Citrus Sinensis ID: 047766

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
PHDNKVNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFDPHNMSHGGKEDEHRHVGDLGNLFGDVYGPDSIIGRAIVIHKDQDDFGR
cccccEEEEEEEEccccccEEEEEEEEEcccccEEEEEEEEccccccEEEEEEccccccccccccccccccccccccccccccccEEEcccEEEcccccccEEEEEEEEccccccccc
cccccEEEEEEEEEcccccEEEEEEEcccccccEEEEEEEEccccEEEEEEEEcccccccHHHHHccEcccccccccccccccccccEEEEEEEcccccccEEEEEEEEEcccccccc
PHDNKVNAIAVItgreggpkgsiffsqdgdhgptilngylhglppghhgfhvhaagdtrhecnsagshfdphnmshggkedehrhvgdlgnlfgdvygpdsiiGRAIVIHkdqddfgr
PHDNKVNAIAvitgreggpkGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFDPHNMSHGGKEDEHRHVGDLGNLFGDVYGPDSIIGRAIVIhkdqddfgr
PHDNKVNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYlhglppghhgFHVHAAGDTRHECNSAGSHFDPHNMSHGGKEDEHRHVGDLGNLFGDVYGPDSIIGRAIVIHKDQDDFGR
*******AIAVITG******GSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAA******************************VGDLGNLFGDVYGPDSIIGRAIVIH********
****KVN*IAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFDPHNMSHGGKEDEHRHVGDLGNLFGDVYGPDSIIGRAIVIHKDQDDFGR
PHDNKVNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFDPHN*********HRHVGDLGNLFGDVYGPDSIIGRAIVIHKDQDDFGR
*HDNKVNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFDPHNMSHGGKEDEHRHVGDLGNLFGDVYGPDSIIGRAIVIHKDQ*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHDNKVNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFDPHNMSHGGKEDEHRHVGDLGNLFGDVYGPDSIIGRAIVIHKDQDDFGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
Q7M1R5152 Superoxide dismutase [Cu- yes no 0.940 0.730 0.515 6e-27
P23345152 Superoxide dismutase [Cu- N/A no 0.940 0.730 0.492 4e-26
P23346152 Superoxide dismutase [Cu- N/A no 0.940 0.730 0.492 7e-26
P11428151 Superoxide dismutase [Cu- N/A no 0.932 0.728 0.5 4e-25
O65768152 Superoxide dismutase [Cu- N/A no 0.940 0.730 0.492 4e-25
O04996153 Superoxide dismutase [Cu- N/A no 0.949 0.732 0.484 4e-25
O65174152 Superoxide dismutase [Cu- N/A no 0.940 0.730 0.476 5e-25
P28757152 Superoxide dismutase [Cu- yes no 0.940 0.730 0.492 7e-25
P27082152 Superoxide dismutase [Cu- N/A no 0.940 0.730 0.492 7e-25
Q9SQL5152 Superoxide dismutase [Cu- N/A no 0.940 0.730 0.492 2e-24
>sp|Q7M1R5|SODC_SOYBN Superoxide dismutase [Cu-Zn] OS=Glycine max GN=SOD1 PE=3 SV=1 Back     alignment and function desciption
 Score =  119 bits (298), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 84/128 (65%), Gaps = 17/128 (13%)

Query: 6   VNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSA 65
           V A+AV+   EG   G+IFF+Q+G+ GPT + G L GL PG HGFHVHA GDT + C S 
Sbjct: 2   VKAVAVLGSSEG-VTGTIFFTQEGN-GPTTVTGSLAGLKPGLHGFHVHALGDTTNGCLST 59

Query: 66  GSHFDPHNMSHGGKEDEHRHVGDLGNL-FGD--------------VYGPDSIIGRAIVIH 110
           G+HF+P+N  HG  EDE+RH GDLGN+  GD              + GP+SIIGRA+V+H
Sbjct: 60  GAHFNPNNNEHGAPEDENRHAGDLGNVNVGDDGTVSFSITDSQIPLTGPNSIIGRAVVVH 119

Query: 111 KDQDDFGR 118
            D DD G+
Sbjct: 120 ADSDDLGK 127
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|P23345|SODC4_MAIZE Superoxide dismutase [Cu-Zn] 4A OS=Zea mays GN=SODCC.3 PE=2 SV=2 Back     alignment and function description
>sp|P23346|SODC5_MAIZE Superoxide dismutase [Cu-Zn] 4AP OS=Zea mays GN=SODCC.2 PE=2 SV=2 Back     alignment and function description
>sp|P11428|SODC2_MAIZE Superoxide dismutase [Cu-Zn] 2 OS=Zea mays GN=SODCC.1 PE=2 SV=2 Back     alignment and function description
>sp|O65768|SODC_CARPA Superoxide dismutase [Cu-Zn] OS=Carica papaya GN=SODCC PE=2 SV=1 Back     alignment and function description
>sp|O04996|SODC_SOLCS Superoxide dismutase [Cu-Zn] OS=Solidago canadensis var. scabra GN=SODCC PE=2 SV=3 Back     alignment and function description
>sp|O65174|SODC_ZANAE Superoxide dismutase [Cu-Zn] OS=Zantedeschia aethiopica GN=SODCC PE=2 SV=1 Back     alignment and function description
>sp|P28757|SODC2_ORYSJ Superoxide dismutase [Cu-Zn] 2 OS=Oryza sativa subsp. japonica GN=SODCC2 PE=1 SV=2 Back     alignment and function description
>sp|P27082|SODC_NICPL Superoxide dismutase [Cu-Zn] OS=Nicotiana plumbaginifolia GN=SODCC PE=2 SV=2 Back     alignment and function description
>sp|Q9SQL5|SODC_ANACO Superoxide dismutase [Cu-Zn] OS=Ananas comosus GN=SOD1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
326415941152 Cu/Zn superoxide dismutase [Vigna radiat 0.940 0.730 0.523 1e-25
351725359152 superoxide dismutase [Cu-Zn] [Glycine ma 0.940 0.730 0.515 2e-25
5441514158 putative cytoplasmic copper/zinc superox 0.940 0.702 0.5 3e-25
5441512144 putative cytoplasmic copper/zinc superox 0.940 0.770 0.5 4e-25
312096461156 superoxide dismutase [Loa loa] gi|307756 0.940 0.711 0.507 4e-25
306755374152 csd1 [Pleioblastus fortunei] 0.940 0.730 0.515 4e-25
164654158152 copper/zinc-superoxide dismutase [Litchi 0.940 0.730 0.5 1e-24
19172405152 copper/zinc superoxide dismutase [Sander 0.940 0.730 0.5 2e-24
162463249152 superoxide dismutase [Cu-Zn] 4AP [Zea ma 0.940 0.730 0.492 2e-24
74229677152 cytoplasmic Cu/ZnSOD [Gossypium hirsutum 0.940 0.730 0.515 2e-24
>gi|326415941|gb|ADZ72850.1| Cu/Zn superoxide dismutase [Vigna radiata] gi|326415943|gb|ADZ72851.1| Cu/Zn superoxide dismutase [Vigna radiata] Back     alignment and taxonomy information
 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 84/128 (65%), Gaps = 17/128 (13%)

Query: 6   VNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSA 65
           V A+AV+   EG   G+++FSQDG+ GPT + G L GL PGHHGFHVHA GDT + C S 
Sbjct: 2   VKAVAVLGSSEG-VTGTVYFSQDGN-GPTTVTGTLAGLKPGHHGFHVHALGDTTNGCLST 59

Query: 66  GSHFDPHNMSHGGKEDEHRHVGDLGNL-FGD--------------VYGPDSIIGRAIVIH 110
           G HF+P+N  HG  EDE+RH GDLGN+  GD              + GP+SIIGRA+V+H
Sbjct: 60  GPHFNPNNKEHGAPEDENRHAGDLGNVNVGDDGTVTFSITDSQIPLTGPNSIIGRAVVVH 119

Query: 111 KDQDDFGR 118
            D DD G+
Sbjct: 120 ADPDDLGK 127

Source: Vigna radiata

Species: Vigna radiata

Genus: Vigna

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351725359|ref|NP_001235298.1| superoxide dismutase [Cu-Zn] [Glycine max] gi|47117142|sp|Q7M1R5.1|SODC_SOYBN RecName: Full=Superoxide dismutase [Cu-Zn] gi|255628369|gb|ACU14529.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|5441514|emb|CAB46812.1| putative cytoplasmic copper/zinc superoxide dismutase [Acanthocheilonema viteae] Back     alignment and taxonomy information
>gi|5441512|emb|CAB46811.1| putative cytoplasmic copper/zinc superoxide dismutase [Acanthocheilonema viteae] Back     alignment and taxonomy information
>gi|312096461|ref|XP_003148675.1| superoxide dismutase [Loa loa] gi|307756161|gb|EFO15395.1| superoxide dismutase [Loa loa] Back     alignment and taxonomy information
>gi|306755374|gb|ADN04915.1| csd1 [Pleioblastus fortunei] Back     alignment and taxonomy information
>gi|164654158|gb|ABY65355.1| copper/zinc-superoxide dismutase [Litchi chinensis] gi|436805717|gb|AGB58021.1| copper/zinc-superoxide dismutase [Litchi chinensis] Back     alignment and taxonomy information
>gi|19172405|gb|AAL85888.1|AF479059_1 copper/zinc superoxide dismutase [Sandersonia aurantiaca] Back     alignment and taxonomy information
>gi|162463249|ref|NP_001105704.1| superoxide dismutase [Cu-Zn] 4AP [Zea mays] gi|134597|sp|P23345.2|SODC4_MAIZE RecName: Full=Superoxide dismutase [Cu-Zn] 4A gi|6018682|emb|CAB57992.1| superoxide dismutase-4AP [Zea mays] gi|238013448|gb|ACR37759.1| unknown [Zea mays] Back     alignment and taxonomy information
>gi|74229677|gb|ABA00453.1| cytoplasmic Cu/ZnSOD [Gossypium hirsutum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
UNIPROTKB|P28757152 SODCC2 "Superoxide dismutase [ 0.940 0.730 0.453 7e-22
UNIPROTKB|Q0DTX5162 Os03g0219200 "Superoxide dismu 0.957 0.697 0.407 4.9e-21
TAIR|locus:2025595152 CSD1 "copper/zinc superoxide d 0.915 0.710 0.432 8e-21
UNIPROTKB|Q0DRV6152 SODCC1 "Superoxide dismutase [ 0.940 0.730 0.421 1.2e-19
UNIPROTKB|Q751L8154 SOD1 "Superoxide dismutase [Cu 0.949 0.727 0.379 1.9e-19
MGI|MGI:98351154 Sod1 "superoxide dismutase 1, 0.949 0.727 0.390 3.1e-19
ZFIN|ZDB-GENE-990415-258154 sod1 "superoxide dismutase 1, 0.949 0.727 0.403 4e-19
DICTYBASE|DDB_G0290343152 sodE "putative cytoplasmatic s 0.940 0.730 0.406 5.1e-19
FB|FBgn0003462153 Sod "Superoxide dismutase" [Dr 0.932 0.718 0.390 1.1e-18
UNIPROTKB|P07509154 sod-1 "Superoxide dismutase [C 0.949 0.727 0.364 2.2e-18
UNIPROTKB|P28757 SODCC2 "Superoxide dismutase [Cu-Zn] 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 255 (94.8 bits), Expect = 7.0e-22, P = 7.0e-22
 Identities = 58/128 (45%), Positives = 72/128 (56%)

Query:     6 VNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYXXXXXXXXXXFHVHAAGDTRHECNSA 65
             V A+AV+   EG  KG+IFFSQ+GD GPT + G           FHVHA GDT + C S 
Sbjct:     2 VKAVAVLASSEG-VKGTIFFSQEGD-GPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMST 59

Query:    66 GSHFDPHNMSHGGKEDEHRHVGDLGNL-----------FGD----VYGPDSIIGRAIVIH 110
             G HF+P    HG  +DE+RH GDLGN+             D    + G  SIIGRA+V+H
Sbjct:    60 GPHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVH 119

Query:   111 KDQDDFGR 118
              D DD G+
Sbjct:   120 ADPDDLGK 127
GO:0004784 "superoxide dismutase activity" evidence=IBA
GO:0005507 "copper ion binding" evidence=IBA
GO:0008270 "zinc ion binding" evidence=IBA
GO:0019430 "removal of superoxide radicals" evidence=IBA
UNIPROTKB|Q0DTX5 Os03g0219200 "Superoxide dismutase [Cu-Zn]" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2025595 CSD1 "copper/zinc superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DRV6 SODCC1 "Superoxide dismutase [Cu-Zn] 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q751L8 SOD1 "Superoxide dismutase [Cu-Zn]" [Ashbya gossypii ATCC 10895 (taxid:284811)] Back     alignment and assigned GO terms
MGI|MGI:98351 Sod1 "superoxide dismutase 1, soluble" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-258 sod1 "superoxide dismutase 1, soluble" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290343 sodE "putative cytoplasmatic superoxide dismutase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0003462 Sod "Superoxide dismutase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P07509 sod-1 "Superoxide dismutase [Cu-Zn]" [Neurospora crassa OR74A (taxid:367110)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7M1R5SODC_SOYBN1, ., 1, 5, ., 1, ., 10.51560.94060.7302yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.10.914
3rd Layer1.15.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Sb01g035350.1
annotation not avaliable (152 aa)
(Sorghum bicolor)
Predicted Functional Partners:
Sb09g011450.1
hypothetical protein; Destroys radicals which are normally produced within the cells and which [...] (233 aa)
   •• • 0.672
Sb10g002970.1
hypothetical protein (216 aa)
      • 0.462
Sb01g048280.1
annotation not avaliable (492 aa)
     •• 0.423
Sb10g030840.1
hypothetical protein; Occurs in almost all aerobically respiring organisms and serves to protec [...] (492 aa)
     •• 0.413
Sb04g001130.1
hypothetical protein; Occurs in almost all aerobically respiring organisms and serves to protec [...] (468 aa)
     •• 0.407

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 1e-33
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 5e-31
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 4e-29
PLN02642164 PLN02642, PLN02642, copper, zinc superoxide dismut 3e-19
COG2032179 COG2032, SodC, Cu/Zn superoxide dismutase [Inorgan 2e-16
PLN02957238 PLN02957, PLN02957, copper, zinc superoxide dismut 1e-06
PRK10290173 PRK10290, PRK10290, superoxide dismutase; Provisio 1e-06
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information 
 Score =  113 bits (286), Expect = 1e-33
 Identities = 55/124 (44%), Positives = 69/124 (55%), Gaps = 16/124 (12%)

Query: 8   AIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGS 67
           A+AV+ G  G   G++ F+Q G  G  ++   L GLPPG HGFH+H  GD    C SAG 
Sbjct: 1   AVAVLKGAGGKVVGTVTFTQVGG-GGVLVTVDLSGLPPGKHGFHIHEFGDCSPGCTSAGG 59

Query: 68  HFDPHNMSHGGKEDEHRHVGDLGNLFGD---------------VYGPDSIIGRAIVIHKD 112
           HF+P    HGG  DE RH GDLGN+  D               + G DSIIGR++VIH  
Sbjct: 60  HFNPDGKKHGGPNDEGRHAGDLGNIVVDADGVAKVEIVDDRVTLSGGDSIIGRSLVIHAG 119

Query: 113 QDDF 116
           +DD 
Sbjct: 120 EDDL 123

superoxide dismutases (SODs) catalyze the conversion of superoxide radicals to hydrogen peroxide and molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the human SOD1 gene cause familial amyotrophic lateral sclerosis (Lou Gehrig's disease). Structure is an eight-stranded beta sandwich, similar to the immunoglobulin fold. Length = 140
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information
>gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|224943 COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|182357 PRK10290, PRK10290, superoxide dismutase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
PLN02386152 superoxide dismutase [Cu-Zn] 100.0
PLN02642164 copper, zinc superoxide dismutase 100.0
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 100.0
KOG0441154 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Ino 100.0
PRK15388177 Cu/Zn superoxide dismutase; Provisional 100.0
PRK10290173 superoxide dismutase; Provisional 100.0
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 100.0
PLN02957238 copper, zinc superoxide dismutase 100.0
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 99.97
KOG4656247 consensus Copper chaperone for superoxide dismutas 99.95
PF07452119 CHRD: CHRD domain; InterPro: IPR010895 CHRD (after 86.96
smart00754118 CHRD A domain in the BMP inhibitor chordin and in 80.29
>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information 
Probab=100.00  E-value=9.5e-41  Score=239.81  Aligned_cols=111  Identities=56%  Similarity=1.020  Sum_probs=102.9

Q ss_pred             eeEEEEEeCCCCCceEEEEEEEcCCCCcEEEEEEEecCCCCcceeEEeccCCCCCCCCccCCCcCCCCCCCCCCCCCCCC
Q 047766            6 VNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFDPHNMSHGGKEDEHRH   85 (118)
Q Consensus         6 ~~Ava~l~~~~~~v~G~i~f~q~~~~~~v~v~~~i~GL~~g~h~~HIHe~gd~~~~c~saGgh~np~~~~h~~p~~~~~~   85 (118)
                      .+|+|+|++ .+.|+|+|+|+|..++ .++|+++++||+||+|+|||||+|||+++|.|||+||||.++.|+.|.+..+|
T Consensus         2 ~~a~a~~~~-~~~v~G~v~f~q~~~g-~v~i~~~~~GL~pG~hg~HIHe~Gd~~~g~~SaGgHfnP~~~~Hg~~~~~~~H   79 (152)
T PLN02386          2 VKAVAVLNS-SEGVKGTIFFTQEGDG-PTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRH   79 (152)
T ss_pred             ceEEEEEcC-CCCCEEEEEEEEcCCC-CEEEEEEEeCCCCCceeEEEeCCCCCCCCcccccCccCCCCCCCCCCCcccCc
Confidence            689999998 4569999999998764 69999999999999999999999999999999999999999999999998999


Q ss_pred             cCcccceEE---------------eecCCCCcccceEEEecCCCCCCC
Q 047766           86 VGDLGNLFG---------------DVYGPDSIIGRAIVIHKDQDDFGR  118 (118)
Q Consensus        86 ~GDLgnl~~---------------~L~g~~siiGRSiVIH~~~Dd~g~  118 (118)
                      +||||||.+               +|.++++|+|||||||+++|||++
T Consensus        80 ~GDLgNi~~~~~G~a~~~~~~~~~~L~g~~~i~GrslVIHa~~DD~~~  127 (152)
T PLN02386         80 AGDLGNVTVGDDGTATFTIVDKQIPLTGPNSIVGRAVVVHADPDDLGK  127 (152)
T ss_pred             cccccCEEECCCCeEEEEEECCceEeCCCCccCCcEEEEEccCCCcCC
Confidence            999999987               456789999999999999999963

>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>KOG0441 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07452 CHRD: CHRD domain; InterPro: IPR010895 CHRD (after SWISS-PROT abbreviation for chordin) is a novel domain identified in chordin, an inhibitor of bone morphogenetic proteins Back     alignment and domain information
>smart00754 CHRD A domain in the BMP inhibitor chordin and in microbial proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
2q2l_A152 Crystal Structure Of Superoxide Dismutase From P. A 2e-20
1to4_A156 Structure Of The Cytosolic Cu,Zn Sod From S. Manson 8e-19
3gtt_A153 Mouse Sod1 Length = 153 9e-19
3ltv_A153 Mouse-Human Sod1 Chimera Length = 153 4e-18
3km1_A154 Zinc-Reconstituted Tomato Chloroplast Superoxide Di 9e-18
1srd_A154 Three-Dimensional Structure Of Cu,Zn-Superoxide Dis 5e-17
3f7k_A152 X-Ray Crystal Structure Of An Alvinella Pompejana C 6e-17
3l9y_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 7e-17
3l9e_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 7e-17
3kbe_A157 Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Le 8e-17
3ce1_A168 Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE 9e-17
1ptz_A153 Crystal Structure Of The Human Cu, Zn Superoxide Di 9e-17
1sos_A154 Atomic Structures Of Wild-type And Thermostable Mut 1e-16
1l3n_A153 The Solution Structure Of Reduced Dimeric Copper Zi 1e-16
1n18_A154 Thermostable Mutant Of Human Superoxide Dismutase, 1e-16
1fun_A153 Superoxide Dismutase Mutant With Lys 136 Replaced B 1e-16
3ecw_A153 Crystal Structure Of The Als-Related Pathological M 2e-16
3gtv_A153 Human-Mouse Sod1 Chimera Length = 153 2e-16
1f1g_A154 Crystal Structure Of Yeast Cuznsod Exposed To Nitri 2e-16
1sdy_A153 Structure Solution And Molecular Dynamics Refinemen 3e-16
3sod_O152 Changes In Crystallographic Structure And Thermosta 3e-16
2gbt_A153 C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 3e-16
1e9o_A152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 4e-16
1e9q_A151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 4e-16
1sda_O152 Crystal Structure Of Peroxynitrite-Modified Bovine 4e-16
1dsw_A153 The Solution Structure Of A Monomeric, Reduced Form 4e-16
1n19_A154 Structure Of The Hsod A4v Mutant Length = 154 5e-16
1xso_A150 Three-Dimensional Structure Of Xenopus Laevis Cu,Zn 5e-16
1ba9_A153 The Solution Structure Of Reduced Monomeric Superox 5e-16
1mfm_A153 Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC 5e-16
1e9p_A151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 6e-16
1q0e_A152 Atomic Resolution (1.15 ) Crystal Structure Of Bovi 8e-16
1cob_A151 Crystal Structure Solution And Refinement Of The Se 8e-16
1f1a_A154 Crystal Structure Of Yeast H48q Cuznsod Fals Mutant 9e-16
1azv_A153 Familial Als Mutant G37r Cuznsod (Human) Length = 1 9e-16
4bcy_A153 Monomeric Human Cu,zn Superoxide Dismutase, Mutatio 1e-15
2zky_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 1e-15
2xjk_A153 Monomeric Human Cu,Zn Superoxide Dismutase Length = 1e-15
3gzp_A153 Human Sod1 G93a Metal-Free Variant Length = 153 1e-15
3gzo_A154 Human Sod1 G93a Variant Length = 154 1e-15
4b3e_A154 Structure Of Copper-Zinc Superoxide Dismutase Compl 1e-15
1hl4_A154 The Structure Of Apo Type Human Cu, Zn Superoxide D 1e-15
2wyt_A153 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng 1e-15
1hl5_A153 The Structure Of Holo Type Human Cu, Zn Superoxide 1e-15
2wko_F154 Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 1e-15
2wyz_A153 L38v Sod1 Mutant Complexed With Ump Length = 153 1e-15
2c9s_A153 1.24 Angstroms Resolution Structure Of Zn-Zn Human 1e-15
1ozu_A153 Crystal Structure Of Familial Als Mutant S134n Of H 1e-15
4a7g_A153 Structure Of Human I113t Sod1 Mutant Complexed With 2e-15
1f18_A154 Crystal Structure Of Yeast Copper-Zinc Superoxide D 2e-15
1e9p_B151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 2e-15
1f1d_A154 Crystal Structure Of Yeast H46c Cuznsod Mutant Leng 2e-15
1jk9_A153 Heterodimer Between H48f-Ysod1 And Yccs Length = 15 2e-15
1b4t_A153 H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPE 2e-15
1cb4_A151 Crystal Structure Of Copper, Zinc Superoxide Dismut 3e-15
1e9q_B151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 3e-15
1e9o_B152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 3e-15
1uxl_A153 I113t Mutant Of Human Sod1 Length = 153 3e-15
1uxm_A153 A4v Mutant Of Human Sod1 Length = 153 3e-15
3gzq_A154 Human Sod1 A4v Metal-Free Variant Length = 154 3e-15
2r27_A154 Constitutively Zinc-Deficient Mutant Of Human Super 3e-15
2gbu_A153 C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase 4e-15
1oez_W153 Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu 5e-15
3h2q_A153 Human Sod1 H80r Variant, P21 Crystal Form Length = 5e-15
3qqd_A154 Human Sod1 H80r Variant, P212121 Crystal Form Lengt 6e-15
2zkw_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 7e-15
3mnd_A152 Crystallographic Analysis Of The Cystosolic CuZN SU 8e-15
2vr7_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 8e-15
2vr6_A153 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 8e-15
3h2p_A153 Human Sod1 D124v Variant Length = 153 9e-15
2vr8_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 9e-15
3cqq_A153 Human Sod1 G85r Variant, Structure Ii Length = 153 9e-15
1p1v_A153 Crystal Structure Of Fals-Associated Human Copper-Z 1e-14
3gqf_A153 Structural And Biophysical Properties Of The Pathog 2e-14
2nnx_A154 Crystal Structure Of The H46r, H48q Double Mutant O 2e-14
2xjl_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 2e-13
3hff_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 8e-13
2e46_A157 Crystal Structure Analysis Of The Clock Protein Ea4 1e-12
2e47_A156 Crystal Structure Analysis Of The Clock Protein Ea4 1e-12
1do5_A154 Human Copper Chaperone For Superoxide Dismutase Dom 2e-11
2jlp_A222 Crystal Structure Of Human Extracellular Copper-Zin 9e-09
1xtm_B175 Crystal Structure Of The Double Mutant Y88h-p104h O 6e-04
>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 Back     alignment and structure 
Iteration: 1

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 70/125 (56%), Gaps = 17/125 (13%)
Query: 9   IAVITGREGGPKGSIFFSQDGDHGPTILNGYXXXXXXXXXXFHVHAAGDTRHECNSAGSH 68
           +AV++  EG   G+I F+Q+GD GPT + G           FHVHA GDT + C S G H
Sbjct: 5   VAVLSSSEG-VAGTILFTQEGD-GPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPH 62
Query: 69  FDPHNMSHGGKEDEHRHVGDLGNL-FGD--------------VYGPDSIIGRAIVIHKDQ 113
           F+P    HG  EDE RH GDLGN+  GD              + GP SIIGRA+V+H D 
Sbjct: 63  FNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHADP 122
Query: 114 DDFGR 118
           DD G+
Sbjct: 123 DDLGK 127
>pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 Back     alignment and structure
>pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 Back     alignment and structure
>pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 Back     alignment and structure
>pdb|3L9Y|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM The Silkworm Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3L9E|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM THE SILKWORM Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3KBE|A Chain A, Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Length = 157 Back     alignment and structure
>pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 Back     alignment and structure
>pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 Back     alignment and structure
>pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 Back     alignment and structure
>pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 Back     alignment and structure
>pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 Back     alignment and structure
>pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 Back     alignment and structure
>pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|1F1G|A Chain A, Crystal Structure Of Yeast Cuznsod Exposed To Nitric Oxide Length = 154 Back     alignment and structure
>pdb|1SDY|A Chain A, Structure Solution And Molecular Dynamics Refinement Of The Yeast Cu,Zn Enzyme Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3SOD|O Chain O, Changes In Crystallographic Structure And Thermostability Of A Cu,Zn Superoxide Dismutase Mutant Resulting From The Removal Of Buried Cysteine Length = 152 Back     alignment and structure
>pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 Back     alignment and structure
>pdb|1E9O|A Chain A, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1E9Q|A Chain A, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1SDA|O Chain O, Crystal Structure Of Peroxynitrite-Modified Bovine Cu,Zn Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1DSW|A Chain A, The Solution Structure Of A Monomeric, Reduced Form Of Human Copper, Zinc Superoxide Dismutase Bearing The Same Charge As The Native Protein Length = 153 Back     alignment and structure
>pdb|1N19|A Chain A, Structure Of The Hsod A4v Mutant Length = 154 Back     alignment and structure
>pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|1BA9|A Chain A, The Solution Structure Of Reduced Monomeric Superoxide Dismutase, Nmr, 36 Structures Length = 153 Back     alignment and structure
>pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 Back     alignment and structure
>pdb|1E9P|A Chain A, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1Q0E|A Chain A, Atomic Resolution (1.15 ) Crystal Structure Of Bovine Copper, Zinc Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1COB|A Chain A, Crystal Structure Solution And Refinement Of The Semisynthetic Cobalt Substituted Bovine Erythrocyte Enzyme Superoxide Dismutase At 2.0 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1F1A|A Chain A, Crystal Structure Of Yeast H48q Cuznsod Fals Mutant Analog Length = 154 Back     alignment and structure
>pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 Back     alignment and structure
>pdb|4BCY|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Mutation H43f Length = 153 Back     alignment and structure
>pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 Back     alignment and structure
>pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 Back     alignment and structure
>pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 Back     alignment and structure
>pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 Back     alignment and structure
>pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 Back     alignment and structure
>pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 Back     alignment and structure
>pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 Back     alignment and structure
>pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 Back     alignment and structure
>pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 Back     alignment and structure
>pdb|1F18|A Chain A, Crystal Structure Of Yeast Copper-Zinc Superoxide Dismutase Mutant Gly85arg Length = 154 Back     alignment and structure
>pdb|1E9P|B Chain B, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1F1D|A Chain A, Crystal Structure Of Yeast H46c Cuznsod Mutant Length = 154 Back     alignment and structure
>pdb|1JK9|A Chain A, Heterodimer Between H48f-Ysod1 And Yccs Length = 153 Back     alignment and structure
>pdb|1B4T|A Chain A, H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPERATURE (298k) Structure Length = 153 Back     alignment and structure
>pdb|1CB4|A Chain A, Crystal Structure Of Copper, Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1E9Q|B Chain B, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9O|B Chain B, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 Back     alignment and structure
>pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 Back     alignment and structure
>pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 Back     alignment and structure
>pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 Back     alignment and structure
>pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 Back     alignment and structure
>pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 Back     alignment and structure
>pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 Back     alignment and structure
>pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 Back     alignment and structure
>pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 Back     alignment and structure
>pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 Back     alignment and structure
>pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 Back     alignment and structure
>pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 Back     alignment and structure
>pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 Back     alignment and structure
>pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 Back     alignment and structure
>pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 Back     alignment and structure
>pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 Back     alignment and structure
>pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 Back     alignment and structure
>pdb|2JLP|A Chain A, Crystal Structure Of Human Extracellular Copper-Zinc Superoxide Dismutase. Length = 222 Back     alignment and structure
>pdb|1XTM|B Chain B, Crystal Structure Of The Double Mutant Y88h-p104h Of A Sod-like Protein From Bacillus Subtilis. Length = 175 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 5e-38
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 2e-36
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 4e-36
1do5_A154 Human copper chaperone for superoxide dismutase do 5e-36
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 7e-36
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 8e-36
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 1e-35
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 1e-35
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 4e-35
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 2e-34
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 2e-34
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 1e-33
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 4e-31
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 3e-30
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 1e-29
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 2e-29
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 7e-29
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 7e-27
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 4e-26
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 6e-26
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 8e-26
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 1e-22
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 4e-22
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 2e-21
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
 Score =  124 bits (314), Expect = 5e-38
 Identities = 56/128 (43%), Positives = 75/128 (58%), Gaps = 16/128 (12%)

Query: 6   VNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSA 65
           + A+ V+TG   G KG + F+Q+ D+GP  ++    GL  G HGFHVH  GDT + C SA
Sbjct: 4   MKAVCVMTG-TAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSA 62

Query: 66  GSHFDPHNMSHGGKEDEHRHVGDLGNLFGD---------------VYGPDSIIGRAIVIH 110
           G+HF+P    HG  ED  RHVGDLGN+                  + G  SIIGR++VIH
Sbjct: 63  GAHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIH 122

Query: 111 KDQDDFGR 118
           +++DD GR
Sbjct: 123 ENEDDLGR 130
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 100.0
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 100.0
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 100.0
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 100.0
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 100.0
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 100.0
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 100.0
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 100.0
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 100.0
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 100.0
1do5_A154 Human copper chaperone for superoxide dismutase do 100.0
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 100.0
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 100.0
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 100.0
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 100.0
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 100.0
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 100.0
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 100.0
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 100.0
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 100.0
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 100.0
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 100.0
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 100.0
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
Probab=100.00  E-value=1.2e-43  Score=253.98  Aligned_cols=112  Identities=46%  Similarity=0.868  Sum_probs=104.1

Q ss_pred             eeEEEEEeCCCCCceEEEEEEEcCCCCcEEEEEEEecCCCCcceeEEeccCCCCCCCCccCCCcCCCCCCCCCCCCCCCC
Q 047766            6 VNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFDPHNMSHGGKEDEHRH   85 (118)
Q Consensus         6 ~~Ava~l~~~~~~v~G~i~f~q~~~~~~v~v~~~i~GL~~g~h~~HIHe~gd~~~~c~saGgh~np~~~~h~~p~~~~~~   85 (118)
                      .+|||+|++ +++|+|+|+|+|.+.+..|+|+++|+||+||+|+|||||+|||+++|.|||+||||+++.|+.|.+..||
T Consensus         2 ~~Avavl~g-~~~v~G~v~f~q~~~~~~v~v~~~i~GL~pG~hg~HIHe~Gd~s~gc~SaGgHfnP~~~~Hg~p~~~~~h   80 (153)
T 4a7u_A            2 TKAVCVLKG-DGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERH   80 (153)
T ss_dssp             EEEEEEEBC-SSSCEEEEEEEESSTTCCEEEEEEEESCCSEEEEEEEESCCCCTTSGGGGCSBCCTTCCCCCCTTCSSCC
T ss_pred             cEEEEEEcC-CCccEEEEEEEEeCCCCcEEEEEEEECCCCCcccEEEeecCccccccccccCeecccCCcCCCCCcCCCc
Confidence            589999999 5789999999999864479999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccceEE---------------eecCCCCcccceEEEecCCCCCCC
Q 047766           86 VGDLGNLFG---------------DVYGPDSIIGRAIVIHKDQDDFGR  118 (118)
Q Consensus        86 ~GDLgnl~~---------------~L~g~~siiGRSiVIH~~~Dd~g~  118 (118)
                      +||||||++               +|.++++|+|||||||+++|||||
T Consensus        81 ~GDLgni~~~~~G~a~~~~~d~~isL~g~~~iiGRsiVIHa~~Dd~g~  128 (153)
T 4a7u_A           81 VGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGK  128 (153)
T ss_dssp             TTEEEEEEECTTSCEEEEEEESSCBSSGGGBCTTSEEEEESSCCCTTC
T ss_pred             cCcccCeEeCCCceEEEEEEcCceEecCCcccCCeEEEEEcCCccCCC
Confidence            999999987               345678999999999999999975
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 1e-24
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 2e-24
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 1e-22
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 7e-22
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 8e-22
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 2e-20
d1eqwa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm 1e-17
d1esoa_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch 2e-17
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 2e-17
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 3e-15
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 1e-14
d1pzsa_171 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco 8e-14
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 89.3 bits (221), Expect = 1e-24
 Identities = 53/126 (42%), Positives = 69/126 (54%), Gaps = 16/126 (12%)

Query: 8   AIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGS 67
           A+ V+ G +G  +G I F Q   +GP  + G + GL  G HGFHVH  GD    C SAG 
Sbjct: 4   AVCVLKG-DGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGP 62

Query: 68  HFDPHNMSHGGKEDEHRHVGDLGNLFGD---------------VYGPDSIIGRAIVIHKD 112
           HF+P +  HGG +DE RHVGDLGN+  D               + G   IIGR +V+H+ 
Sbjct: 63  HFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEK 122

Query: 113 QDDFGR 118
            DD G+
Sbjct: 123 ADDLGK 128
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 100.0
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 100.0
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 100.0
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 100.0
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 100.0
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 100.0
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 100.0
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 100.0
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 100.0
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 100.0
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 100.0
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 100.0
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Blood fluke (Schistosoma mansoni) [TaxId: 6183]

Probab=100.00  E-value=1.2e-41  Score=242.67  Aligned_cols=113  Identities=50%  Similarity=0.937  Sum_probs=104.6

Q ss_pred             ceeEEEEEeCCCCCceEEEEEEEcCCCCcEEEEEEEecCCCCcceeEEeccCCCCCCCCccCCCcCCCCCCCCCCCCCCC
Q 047766            5 KVNAIAVITGREGGPKGSIFFSQDGDHGPTILNGYLHGLPPGHHGFHVHAAGDTRHECNSAGSHFDPHNMSHGGKEDEHR   84 (118)
Q Consensus         5 ~~~Ava~l~~~~~~v~G~i~f~q~~~~~~v~v~~~i~GL~~g~h~~HIHe~gd~~~~c~saGgh~np~~~~h~~p~~~~~   84 (118)
                      ..+|+|+|++ ++.|+|+|+|+|...++.++|+++|+||+||.|+|||||+|||+++|.|+|+||||++..|+.|.+..+
T Consensus         3 ~~~Ava~~~g-~~~v~G~v~F~Q~~~~~~v~V~~~l~GL~pG~hg~HIHe~Gd~s~~~~saGgH~nP~~~~hg~~~~~~~   81 (156)
T d1to4a_           3 NMKAVCVMTG-TAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIR   81 (156)
T ss_dssp             CCEEEEEEBC-SSSCEEEEEEEESSTTSCEEEEEEEESCCSEEEEEEEESCCCCTTTTGGGCSBCCTTCCCCCCTTCSSC
T ss_pred             ceEEEEEEcC-CCCcEEEEEEEEECCCCcEEEEEEEccCCCcceeeEEcCCCccCCcccccccccccccccccCCCcccC
Confidence            4689999998 568999999999887667999999999999999999999999999999999999999999999998899


Q ss_pred             CcCcccceEE---------------eecCCCCcccceEEEecCCCCCCC
Q 047766           85 HVGDLGNLFG---------------DVYGPDSIIGRAIVIHKDQDDFGR  118 (118)
Q Consensus        85 ~~GDLgnl~~---------------~L~g~~siiGRSiVIH~~~Dd~g~  118 (118)
                      |+||||||.+               +|++.++|+|||||||+++|||++
T Consensus        82 h~GDlgni~~~~~G~~~~~~~d~~l~l~g~~~iiGRsiVIH~~~Dd~~~  130 (156)
T d1to4a_          82 HVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGR  130 (156)
T ss_dssp             CTTEEEEEEECTTSCEEEEEEESSCBSSGGGBCTTSEEEEESSCCCTTC
T ss_pred             ccCccccEEeCCCceEEEEEECceeecCCcCCcCCcEEEEECCCCcccc
Confidence            9999999987               345678999999999999999974
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure