhcCh--HHHHHHHHHHHHHHHHHHHHHHHhcccCCCCccccHHHHHHHHHH
Q 047737          119 KILLYDGKDLGFAEYGEYWRQLWKICVLELLSN--KRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSN  196 (265)
Q Consensus       119 ~~~~~~~~~~~~~~~g~~w~~~R~~l~~~~f~~--~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~vd~~~~~~~~t~  196 (265)
                      ......+.|++++.+|+.|+++|+++ .+.|+.  ..++.+.+.+.++++.+++.+.+.     .+.++|+.+.+..+++
T Consensus        85 ~~~~~~~~gl~~~~~g~~wr~~Rr~~-~~~f~~~~~~~~~~~~~i~~~~~~l~~~l~~~-----~~~~vd~~~~~~~~t~  158 (494)
T 3swz_A           85 DIASNNRKGIAFADSGAHWQLHRRLA-MATFALFKDGDQKLEKIICQEISTLCDMLATH-----NGQSIDISFPVFVAVT  158 (494)
T ss_dssp             HHHTTTTCSSSSSCSSHHHHHHHHHH-HHHTTTTSSSTTCHHHHHHHHHHHHHHHHHHT-----TTEEECCHHHHHHHHH
T ss_pred             HHhccCCCCeEeCCCCHHHHHHHHHH-HHHHHHhcchHHHHHHHHHHHHHHHHHHHHHc-----CCCcccHHHHHHHHHH
Confidence            44444466777777799999999999 999974  446778999999999999999753     4678999999999999


Q ss_pred             HHhhHHhccccccchhhcCCcchhHHHHHHHHHHHHhccCCcccccccccccc
Q 047737          197 NIATRCIFGRKVEDLEEENGSGESKFGELTKKNMILLARTCVGDLYPSLKWID  249 (265)
Q Consensus       197 ~vi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~~  249 (265)
                      |+|+.++||.+++    ..++....+.+..+.+........+.+++|++.+++
T Consensus       159 dvi~~~~fG~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~p  207 (494)
T 3swz_A          159 NVISLICFNTSYK----NGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFP  207 (494)
T ss_dssp             HHHHHHHHSCCCC----TTCTHHHHHHHHHHHHHHHHCSSSSCCSSCGGGTSC
T ss_pred             HHHHHHHcCCcCC----CCCHHHHHHHHHHHHHHHhcccchHHHHHHHHHHcC
Confidence            9999999999986    222222334444444444444445677889888775
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 265
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 3e-35
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-35
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 4e-34
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-28
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 9e-26
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-25
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 7e-18
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-14
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 6e-12
d1z8oa1 402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 0.004
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  129 bits (324), Expect = 3e-35
 Identities = 47/223 (21%), Positives = 101/223 (45%), Gaps = 12/223 (5%)

Query: 44  LPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMK 103
           LPP P  LP++GNL Q+ +    RS   L ++YG +  VY G+ P +V+   +   E + 
Sbjct: 3   LPPGPSPLPVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALV 62

Query: 104 THDIAFSNRPRSIATKILLYDGKDLGFAEYGEYWRQLWKICVLELLSNKRVKSAQHIRVE 163
               AFS R +      +   G  + FA  GE WR L +  +  +      K +   R++
Sbjct: 63  DQAEAFSGRGKIAVVDPIFQ-GYGVIFA-NGERWRALRRFSLATMRDFGMGKRSVEERIQ 120

Query: 164 -EVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRCIFGRKVEDLEEENGSGESKF 222
            E  CL+ ++R+       G+ ++ + +  ++++NI    +FG++ +  +        + 
Sbjct: 121 EEARCLVEELRK-----SKGALLDNTLLFHSITSNIICSIVFGKRFDYKDPVF----LRL 171

Query: 223 GELTKKNMILLARTCVGDLYPSLKWIDFLTGSIYHLHKIARDL 265
            +L  ++  L++            ++    G+   +++  +++
Sbjct: 172 LDLFFQSFSLISSFSSQVFELFSGFLKHFPGTHRQIYRNLQEI 214
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query265
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.95
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.93
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.92
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.91
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.89
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.89
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.82
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.79
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.64
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.55
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.48
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.48
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.45
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.42
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.31
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.22
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.21
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.17
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.0
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.95
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.6
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.95  E-value=2.5e-27  Score=198.39  Aligned_cols=160  Identities=17%  Similarity=0.196  Sum_probs=136.2

Q ss_pred             CCCCCCCCccccccccccCCCchhHHHHHHhhcCCeEEEEeCCccEEEeccHHHHHHHHHhccccccCCCCccccccccc
Q 047737           44 LPPSPPRLPIIGNLHQIVQNVPHRSLKALSDRYGPIILVYFGNSPSLVVSSAEVASEMMKTHDIAFSNRPRSIATKILLY  123 (265)
Q Consensus        44 ~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~yG~i~~~~~~~~~~v~v~~p~~i~~il~~~~~~~~~~~~~~~~~~~~~  123 (265)
                      .+|||.++|++||++.+...+++.++.+++++|||||++++|+.++|+++||+++++++.++...+..+.......... 
T Consensus         2 ~iPGP~~~p~lG~l~~l~~~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~~~-   80 (453)
T d2ij2a1           2 EMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFA-   80 (453)
T ss_dssp             CCCCCCCCGGGTTGGGGCSSCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHHHH-
T ss_pred             CCccCCCcchhhCHHHhCCCCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHHhc-
Confidence            4599999999999998866778999999999999999999999999999999999999977665554433222223333 


Q ss_pred             CCceeEe-cCCChhHHHHHHHHHHHhcChHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCccccHHHHHHHHHHHHhhHH
Q 047737          124 DGKDLGF-AEYGEYWRQLWKICVLELLSNKRVKSAQHIRVEEVSCLINKIRRSCINGHGGSTINLSEMILAVSNNIATRC  202 (265)
Q Consensus       124 ~~~~~~~-~~~g~~w~~~R~~l~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~vd~~~~~~~~t~~vi~~~  202 (265)
                       |+|++. ..+|+.|+++|+.+ .|+|++++++.+.+.+.++++++++.|.+    .++++++|+.+++..+++|+++.+
T Consensus        81 -g~~~~~~~~~g~~wk~~Rk~l-~~~fs~~~l~~~~~~i~~~~~~li~~l~~----~~~~~~idl~~~~~~~~~~~i~~~  154 (453)
T d2ij2a1          81 -GDGLFTSWTHEKNWKKAHNIL-LPSFSQQAMKGYHAMMVDIAVQLVQKWER----LNADEHIEVPEDMTRLTLDTIGLC  154 (453)
T ss_dssp             -TTSGGGSCTTSHHHHHHHHHH-GGGGSTTTHHHHHHHHHHHHHHHHHHHHT----CCTTCCEEHHHHHHHHHHHHHHHH
T ss_pred             -CCcEEecCCChHHHHHHHHHH-HHHhhhhhhhhhhhhHHHHHHHHHHHhhh----cCCCCccchHHHHHHHhhhcchhc
Confidence             556554 35699999999999 99999999999999999999999999975    456789999999999999999999


Q ss_pred             hccccccc
Q 047737          203 IFGRKVED  210 (265)
Q Consensus       203 ~fG~~~~~  210 (265)
                      +||.++++
T Consensus       155 ~fG~~~~~  162 (453)
T d2ij2a1         155 GFNYRFNS  162 (453)
T ss_dssp             HHSCCCCG
T ss_pred             ccccccch
Confidence            99999873
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure