Citrus Sinensis ID: 047909

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MLQKQADRDPTHLHSVDGYILDLQMENGDNPDDTMNIWYAMCGLLVIMIKNAIVENKFRLLVELQVVFCKPNTWCKSK
ccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEcccccccc
cHHHHcccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEEccccccccc
mlqkqadrdpthlhsvdgyildlqmengdnpddtMNIWYAMCGLLVIMIKNAIVENKFRLLVELQVVfckpntwcksk
mlqkqadrdpthlhsVDGYILDLQMENGDNPDDTMNIWYAMCGLLVIMIKNAIVENKFRLLVELQvvfckpntwcksk
MLQKQADRDPTHLHSVDGYILDLQMENGDNPDDTMNIWYAMCGLLVIMIKNAIVENKFRLLVELQVVFCKPNTWCKSK
***************VDGYILDLQME*****DDTMNIWYAMCGLLVIMIKNAIVENKFRLLVELQVVFCKPNTWC***
************LHSVDGYILDLQMENGDNPDDTMNIWYAMCGLLVIMIKNAIVENKFRLLVELQVVFCKPNTWC***
**********THLHSVDGYILDLQMENGDNPDDTMNIWYAMCGLLVIMIKNAIVENKFRLLVELQVVFCKPNTWCKSK
******DRDPTHLHSVDGYILDLQMENGDNPDDTMNIWYAMCGLLVIMIKNAIVENKFRLLVELQVVFCKPNTWC***
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQKQADRDPTHLHSVDGYILDLQMENGDNPDDTMNIWYAMCGLLVIMIKNAIVENKFRLLVELQVVFCKPNTWCKSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
PLN02993763 PLN02993, PLN02993, lupeol synthase 6e-04
>gnl|CDD|215537 PLN02993, PLN02993, lupeol synthase Back     alignment and domain information 
 Score = 36.0 bits (83), Expect = 6e-04
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 5   QADRDPTHLHSVDGYILDLQMENGDNP 31
           QA+RD   LH     I+  Q+ENGD P
Sbjct: 695 QAERDLIPLHRAAKLIITSQLENGDFP 721

Length = 763

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 78
KOG0497760 consensus Oxidosqualene-lanosterol cyclase and rel 99.77
PLN03012759 Camelliol C synthase 99.71
PLN02993763 lupeol synthase 99.65
TIGR03463634 osq_cycl 2,3-oxidosqualene cyclase. This model ide 99.08
TIGR01507635 hopene_cyclase squalene-hopene cyclase. SHC is an 98.92
cd02892634 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; 98.86
TIGR01787621 squalene_cyclas squalene/oxidosqualene cyclases. T 98.77
cd02889348 SQCY Squalene cyclase (SQCY) domain; found in clas 97.43
PF09492 289 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 95.77
TIGR02474 290 pec_lyase pectate lyase, PelA/Pel-15E family. Memb 95.25
PF13243109 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 94.91
PF13243109 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 94.82
PF13249113 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 93.64
COG1657517 SqhC Squalene cyclase [Lipid metabolism] 93.5
PF07678 246 A2M_comp: A-macroglobulin complement component; In 93.09
cd02896 297 complement_C3_C4_C5 Proteins similar to C3, C4 and 91.99
cd02897 292 A2M_2 Proteins similar to alpha2-macroglobulin (al 90.6
) (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF00432">PF0043244 Prenyltrans: Prenyltransferase and squalene oxidas 90.22
cd02889 348 SQCY Squalene cyclase (SQCY) domain; found in clas 89.55
PLN03012759 Camelliol C synthase 88.6
PLN02993763 lupeol synthase 86.21
cd00688 300 ISOPREN_C2_like This group contains class II terpe 85.32
cd02891 282 A2M_like Proteins similar to alpha2-macroglobulin 85.16
TIGR01787621 squalene_cyclas squalene/oxidosqualene cyclases. T 83.04
cd00688300 ISOPREN_C2_like This group contains class II terpe 82.98
PF13249113 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 82.61
TIGR03463634 osq_cycl 2,3-oxidosqualene cyclase. This model ide 80.65
>KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism] Back     alignment and domain information 
Probab=99.77  E-value=6.5e-20  Score=155.17  Aligned_cols=55  Identities=29%  Similarity=0.508  Sum_probs=49.9

Q ss_pred             CCCCCCCCCChhHhHHHHHHHhccccCCCCCccceeeeec-cchhhhhhhhhhhhhhhhhh
Q 047909            1 MLQKQADRDPTHLHSVDGYILDLQMENGDNPDDTMNIWYA-MCGLLVIMIKNAIVENKFRL   60 (78)
Q Consensus         1 M~AGqaerDp~PLhRAaklLin~QlenGDwPQqeI~G~f~-~c~l~y~~yr~a~~~n~f~l   60 (78)
                      +.|||++|||.|+|||||+|||+|++|||||||+|+|+|+ +||++|+.|     ||+|||
T Consensus       690 i~~~q~~rd~~P~hr~ak~linsQ~~nGdfpqq~i~g~f~~~~~~~y~~y-----r~~F~~  745 (760)
T KOG0497|consen  690 IMAGQAERDPLPLHRAAKVLINSQLENGDFPQQEIEGVFNKNCMIHYPTY-----RNIFPI  745 (760)
T ss_pred             HhcCCcccccchHHHHHHHHHhcccccCCcchhHHHHHhhhhhhhccchh-----hhhccH
Confidence            4689999999999999999999999999999999999999 788777665     578886

>PLN03012 Camelliol C synthase Back     alignment and domain information
>PLN02993 lupeol synthase Back     alignment and domain information
>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase Back     alignment and domain information
>TIGR01507 hopene_cyclase squalene-hopene cyclase Back     alignment and domain information
>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>PF09492 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 Members of this family are isozymes of pectate lyase (4 Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A Back     alignment and domain information
>PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A Back     alignment and domain information
>PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C Back     alignment and domain information
>COG1657 SqhC Squalene cyclase [Lipid metabolism] Back     alignment and domain information
>PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family Back     alignment and domain information
>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement Back     alignment and domain information
>cd02897 A2M_2 Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>PF00432 Prenyltrans: Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>PLN03012 Camelliol C synthase Back     alignment and domain information
>PLN02993 lupeol synthase Back     alignment and domain information
>cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>cd02891 A2M_like Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases Back     alignment and domain information
>cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C Back     alignment and domain information
>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query78
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 98.72
2sqc_A631 Squalene-hopene cyclase; isomerase, triterpene cyc 98.62
1gxm_A 332 Pectate lyase; mechanism, elimination; 1.32A {Cell 94.47
1r76_A 408 Pectate lyase; A-helical structure; 2.65A {Azospir 93.8
1qqf_A 277 Protein (complement C3DG); alpha-alpha barrel, imm 91.82
3dss_B331 Geranylgeranyl transferase type-2 subunit beta; pr 89.75
2wy7_A 310 Complement C3D fragment; immune system, immune res 89.63
1hzf_A 367 Complement factor C4A; alpha-alpha 6 barrel, immun 88.96
2wy7_A310 Complement C3D fragment; immune system, immune res 88.34
2h6f_B 437 Protein farnesyltransferase beta subunit; ftase, f 85.16
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Back     alignment and structure
Probab=98.72  E-value=3.3e-09  Score=86.15  Aligned_cols=52  Identities=19%  Similarity=0.325  Sum_probs=44.3

Q ss_pred             CCCCCCCChhHhHHHHHHHhccccCCCCCccceeeeec-cchhhhhhhhhhhhhhhhhhe
Q 047909            3 QKQADRDPTHLHSVDGYILDLQMENGDNPDDTMNIWYA-MCGLLVIMIKNAIVENKFRLL   61 (78)
Q Consensus         3 AGqaerDp~PLhRAaklLin~QlenGDwPQqeI~G~f~-~c~l~y~~yr~a~~~n~f~l~   61 (78)
                      +|++  |.++++||+++|+++|.++|+|+|+.++|.|+ .|+++|+.||     |+|||.
T Consensus       662 ag~~--~~~~i~r~v~wL~~~Q~~~Ggf~~~~~~g~f~~~~~i~Y~~y~-----~~fpl~  714 (732)
T 1w6k_A          662 VRHP--DIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYR-----NIFPIW  714 (732)
T ss_dssp             TTCS--CHHHHHHHHHHHHHHCCTTSCCCCCSCCEEETTTEEECCTTHH-----HHHHHH
T ss_pred             cCCC--ChHHHHHHHHHHHHhcCCCCCccCCcccccccchhhhcccchh-----HHHHHH
Confidence            5654  77789999999999999999999999999999 8888877655     567764
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Back     alignment and structure
>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Back     alignment and structure
>1qqf_A Protein (complement C3DG); alpha-alpha barrel, immune system; 1.45A {Rattus norvegicus} SCOP: a.102.4.4 PDB: 1qsj_A 3d5r_A 2noj_A 2gox_A 3d5s_A 1c3d_A 2xqw_A Back     alignment and structure
>3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* 4ehm_B* 4gts_B* 4gtt_B* 4gtv_B* Back     alignment and structure
>2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A Back     alignment and structure
>1hzf_A Complement factor C4A; alpha-alpha 6 barrel, immune system; 2.30A {Homo sapiens} SCOP: a.102.4.4 Back     alignment and structure
>2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A Back     alignment and structure
>2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query78
d1w6ka1448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 99.4
d2sqca1352 Squalene-hopene cyclase {Alicyclobacillus acidocal 99.39
d1gxma_ 324 Polygalacturonic acid lyase (pectate lyase) {Cellv 96.14
d1r76a_ 408 Polygalacturonic acid lyase (pectate lyase) {Azosp 94.68
d2sqca1 352 Squalene-hopene cyclase {Alicyclobacillus acidocal 94.05
d2sqca2 271 Squalene-hopene cyclase {Alicyclobacillus acidocal 91.44
d1w6ka1 448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 85.39
d1w6ka2 279 Lanosterol synthase {Human (Homo sapiens) [TaxId: 81.65
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Terpenoid cyclases/Protein prenyltransferases
family: Terpene synthases
domain: Lanosterol synthase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.40  E-value=2.4e-14  Score=109.15  Aligned_cols=53  Identities=19%  Similarity=0.284  Sum_probs=45.6

Q ss_pred             CCCCCCCCChhHhHHHHHHHhccccCCCCCccceeeeec-cchhhhhhhhhhhhhhhhhhe
Q 047909            2 LQKQADRDPTHLHSVDGYILDLQMENGDNPDDTMNIWYA-MCGLLVIMIKNAIVENKFRLL   61 (78)
Q Consensus         2 ~AGqaerDp~PLhRAaklLin~QlenGDwPQqeI~G~f~-~c~l~y~~yr~a~~~n~f~l~   61 (78)
                      .+|  +++.++++||+++|+++|.+||+||||+++|.|+ .|+|+|.+|     +|+|||.
T Consensus       377 ~ag--~~~~~~v~rgv~~L~~~Q~~~G~W~~~~~~g~f~~~~~l~Y~~Y-----~~~fpl~  430 (448)
T d1w6ka1         377 AVR--HPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSY-----RNIFPIW  430 (448)
T ss_dssp             HTT--CSCHHHHHHHHHHHHHHCCTTSCCCCCSCCEEETTTEEECCTTH-----HHHHHHH
T ss_pred             hcC--CCCcHHHHHHHHHHHHccCCCCCCCCCceeeeecccceeecCCc-----chHHHHH
Confidence            356  4566789999999999999999999999999999 888888775     5889875
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure