Citrus Sinensis ID: 047802

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKRQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLTVEKSTPLEVLVSPRLSASLYG
cccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccEEEcccccccccEEEEEEEEccccccccccccccccccccccccccccccccccEEccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEcccccccc
ccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccEEEEEEccEEcccccEEEEEEEEEccccccccccHHcccHHHccccccEccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccEEEEEccccccHHcc
MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDiqvgtkrqsmeectvsgynfpsgtqLFINVWklqrdphvweepckfqperfltrhkdtdvrgqnfellpfssgrrmcpgvSFALQVMQFTLaslphgfdiatpsnepldmgerlgltvekstplevlvsprlsaslyg
MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKRQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERfltrhkdtdvrGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLtvekstplevlvsprlsaslyg
MTTLYTLPilqalilaatdttavtltwiiSPLLNHHDILNKARNELDIQVGTKRQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLTVEKSTPLEVLVSPRLSASLYG
**TLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKRQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIA*************************************
MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKRQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLTVEKSTPLEVLVSPRLSASLYG
MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKRQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLTVEKSTPLEVLVSPRLSASLYG
MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKRQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLTVEKSTPLEVLVSPRLSA*L**
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKRQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLTVEKSTPLEVLVSPRLSASLYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
Q9SZ46524 Cytochrome P450 82C4 OS=A yes no 0.935 0.330 0.483 5e-51
O49396512 Cytochrome P450 82C3 OS=A no no 0.935 0.337 0.473 7e-50
O49394523 Cytochrome P450 82C2 OS=A no no 0.935 0.330 0.468 8e-49
O49858527 Cytochrome P450 82A3 OS=G no no 0.929 0.326 0.468 1e-48
Q43068544 Cytochrome P450 82A1 (Fra N/A no 0.929 0.316 0.439 3e-44
O49859525 Cytochrome P450 82A4 OS=G no no 0.918 0.323 0.446 2e-43
O81972522 Cytochrome P450 82A2 OS=G no no 0.929 0.329 0.419 2e-41
Q9LSF8515 Cytochrome P450 82G1 OS=A no no 0.924 0.332 0.398 5e-38
Q9SD85513 Flavonoid 3'-monooxygenas no no 0.951 0.343 0.371 2e-35
O04773523 Flavonoid 3',5'-hydroxyla N/A no 0.951 0.336 0.345 1e-34
>sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 Back     alignment and function desciption
 Score =  200 bits (508), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 131/207 (63%), Gaps = 34/207 (16%)

Query: 12  ALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKR----------------- 54
           ALIL  +DT+A TLTW IS LLN+ ++L KA++E+DI VG  R                 
Sbjct: 317 ALILGGSDTSASTLTWAISLLLNNKEMLKKAQDEIDIHVGRDRNVEDSDIENLVYLQAII 376

Query: 55  ----------------QSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERF 98
                           ++ME+CTV+GY  P GT+L +NVWK+QRDP V+ EP +F+PERF
Sbjct: 377 KETLRLYPAGPLLGPREAMEDCTVAGYYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERF 436

Query: 99  LT-RHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDM 157
           +T   K+ DVRGQNFEL+PF SGRR CPG S A+QV+   LA   H FD+ T  + P+DM
Sbjct: 437 ITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDM 496

Query: 158 GERLGLTVEKSTPLEVLVSPRLSASLY 184
            E  GLT+ K+TPLEVL+SPR+   L+
Sbjct: 497 SENPGLTIPKATPLEVLISPRIKEELF 523
Can hydroxylates 8-methoxypsoralen to form 5-hydroxy-8-methoxypsoralen in vivo and in vitro. Involved in the early iron deficiency response, possibly through an IDE1-like mediated pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 Back     alignment and function description
>sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 Back     alignment and function description
>sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 Back     alignment and function description
>sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 Back     alignment and function description
>sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 Back     alignment and function description
>sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 Back     alignment and function description
>sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
225458465 527 PREDICTED: cytochrome P450 82C4 [Vitis v 0.940 0.330 0.521 2e-56
224137318 392 cytochrome P450 [Populus trichocarpa] gi 0.940 0.443 0.516 2e-54
225468906 528 PREDICTED: cytochrome P450 82C4 [Vitis v 0.929 0.325 0.529 3e-54
297745692 543 unnamed protein product [Vitis vinifera] 0.929 0.316 0.529 3e-54
224137290 538 cytochrome P450 [Populus trichocarpa] gi 0.940 0.323 0.526 1e-53
224109946250 cytochrome P450 [Populus trichocarpa] gi 0.940 0.696 0.526 2e-53
255538496 528 cytochrome P450, putative [Ricinus commu 0.935 0.327 0.509 2e-53
224137286 465 cytochrome P450 [Populus trichocarpa] gi 0.940 0.374 0.521 4e-53
224123398 525 cytochrome P450 [Populus trichocarpa] gi 0.935 0.329 0.490 6e-53
356510322 526 PREDICTED: cytochrome P450 82C4-like [Gl 0.935 0.328 0.512 2e-52
>gi|225458465|ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|302142392|emb|CBI19595.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 137/207 (66%), Gaps = 33/207 (15%)

Query: 12  ALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKRQ---------------- 55
           ALIL  +DTTA TLTW IS LLN+   L KA+ ELD+ VG +RQ                
Sbjct: 320 ALILGGSDTTAGTLTWAISLLLNNRHALKKAQEELDLCVGMERQVEESDVKNLVYLQAII 379

Query: 56  -----------------SMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERF 98
                            ++++CTV+GYN P+GT+L +N+WKLQRDP VW  PC FQPERF
Sbjct: 380 KETLRLYPAGPLLGPREALDDCTVAGYNVPAGTRLIVNIWKLQRDPSVWTNPCAFQPERF 439

Query: 99  LTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMG 158
           L  H D DV+GQ FEL+PF SGRR CPGVSFALQV+  TLA L H F+++TP ++P+DM 
Sbjct: 440 LNAHADVDVKGQQFELMPFGSGRRSCPGVSFALQVLHLTLARLLHAFELSTPVDQPVDMT 499

Query: 159 ERLGLTVEKSTPLEVLVSPRLSASLYG 185
           E  GLT+ K+TPLEVL++PRL++ LY 
Sbjct: 500 ESSGLTIPKATPLEVLLTPRLNSKLYA 526

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224137318|ref|XP_002327096.1| cytochrome P450 [Populus trichocarpa] gi|222835411|gb|EEE73846.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225468906|ref|XP_002268915.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|147794787|emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745692|emb|CBI40977.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224137290|ref|XP_002327089.1| cytochrome P450 [Populus trichocarpa] gi|222835404|gb|EEE73839.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224109946|ref|XP_002333178.1| cytochrome P450 [Populus trichocarpa] gi|222835027|gb|EEE73476.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255538496|ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis] gi|223551014|gb|EEF52500.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224137286|ref|XP_002327088.1| cytochrome P450 [Populus trichocarpa] gi|222835403|gb|EEE73838.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123398|ref|XP_002330305.1| cytochrome P450 [Populus trichocarpa] gi|222871340|gb|EEF08471.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356510322|ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
TAIR|locus:2116622512 CYP82C3 ""cytochrome P450, fam 0.708 0.255 0.575 2.3e-44
TAIR|locus:2116607524 CYP82C4 ""cytochrome P450, fam 0.708 0.25 0.575 5.9e-44
TAIR|locus:2116652523 CYP82C2 ""cytochrome P450, fam 0.708 0.250 0.560 4.1e-43
TAIR|locus:2090275515 CYP82G1 "cytochrome P450, fami 0.697 0.250 0.480 1.4e-33
TAIR|locus:2040174527 CYP82F1 ""cytochrome P450, fam 0.632 0.222 0.470 1.4e-32
TAIR|locus:2142878513 TT7 "TRANSPARENT TESTA 7" [Ara 0.681 0.245 0.444 6.1e-31
TAIR|locus:2139099520 CYP706A5 ""cytochrome P450, fa 0.670 0.238 0.472 1.7e-30
TAIR|locus:2139114518 CYP706A6 ""cytochrome P450, fa 0.681 0.243 0.468 5.9e-30
TAIR|locus:2139084516 CYP706A4 ""cytochrome P450, fa 0.681 0.244 0.453 3.8e-29
TAIR|locus:2043605512 CYP76C2 ""cytochrome P450, fam 0.643 0.232 0.451 1.8e-27
TAIR|locus:2116622 CYP82C3 ""cytochrome P450, family 82, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 420 (152.9 bits), Expect = 2.3e-44, Sum P(2) = 2.3e-44
 Identities = 76/132 (57%), Positives = 100/132 (75%)

Query:    54 RQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRH-KDTDVRGQNF 112
             R++ME+CTV+GYN P GT+L +NVWK+QRDP V+ EP +F+PERF+T   KD DVRGQNF
Sbjct:   380 REAMEDCTVAGYNVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKDFDVRGQNF 439

Query:   113 ELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLTVEKSTPLE 172
             EL+PF SGRR CPG S A+Q++   LA   H F++ T  + P+DM E  GLT+ K+TPLE
Sbjct:   440 ELMPFGSGRRSCPGPSLAMQMLHLGLARFLHSFEVKTVLDRPVDMSESPGLTITKATPLE 499

Query:   173 VLVSPRLSASLY 184
             VL++PRL   L+
Sbjct:   500 VLINPRLKRELF 511
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2116607 CYP82C4 ""cytochrome P450, family 82, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116652 CYP82C2 ""cytochrome P450, family 82, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090275 CYP82G1 "cytochrome P450, family 82, subfamily G, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040174 CYP82F1 ""cytochrome P450, family 82, subfamily F, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142878 TT7 "TRANSPARENT TESTA 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139099 CYP706A5 ""cytochrome P450, family 706, subfamily A, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139114 CYP706A6 ""cytochrome P450, family 706, subfamily A, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139084 CYP706A4 ""cytochrome P450, family 706, subfamily A, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014732001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (537 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-50
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 9e-46
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 6e-38
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 5e-29
pfam00067461 pfam00067, p450, Cytochrome P450 3e-27
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 4e-27
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 8e-27
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 3e-22
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 7e-20
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-19
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-19
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 3e-18
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 4e-18
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 4e-18
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 3e-15
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 4e-13
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-07
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 5e-07
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 5e-07
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 7e-07
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 8e-06
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 8e-06
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 3e-05
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 0.002
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 0.003
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information 
 Score =  169 bits (431), Expect = 1e-50
 Identities = 81/218 (37%), Positives = 116/218 (53%), Gaps = 42/218 (19%)

Query: 10  LQALIL----AATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKR----------- 54
           ++AL+L    A TDTT+ T+ W I+ L+ H DIL KA+ ELD  VG  R           
Sbjct: 298 IKALLLNLFTAGTDTTSSTVEWAIAELIRHPDILKKAQEELDAVVGRDRLVSESDLPQLT 357

Query: 55  ----------------------QSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCK 92
                                  + EEC ++GY+ P G  L +NVW + RDP  W +P +
Sbjct: 358 YLQAVIKETFRLHPSTPLSLPRMAAEECEINGYHIPKGATLLVNVWAIARDPEQWPDPLE 417

Query: 93  FQPERFLT--RHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATP 150
           F+P+RFL    H   DV+G +FEL+PF +GRR+C G+S+ L+++    A+L H FD    
Sbjct: 418 FRPDRFLPGGEHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLLTATLVHAFDWELA 477

Query: 151 SN---EPLDMGERLGLTVEKSTPLEVLVSPRLSASLYG 185
                + L+M E  GLT++++ PL V   PRL  S YG
Sbjct: 478 DGQTPDKLNMEEAYGLTLQRAVPLMVHPRPRLLPSAYG 515

Length = 517
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 99.97
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-45  Score=303.09  Aligned_cols=174  Identities=29%  Similarity=0.486  Sum_probs=158.2

Q ss_pred             CchhhHHHHHHHHHHhhhhcHHHHHHHHHHHHhhChHHHHHHHHHHhHhhCCC---------------------------
Q 047802            1 MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTK---------------------------   53 (185)
Q Consensus         1 l~~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~~~---------------------------   53 (185)
                      ||.++|+++++.+++||.||||++++.++|+|++||++|+|||+||+++....                           
T Consensus       290 lt~dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~ltyd~l~~L~YLd~Vi~ETLR~yP~  369 (499)
T KOG0158|consen  290 LTDDEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEGLTYDSLSKLKYLDMVIKETLRLYPP  369 (499)
T ss_pred             cCHHHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCCCCHHHHhCCcHHHHHHHHHHhhCCC
Confidence            68999999999999999999999999999999999999999999999985432                           


Q ss_pred             -----Cccccceeee-ceeeCCCCEEEEchhhhccCCCCCCCCCCCCCCccccCCCCCCcCCCccceeeccCCCCCCcch
Q 047802           54 -----RQSMEECTVS-GYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGV  127 (185)
Q Consensus        54 -----r~~~~d~~i~-~~~i~~g~~v~~~~~~~~~d~~~~~~p~~f~P~R~~~~~~~~~~~~~~~~~~~fg~G~~~C~G~  127 (185)
                           |.|++|+++. ++.|+||+.|.++.+++||||++|+||++|+||||.+.+..   ..++..|+|||.|||.|+|+
T Consensus       370 ~~~~~R~C~k~~~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~---~~~~~~ylPFG~GPR~CIGm  446 (499)
T KOG0158|consen  370 APFLNRECTKDYEIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNK---SRHPGAYLPFGVGPRNCIGM  446 (499)
T ss_pred             cccccceecCceecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCccc---ccCCccccCCCCCccccHHH
Confidence                 9999999999 99999999999999999999999999999999999987622   45788999999999999999


Q ss_pred             HHHHHHHHHHHHHhcccceeecCCCCCCCCcccc---eeeeecCCCeEEEEEecC
Q 047802          128 SFALQVMQFTLASLPHGFDIATPSNEPLDMGERL---GLTVEKSTPLEVLVSPRL  179 (185)
Q Consensus       128 ~la~~~~~~~~~~ll~~f~~~~~~~~~~~~~~~~---~~~~~~~~~~~v~~~~R~  179 (185)
                      +||++|+|+.+++||++|+++..+.+...  ...   ++.+.|+.++++++.+|.
T Consensus       447 Rfa~mq~K~~L~~lL~~f~~~~~~~t~~~--~~~~~~~~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  447 RFALMEAKLALAHLLRNFSFEVCPTTIIP--LEGDPKGFTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             HHHHHHHHHHHHHHHhhCEEecCCcccCc--ccCCccceeeecCCceEEEEEeCC
Confidence            99999999999999999999988743222  333   677899999999999985

>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 1e-11
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 1e-11
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-11
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 2e-11
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-11
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-11
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 2e-11
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 2e-11
3pm0_A507 Structural Characterization Of The Complex Between 7e-11
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 2e-10
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 1e-09
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-09
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 4e-09
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-08
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 8e-08
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-07
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 2e-07
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 2e-07
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 3e-07
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-07
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 3e-07
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 3e-07
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 3e-07
1fah_A471 Structure Of Cytochrome P450 Length = 471 3e-07
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-07
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 3e-07
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 3e-07
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 3e-07
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 3e-07
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 3e-07
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 3e-07
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 3e-07
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 3e-07
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 3e-07
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 3e-07
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 3e-07
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 3e-07
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 3e-07
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 3e-07
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 3e-07
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 3e-07
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 3e-07
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 3e-07
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-07
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 4e-07
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 4e-07
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 4e-07
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 4e-07
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 5e-07
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 5e-07
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 6e-07
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 7e-07
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 7e-07
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-06
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 1e-06
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-06
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 2e-06
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 3e-06
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-06
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 6e-06
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 1e-05
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 1e-05
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 1e-05
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 1e-05
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 2e-05
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 9e-05
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 1e-04
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 1e-04
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 1e-04
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 1e-04
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 1e-04
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 1e-04
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-04
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 1e-04
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-04
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 2e-04
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 3e-04
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 4e-04
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 5e-04
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 5e-04
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 6e-04
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 8e-04
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure 
Iteration: 1

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 3/119 (2%)
Query: 48  IQVGTKRQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDV 107
           + +G    + E+  V GY+ P GT +  N++ +  D   W +P  F PERFL     +  
Sbjct: 349 VPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFL---DSSGY 405
Query: 108 RGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLTVE 166
             +   L+PFS GRR C G   A   M     +L   F +  P     D+  RLG+T++
Sbjct: 406 FAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLGMTLQ 464
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-56
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-51
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-50
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-49
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-36
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 7e-36
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-35
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-32
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-32
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-30
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-29
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-29
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-29
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-28
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-27
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-27
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-27
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 7e-27
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-26
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-26
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 8e-26
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 5e-25
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-24
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-24
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 7e-24
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 9e-24
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-18
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 5e-18
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 5e-16
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  184 bits (468), Expect = 1e-56
 Identities = 41/221 (18%), Positives = 74/221 (33%), Gaps = 50/221 (22%)

Query: 9   ILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTK--------------- 53
            +   +            W++  LL H + L   R E+    G K               
Sbjct: 257 AMLLQLWVTQGNAGPAAFWVMGYLLTHPEALRAVREEIQ---GGKHLRLEERQKNTPVFD 313

Query: 54  ----------------RQSMEECTVS-----GYNFPSGTQLFINVW-KLQRDPHVWEEPC 91
                           R   ++  +       Y+   G +L +  +   Q DP + ++P 
Sbjct: 314 SVLWETLRLTAAALITRDVTQDKKICLSNGQEYHLRRGDRLCVFPFISPQMDPQIHQQPE 373

Query: 92  KFQPERFL----TRHKDTDVRGQ--NFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGF 145
            FQ +RFL    T  KD    G    +  +P+ +   +CPG  FA+  ++  + ++   F
Sbjct: 374 MFQFDRFLNADRTEKKDFFKNGARVKYPSVPWGTEDNLCPGRHFAVHAIKELVFTILTRF 433

Query: 146 DIATPS---NEPLDMGERLGLTV-EKSTPLEVLVSPRLSAS 182
           D+         PL    R G  + + +  LE+    R    
Sbjct: 434 DVELCDKNATVPLVDPSRYGFGILQPAGDLEIRYRIRFHHH 474
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=2.2e-46  Score=308.28  Aligned_cols=176  Identities=28%  Similarity=0.491  Sum_probs=153.7

Q ss_pred             CchhhHHHHHHHHHHhhhhcHHHHHHHHHHHHhhChHHHHHHHHHHhHhhCCC---------------------------
Q 047802            1 MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTK---------------------------   53 (185)
Q Consensus         1 l~~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~~~---------------------------   53 (185)
                      |+++++..+++++++||+|||+++++|++++|++||++|+||++|++.+....                           
T Consensus       268 l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~EtlRl~p~  347 (479)
T 3tbg_A          268 FNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDI  347 (479)
T ss_dssp             CSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHHHHHCS
T ss_pred             hhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccchhhhccccccccceeeecccccc
Confidence            58899999999999999999999999999999999999999999999877543                           


Q ss_pred             ------CccccceeeeceeeCCCCEEEEchhhhccCCCCCCCCCCCCCCccccCCCCCCcCCCccceeeccCCCCCCcch
Q 047802           54 ------RQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGV  127 (185)
Q Consensus        54 ------r~~~~d~~i~~~~i~~g~~v~~~~~~~~~d~~~~~~p~~f~P~R~~~~~~~~~~~~~~~~~~~fg~G~~~C~G~  127 (185)
                            |.+.+|++++||.||+|+.|.++.+++||||++|+||++|+|+||++.+.   ...++..|+|||+|+|.|+|+
T Consensus       348 ~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~---~~~~~~~~~pFG~G~R~C~G~  424 (479)
T 3tbg_A          348 VPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQG---HFVKPEAFLPFSAGRRACLGE  424 (479)
T ss_dssp             STTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTC---CBCCCTTCCTTCCSTTSCTTH
T ss_pred             ccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCc---ccCCCCceecCCCCCcCChhH
Confidence                  45678999999999999999999999999999999999999999998653   233677899999999999999


Q ss_pred             HHHHHHHHHHHHHhcccceeecCCCCCCCC-cccceeeeecCCCeEEEEEecCC
Q 047802          128 SFALQVMQFTLASLPHGFDIATPSNEPLDM-GERLGLTVEKSTPLEVLVSPRLS  180 (185)
Q Consensus       128 ~la~~~~~~~~~~ll~~f~~~~~~~~~~~~-~~~~~~~~~~~~~~~v~~~~R~~  180 (185)
                      +||++|++++++.|+++|+|+++++++.+. ....++...| .+++|+++||+.
T Consensus       425 ~lA~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~P-~~~~v~~~pRs~  477 (479)
T 3tbg_A          425 PLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSP-SPYELCAVPRHH  477 (479)
T ss_dssp             HHHHHHHHHHHHHHHHHEEEECCTTSCCCCSCEEESSSEEE-CCCCBEEEEC--
T ss_pred             HHHHHHHHHHHHHHHHccEEEeCCCCCCccccccceeeecC-CCeEEEEEECCC
Confidence            999999999999999999999988765332 2233445555 589999999986
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 3e-31
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 4e-31
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-30
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 8e-23
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-21
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-20
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-17
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 9e-17
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 3e-16
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 3e-16
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 3e-15
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 6e-14
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 9e-14
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 4e-13
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 5e-13
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 2e-12
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 3e-12
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 2e-11
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 2e-10
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 5e-10
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 7e-10
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  115 bits (288), Expect = 3e-31
 Identities = 41/204 (20%), Positives = 74/204 (36%), Gaps = 37/204 (18%)

Query: 9   ILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTKRQ------------- 55
            + +L  A T+TT+ TL +    +L +  +  + + E++  +G+ R              
Sbjct: 264 TVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTD 323

Query: 56  --------------------SMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQP 95
                                 ++    GY  P  T++F  +     DP  +E P  F P
Sbjct: 324 AVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNP 383

Query: 96  ERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLPHGFDIATP-SNEP 154
             FL  +       +N   +PFS G+R+C G   A   +     ++   F IA+P   E 
Sbjct: 384 GHFLDANGALK---RNEGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPED 440

Query: 155 LDMGERLGLTVEKSTPLEVLVSPR 178
           +D+  R           ++    R
Sbjct: 441 IDLTPRESGVGNVPPSYQIRFLAR 464
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.97
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.6e-45  Score=296.02  Aligned_cols=177  Identities=29%  Similarity=0.499  Sum_probs=161.6

Q ss_pred             CchhhHHHHHHHHHHhhhhcHHHHHHHHHHHHhhChHHHHHHHHHHhHhhCCC---------------------------
Q 047802            1 MTTLYTLPILQALILAATDTTAVTLTWIISPLLNHHDILNKARNELDIQVGTK---------------------------   53 (185)
Q Consensus         1 l~~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~~~---------------------------   53 (185)
                      |++++++.+++.+++||++||+.+++|++++|++||++|+++++|+.++.+..                           
T Consensus       263 ls~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~l~~~~~l~a~i~E~lRl~p~  342 (472)
T d1tqna_         263 LSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPI  342 (472)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHHHHHCHHHHHHHHHHHHHCCT
T ss_pred             hhhhHHHhhhhhhhhcccccccccceeeccccccCccccccccceeheeccccccchHHHhhccccccceeeeccccCCc
Confidence            57899999999999999999999999999999999999999999999988754                           


Q ss_pred             -----CccccceeeeceeeCCCCEEEEchhhhccCCCCCCCCCCCCCCccccCCCCCCcCCCccceeeccCCCCCCcchH
Q 047802           54 -----RQSMEECTVSGYNFPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHKDTDVRGQNFELLPFSSGRRMCPGVS  128 (185)
Q Consensus        54 -----r~~~~d~~i~~~~i~~g~~v~~~~~~~~~d~~~~~~p~~f~P~R~~~~~~~~~~~~~~~~~~~fg~G~~~C~G~~  128 (185)
                           |.+.+|+.++||.||||+.|+++.+.+|+||++|+||++|+|+||++.+.   ....+..|+|||+|+|.|+|++
T Consensus       343 ~~~~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~---~~~~~~~~~~FG~G~r~C~G~~  419 (472)
T d1tqna_         343 AMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNK---DNIDPYIYTPFGSGPRNCIGMR  419 (472)
T ss_dssp             TCCEEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTG---GGCCTTTSCTTCCSTTSCTTHH
T ss_pred             ccccccccccCccccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCc---ccCCCceecCCCCCCccChhHH
Confidence                 78899999999999999999999999999999999999999999998652   2336778999999999999999


Q ss_pred             HHHHHHHHHHHHhcccceeecCCCCCCCCcccceeeeecCCCeEEEEEecCC
Q 047802          129 FALQVMQFTLASLPHGFDIATPSNEPLDMGERLGLTVEKSTPLEVLVSPRLS  180 (185)
Q Consensus       129 la~~~~~~~~~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R~~  180 (185)
                      +|+++++++++.|+++|+|+++++++.+..........|+.+++|++++|+-
T Consensus       420 ~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R~~  471 (472)
T d1tqna_         420 FALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDG  471 (472)
T ss_dssp             HHHHHHHHHHHHHHTTEEEECCTTCCSSCCBCSSSSCCBSSCCEEEEEETTC
T ss_pred             HHHHHHHHHHHHHHHhCEEEeCCCCCCCceeccceEEeeCCCEEEEEEECCC
Confidence            9999999999999999999998876666665566677888999999999973
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure