Citrus Sinensis ID: 047923
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 190 | ||||||
| 224127754 | 1125 | tir-nbs-lrr resistance protein [Populus | 0.989 | 0.167 | 0.473 | 1e-44 | |
| 255555357 | 1094 | leucine-rich repeat-containing protein, | 0.984 | 0.170 | 0.507 | 2e-44 | |
| 255561496 | 876 | TMV resistance protein N, putative [Rici | 0.989 | 0.214 | 0.502 | 3e-42 | |
| 255555349 | 1109 | leucine-rich repeat containing protein, | 0.989 | 0.169 | 0.468 | 6e-41 | |
| 224109502 | 1060 | tir-nbs-lrr resistance protein [Populus | 0.978 | 0.175 | 0.473 | 1e-40 | |
| 255564976 | 944 | TMV resistance protein N, putative [Rici | 0.978 | 0.197 | 0.478 | 6e-40 | |
| 224133498 | 1187 | tir-nbs-lrr resistance protein [Populus | 0.984 | 0.157 | 0.489 | 1e-39 | |
| 317106744 | 947 | JHS03A10.2 [Jatropha curcas] | 0.984 | 0.197 | 0.479 | 2e-39 | |
| 224127917 | 1470 | tir-nbs-lrr resistance protein [Populus | 0.978 | 0.126 | 0.465 | 3e-39 | |
| 224145016 | 1254 | tir-nbs-lrr resistance protein [Populus | 0.989 | 0.149 | 0.487 | 1e-38 |
| >gi|224127754|ref|XP_002329169.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870950|gb|EEF08081.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 184 bits (468), Expect = 1e-44, Method: Compositional matrix adjust.
Identities = 91/192 (47%), Positives = 131/192 (68%), Gaps = 4/192 (2%)
Query: 2 RQNIQTFIDDQLNRGDEISESIAYAIESPAISVIIFSEGYPFSRWCLHELVKILKYKKEY 61
R+ I TFID +LNRG+EIS S+ AIE +SV++FS+ Y S+WCL EL KIL+ KK
Sbjct: 40 RKQISTFIDYKLNRGEEISPSLLKAIEDSKLSVVVFSDNYASSKWCLEELAKILECKKVK 99
Query: 62 AHIVIPGFYRGDPSEVRSQTGSFGNSFSKLEERFNENSEKLQSWRNATKEAASFMAF--- 118
+VIP FYR DPS VR+QTGSF ++F++ ++ E EK+ +WR A +EAA+ +
Sbjct: 100 GQMVIPVFYRVDPSHVRNQTGSFADAFARHDQLLKEKMEKVLNWRAAMREAANLSGWDSH 159
Query: 119 -ILPESELIKEVVNQILKRLAEVLLCDKENQLVGRESRVEIIESLLAAESKDVYILGIWG 177
I ESE + ++V IL +L + + L+G ++R++ +E+LL ES+DV I+GIWG
Sbjct: 160 NIKSESEFVDDIVRDILNKLHQTSMSTHHTSLIGIDARIKKVETLLKMESQDVRIVGIWG 219
Query: 178 VGSIGKTTIARA 189
+G IGKTTIA+A
Sbjct: 220 MGGIGKTTIAKA 231
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255555357|ref|XP_002518715.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223542096|gb|EEF43640.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255561496|ref|XP_002521758.1| TMV resistance protein N, putative [Ricinus communis] gi|223538971|gb|EEF40568.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255555349|ref|XP_002518711.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223542092|gb|EEF43636.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224109502|ref|XP_002333244.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222835789|gb|EEE74224.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224133498|ref|XP_002328057.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222837466|gb|EEE75845.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|317106744|dbj|BAJ53239.1| JHS03A10.2 [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 190 | ||||||
| UNIPROTKB|Q40392 | 1144 | N "TMV resistance protein N" [ | 0.978 | 0.162 | 0.411 | 1e-31 | |
| TAIR|locus:2136108 | 1095 | AT4G11170 [Arabidopsis thalian | 0.968 | 0.168 | 0.413 | 1.7e-29 | |
| TAIR|locus:2151506 | 1127 | RPS6 "RESISTANT TO P. SYRINGAE | 0.973 | 0.164 | 0.395 | 3.7e-29 | |
| TAIR|locus:2160472 | 1038 | AT5G41540 [Arabidopsis thalian | 0.968 | 0.177 | 0.392 | 6.7e-29 | |
| TAIR|locus:2151491 | 1123 | AT5G46450 [Arabidopsis thalian | 0.973 | 0.164 | 0.369 | 2.4e-27 | |
| TAIR|locus:2151466 | 1353 | VICTL "VARIATION IN COMPOUND T | 0.973 | 0.136 | 0.356 | 2.5e-27 | |
| TAIR|locus:2115870 | 1234 | AT4G08450 [Arabidopsis thalian | 0.957 | 0.147 | 0.385 | 4.6e-27 | |
| TAIR|locus:2162439 | 1008 | AT5G22690 [Arabidopsis thalian | 0.978 | 0.184 | 0.348 | 5.4e-27 | |
| TAIR|locus:2146243 | 900 | AT5G18360 [Arabidopsis thalian | 0.957 | 0.202 | 0.390 | 7.1e-27 | |
| TAIR|locus:2130270 | 1449 | RPP5 "RECOGNITION OF PERONOSPO | 0.973 | 0.127 | 0.383 | 7.4e-27 |
| UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] | Back alignment and assigned GO terms |
|---|
Score = 360 (131.8 bits), Expect = 1.0e-31, P = 1.0e-31
Identities = 79/192 (41%), Positives = 118/192 (61%)
Query: 3 QNIQTFIDDQ-LNRGDEISESIAYAIESPAISVIIFSEGYPFSRWCLHELVKILKYKKEY 61
+ I+TF DD+ L G I + AIE ++++FSE Y SRWCL+ELVKI++ K +
Sbjct: 38 KGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRF 97
Query: 62 AHIVIPGFYRGDPSEVRSQTGSFGNSFSKLEERFNENSEKLQSWRNATKEAASFMAFI-- 119
VIP FY DPS VR+Q SF +F + E ++ ++ E +Q WR A EAA+
Sbjct: 98 KQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALNEAANLKGSCDN 157
Query: 120 --LPESELIKEVVNQILKRLAEVLLCDKENQLVGRESRVEIIESLLAAESKDVYILGIWG 177
+++ I+++V+QI +L ++ L +N +VG ++ +E IESLL V I+GIWG
Sbjct: 158 RDKTDADCIRQIVDQISSKLCKISLSYLQN-IVGIDTHLEKIESLLEIGINGVRIMGIWG 216
Query: 178 VGSIGKTTIARA 189
+G +GKTTIARA
Sbjct: 217 MGGVGKTTIARA 228
|
|
| TAIR|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151506 RPS6 "RESISTANT TO P. SYRINGAE 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2160472 AT5G41540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151491 AT5G46450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151466 VICTL "VARIATION IN COMPOUND TRIGGERED ROOT growth response-like" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130270 RPP5 "RECOGNITION OF PERONOSPORA PARASITICA 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 190 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 2e-41 | |
| pfam01582 | 135 | pfam01582, TIR, TIR domain | 7e-21 | |
| smart00255 | 140 | smart00255, TIR, Toll - interleukin 1 - resistance | 7e-20 | |
| PLN03194 | 187 | PLN03194, PLN03194, putative disease resistance pr | 2e-08 | |
| pfam13676 | 102 | pfam13676, TIR_2, TIR domain | 4e-04 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 148 bits (374), Expect = 2e-41
Identities = 72/192 (37%), Positives = 112/192 (58%), Gaps = 7/192 (3%)
Query: 2 RQNIQTFIDDQLNRGDEISESIAYAIESPAISVIIFSEGYPFSRWCLHELVKILKYKKEY 61
R+ I F D+++ R + + AI I+V++FS+ Y S WCL+EL++I++ K+E
Sbjct: 38 RKLIIAFKDNEIERSQSLDPELKQAIRDSRIAVVVFSKNYASSSWCLNELLEIVRCKEEL 97
Query: 62 AHIVIPGFYRGDPSEVRSQTGSFGNSFSKLEERFNENSEKLQSWRNATKEAASFMAFILP 121
+VIP FY DPS VR QTG FG +F K + E+ + W+ A + A+ + +
Sbjct: 98 GQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNKTEDEKIQ--WKQALTDVANILGYHSQ 155
Query: 122 ----ESELIKEVVNQILKRLAEVLLCDKENQLVGRESRVEIIESLLAAESKDVYILGIWG 177
E+++I+E+ N +L +L D E+ VG E + + SLL ES++V ++GIWG
Sbjct: 156 NWPNEAKMIEEIANDVLGKLNLTPSNDFED-FVGIEDHIAKMSSLLHLESEEVRMVGIWG 214
Query: 178 VGSIGKTTIARA 189
IGKTTIARA
Sbjct: 215 SSGIGKTTIARA 226
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|216585 pfam01582, TIR, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >gnl|CDD|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222311 pfam13676, TIR_2, TIR domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PLN03194 | 187 | putative disease resistance protein; Provisional | 100.0 | |
| PF01582 | 141 | TIR: TIR domain; InterPro: IPR000157 In Drosophila | 99.84 | |
| smart00255 | 140 | TIR Toll - interleukin 1 - resistance. | 99.69 | |
| PF13676 | 102 | TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ | 99.19 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.59 | |
| PTZ00202 | 550 | tuzin; Provisional | 97.75 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.6 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.45 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.42 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 97.33 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.1 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.02 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 96.96 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 96.78 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.77 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.74 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 96.74 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 96.74 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.74 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 96.72 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.69 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 96.66 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.63 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 96.58 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.57 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.56 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.55 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 96.51 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.49 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 96.47 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.45 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.42 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 96.4 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.39 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.38 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 96.28 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.27 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 96.25 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 96.23 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.17 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 96.16 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.15 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.13 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.13 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.07 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.0 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 95.8 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 95.75 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 95.66 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.62 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 95.6 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 95.59 | |
| PLN02200 | 234 | adenylate kinase family protein | 95.57 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.55 | |
| PLN02348 | 395 | phosphoribulokinase | 95.5 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 95.49 | |
| PF08937 | 130 | DUF1863: MTH538 TIR-like domain (DUF1863); InterPr | 95.46 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 95.45 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 95.42 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 95.37 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 95.36 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 95.36 | |
| PRK06620 | 214 | hypothetical protein; Validated | 95.35 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 95.29 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 95.28 | |
| PRK09087 | 226 | hypothetical protein; Validated | 95.26 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.25 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 95.25 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 95.21 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.21 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 95.08 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 95.08 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 95.07 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 95.05 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 94.94 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 94.87 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 94.86 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 94.83 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 94.83 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 94.8 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 94.79 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 94.76 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 94.74 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 94.72 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 94.62 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 94.61 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 94.58 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 94.56 | |
| PRK06526 | 254 | transposase; Provisional | 94.52 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 94.52 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 94.5 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 94.5 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 94.48 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 94.42 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 94.41 | |
| PRK08727 | 233 | hypothetical protein; Validated | 94.38 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 94.29 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 94.24 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 94.23 | |
| PRK12377 | 248 | putative replication protein; Provisional | 94.2 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 94.18 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 94.14 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 94.14 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 94.14 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 94.13 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 94.12 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 94.11 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 94.11 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 94.06 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 94.06 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 94.04 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 94.01 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 94.01 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.0 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 93.99 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 93.98 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 93.98 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 93.95 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 93.92 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 93.88 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 93.86 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 93.83 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 93.82 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 93.75 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 93.7 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 93.68 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 93.68 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 93.67 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 93.64 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 93.63 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 93.63 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 93.61 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 93.61 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 93.58 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 93.58 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.56 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 93.55 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 93.45 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 93.36 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.33 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 93.32 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 93.31 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 93.28 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 93.24 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 93.22 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 93.21 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 93.21 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.18 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 93.17 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 93.12 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 93.12 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 93.11 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 93.08 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 93.06 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 93.04 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 92.98 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 92.97 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 92.95 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 92.94 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 92.92 | |
| PLN02199 | 303 | shikimate kinase | 92.91 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 92.83 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 92.82 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 92.81 | |
| PRK08116 | 268 | hypothetical protein; Validated | 92.81 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 92.8 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 92.78 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 92.76 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 92.76 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 92.76 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 92.75 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 92.75 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 92.74 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 92.73 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 92.71 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 92.67 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 92.63 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 92.6 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 92.58 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 92.57 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 92.55 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 92.53 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 92.52 | |
| PHA02244 | 383 | ATPase-like protein | 92.48 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 92.47 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 92.47 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 92.46 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 92.44 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 92.37 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 92.36 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 92.26 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 92.25 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 92.25 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 92.23 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 92.2 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 92.2 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 92.17 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 92.12 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 92.11 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 92.11 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 92.08 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 92.08 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 92.03 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 92.01 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 92.01 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 92.01 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 92.0 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 92.0 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 91.95 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 91.95 | |
| PRK08181 | 269 | transposase; Validated | 91.92 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 91.9 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 91.9 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 91.86 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 91.86 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 91.83 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 91.82 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 91.82 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 91.81 | |
| PF11868 | 192 | DUF3388: Protein of unknown function (DUF3388); In | 91.8 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 91.73 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 91.72 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 91.71 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 91.69 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 91.68 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 91.63 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 91.59 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 91.57 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 91.54 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 91.53 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 91.48 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 91.47 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 91.47 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 91.47 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 91.45 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 91.4 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 91.36 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 91.34 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 91.32 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 91.32 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 91.29 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 91.25 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 91.24 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 91.24 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 91.22 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 91.2 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 91.19 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 91.19 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 91.17 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 91.12 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 91.08 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 91.05 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 91.04 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 91.02 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 91.0 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 90.91 | |
| PHA02624 | 647 | large T antigen; Provisional | 90.88 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 90.87 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 90.86 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 90.78 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 90.73 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 90.72 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 90.7 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 90.7 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 90.69 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 90.68 | |
| KOG1547 | 336 | consensus Septin CDC10 and related P-loop GTPases | 90.66 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 90.62 | |
| TIGR03453 | 387 | partition_RepA plasmid partitioning protein RepA. | 90.62 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 90.6 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 90.58 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 90.54 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 90.44 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 90.34 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 90.33 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 90.3 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 90.29 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 90.26 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 90.25 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 90.25 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 90.19 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 90.19 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 90.13 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 90.1 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 89.95 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 89.94 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 89.91 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 89.86 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 89.86 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 89.85 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 89.82 | |
| PRK00652 | 325 | lpxK tetraacyldisaccharide 4'-kinase; Reviewed | 89.81 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 89.81 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 89.77 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 89.72 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 89.71 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 89.71 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 89.64 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 89.64 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 89.61 | |
| PRK11670 | 369 | antiporter inner membrane protein; Provisional | 89.58 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 89.55 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 89.55 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 89.53 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 89.48 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 89.42 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 89.39 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 89.31 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 89.3 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 89.28 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 89.28 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 89.25 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 89.23 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 89.05 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 89.0 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 89.0 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 88.91 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 88.8 | |
| PHA02519 | 387 | plasmid partition protein SopA; Reviewed | 88.78 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 88.76 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 88.74 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 88.7 | |
| PF01057 | 271 | Parvo_NS1: Parvovirus non-structural protein NS1; | 88.61 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 88.6 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 88.56 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 88.55 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 88.55 | |
| COG0305 | 435 | DnaB Replicative DNA helicase [DNA replication, re | 88.49 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 88.47 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 88.44 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 88.36 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 88.36 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 88.36 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 88.21 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 88.06 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 88.04 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 88.02 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 88.02 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 87.79 | |
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 87.73 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 87.7 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 87.68 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 87.63 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 87.63 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 87.59 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 87.52 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 87.52 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 87.44 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 87.35 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 87.17 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 87.11 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 86.97 | |
| PF06431 | 417 | Polyoma_lg_T_C: Polyomavirus large T antigen C-ter | 86.87 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 86.79 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 86.78 | |
| PF08357 | 150 | SEFIR: SEFIR domain; InterPro: IPR013568 This doma | 86.73 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 86.59 | |
| KOG4181 | 491 | consensus Uncharacterized conserved protein [Funct | 86.4 | |
| PRK13764 | 602 | ATPase; Provisional | 86.39 | |
| KOG2702 | 323 | consensus Predicted panthothenate kinase/uridine k | 86.37 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 86.36 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 86.08 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 86.02 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 85.75 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 85.62 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 85.49 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 85.43 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 85.42 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 85.34 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 85.28 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 85.15 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 85.07 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 85.02 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 84.98 | |
| PLN02772 | 398 | guanylate kinase | 84.9 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 84.75 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 84.57 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 84.53 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 84.51 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 84.48 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 84.38 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 84.3 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 84.18 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 83.98 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 83.89 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 83.82 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 83.48 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 83.44 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 83.41 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 83.24 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 83.2 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 82.94 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 82.8 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 82.57 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 82.56 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 82.46 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 82.43 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 82.3 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 82.3 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 81.64 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 81.52 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 81.31 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 81.3 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 81.29 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 81.27 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 81.21 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 81.18 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 81.18 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 81.17 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 81.13 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 81.05 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 81.03 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 81.01 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 80.98 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 80.96 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 80.95 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 80.85 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 80.72 | |
| PHA03132 | 580 | thymidine kinase; Provisional | 80.65 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 80.52 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 80.31 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 80.26 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 80.22 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 80.19 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 80.12 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-55 Score=408.07 Aligned_cols=186 Identities=37% Similarity=0.674 Sum_probs=175.5
Q ss_pred CCCeeEEEeCCCCCcccchHHHHHHhhcccceEEEecCCCcCchhhHHHHHHHHHhhhcCCeeEEeEEeecCCccccccC
Q 047923 2 RQNIQTFIDDQLNRGDEISESIAYAIESPAISVIIFSEGYPFSRWCLHELVKILKYKKEYAHIVIPGFYRGDPSEVRSQT 81 (190)
Q Consensus 2 ~~gi~~f~d~~~~~g~~~~~~l~~ai~~s~~~ivv~S~~y~~S~wcl~El~~i~~~~~~~~~~v~PvFy~v~ps~Vr~q~ 81 (190)
++||+||+|+++++|+.|++++++||++|+++|||||++||+|+||||||++|++|+++.+++|+||||+|+|+|||+|+
T Consensus 38 ~~~i~~f~d~~~~~g~~~~~~l~~~i~~s~~~ivv~s~~ya~s~wcl~el~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~ 117 (1153)
T PLN03210 38 RKLIIAFKDNEIERSQSLDPELKQAIRDSRIAVVVFSKNYASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQT 117 (1153)
T ss_pred HCCCeEEccCCccCCCcccHHHHHHHHhCeEEEEEecCCcccchHHHHHHHHHHHhhhhcCceEEEEEecccHHHHhhcc
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CchhhHHHHHHHhhhhhhHHHHhHHHHHHHhhccccccCc----hhhhHHHHHHHHHhhhhhhhhccccccccccchhHH
Q 047923 82 GSFGNSFSKLEERFNENSEKLQSWRNATKEAASFMAFILP----ESELIKEVVNQILKRLAEVLLCDKENQLVGRESRVE 157 (190)
Q Consensus 82 g~~~~~f~~~~~~~~~~~e~v~kWr~AL~ev~~~~g~~~~----e~~~i~~iv~~v~~~l~~~~~~~~~~~~vG~d~~~~ 157 (190)
|.|+++|.++.... ..+++++||+||+++++++|+++. |+++|++|+++|++++...++ .+..++||++.+++
T Consensus 118 g~f~~~f~~~~~~~--~~~~~~~w~~al~~~~~~~g~~~~~~~~E~~~i~~Iv~~v~~~l~~~~~-~~~~~~vG~~~~l~ 194 (1153)
T PLN03210 118 GDFGEAFEKTCQNK--TEDEKIQWKQALTDVANILGYHSQNWPNEAKMIEEIANDVLGKLNLTPS-NDFEDFVGIEDHIA 194 (1153)
T ss_pred chHHHHHHHHhccc--chhHHHHHHHHHHHHhCcCceecCCCCCHHHHHHHHHHHHHHhhccccC-cccccccchHHHHH
Confidence 99999999987654 345799999999999999999875 999999999999999988776 78889999999999
Q ss_pred HHHHHhhhcCCCeEEEEEEcCCCCcHHHHhccC
Q 047923 158 IIESLLAAESKDVYILGIWGVGSIGKTTIARAN 190 (190)
Q Consensus 158 ~~~~~l~~~~~~~~vi~i~G~gGiGKTTla~~v 190 (190)
++.++|..++++++++|||||||+||||||+++
T Consensus 195 ~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l 227 (1153)
T PLN03210 195 KMSSLLHLESEEVRMVGIWGSSGIGKTTIARAL 227 (1153)
T ss_pred HHHHHHccccCceEEEEEEcCCCCchHHHHHHH
Confidence 999999888888999999999999999999864
|
syringae 6; Provisional |
| >PLN03194 putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo | Back alignment and domain information |
|---|
| >smart00255 TIR Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PF11868 DUF3388: Protein of unknown function (DUF3388); InterPro: IPR024514 This domain is found in a family of bacterial proteins that are functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03453 partition_RepA plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11670 antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PHA02519 plasmid partition protein SopA; Reviewed | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PF01057 Parvo_NS1: Parvovirus non-structural protein NS1; InterPro: IPR001257 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PF06431 Polyoma_lg_T_C: Polyomavirus large T antigen C-terminus; InterPro: IPR010932 The group of polyomaviruses is formed by the homonymous murine virus (Py) as well as other representative members such as the simian virus 40 (SV40) and the human BK and JC viruses [] | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG4181 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PHA03132 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 190 | ||||
| 3ozi_A | 204 | Crystal Structure Of The Tir Domain From The Flax D | 1e-16 | ||
| 3jrn_A | 176 | Crystal Structure Of Tir Domain From Arabidopsis Th | 2e-15 |
| >pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 | Back alignment and structure |
|
| >pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 190 | |||
| 3jrn_A | 176 | AT1G72930 protein; TIR domain arabidopsis thaliana | 4e-55 | |
| 3ozi_A | 204 | L6TR; plant TIR domain, plant protein; 2.30A {Linu | 3e-52 | |
| 3h16_A | 154 | TIR protein; bacteria TIR domain, signaling protei | 2e-38 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 5e-07 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 3ub2_A | 146 | TOLL/interleukin-1 receptor domain-containing ADA | 7e-05 |
| >3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 | Back alignment and structure |
|---|
Score = 171 bits (436), Expect = 4e-55
Identities = 47/140 (33%), Positives = 72/140 (51%), Gaps = 5/140 (3%)
Query: 1 SRQNIQTFIDDQ-LNRGDEISESIAYAIESPAISVIIFSEGYPFSRWCLHELVKILKYKK 59
R++I+TF DD+ L G S + IE +V++ SE Y S WCL ELV I+ ++K
Sbjct: 33 VRRSIRTFKDDKELENGQRFSPELKSPIEVSRFAVVVVSENYAASSWCLDELVTIMDFEK 92
Query: 60 EYAHIVIPGFYRGDPSEVRSQTGSFGNSFSKLEERFNENSEKLQSWRNATKEAASFMAFI 119
+ + V+P FY +P+ VR QTG F K R + EK+ WR A A
Sbjct: 93 KGSITVMPIFYGVEPNHVRWQTGVLAEQFKKHASREDP--EKVLKWRQALTNFAQLSGDC 150
Query: 120 L--PESELIKEVVNQILKRL 137
+S+L+ ++ N+I +
Sbjct: 151 SGDDDSKLVDKIANEISNKK 170
|
| >3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 | Back alignment and structure |
|---|
| >3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| 3jrn_A | 176 | AT1G72930 protein; TIR domain arabidopsis thaliana | 100.0 | |
| 3ozi_A | 204 | L6TR; plant TIR domain, plant protein; 2.30A {Linu | 100.0 | |
| 3h16_A | 154 | TIR protein; bacteria TIR domain, signaling protei | 99.92 | |
| 3ub2_A | 146 | TOLL/interleukin-1 receptor domain-containing ADA | 99.82 | |
| 1fyx_A | 149 | TOLL-like receptor 2; beta-alpha-beta fold, signal | 99.68 | |
| 2j67_A | 178 | TOLL like receptor 10; TIR, IL-1, TLR10, membrane, | 99.67 | |
| 1t3g_A | 159 | X-linked interleukin-1 receptor accessory protein- | 99.66 | |
| 2js7_A | 160 | Myeloid differentiation primary response protein M | 99.65 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.22 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 98.98 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 98.8 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 98.76 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 98.62 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 97.99 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.95 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.87 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.8 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.74 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.73 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.64 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.6 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.51 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.5 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.46 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.36 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.35 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.24 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.18 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.1 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.09 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.08 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 97.01 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 96.98 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 96.92 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.91 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.86 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 96.81 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.81 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 96.79 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 96.79 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 96.78 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 96.75 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.75 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.72 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.65 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.65 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.6 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.6 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 96.6 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.56 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.54 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.52 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 96.47 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.45 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 96.44 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 96.41 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.38 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 96.36 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.36 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 96.35 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 96.34 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.34 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.27 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.27 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 96.25 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 96.22 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.21 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 96.11 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 96.05 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 96.03 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 95.95 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 95.89 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.88 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 95.87 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.86 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 95.85 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 95.79 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 95.77 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 95.77 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 95.75 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 95.72 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.68 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 95.66 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 95.62 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 95.61 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 95.6 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 95.59 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.59 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.53 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.5 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 95.5 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 95.45 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 95.41 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 95.29 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 95.14 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 95.11 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.09 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 95.04 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 95.03 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 94.93 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 94.93 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 94.92 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 94.91 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 94.9 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 94.83 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 94.83 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 94.83 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 94.8 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.75 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 94.68 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 94.6 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 94.59 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 94.57 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 94.57 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 94.56 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 94.53 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 94.51 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 94.44 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 94.32 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 94.18 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 94.17 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 94.16 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 94.14 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 94.13 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 94.09 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 94.0 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.0 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 93.99 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 93.93 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 93.89 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 93.86 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 93.82 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 93.8 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 93.73 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 93.68 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 93.57 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 93.35 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 93.3 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 93.27 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 93.26 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 93.22 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 93.19 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 93.12 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 93.11 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 93.08 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 93.03 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 93.02 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 93.0 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 92.99 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 92.96 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 92.94 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 92.88 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 92.87 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 92.8 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 92.73 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 92.67 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 92.54 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 92.46 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 92.42 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 92.4 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 92.33 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 92.32 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 92.32 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 92.31 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 92.29 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 92.28 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 92.27 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 92.23 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 92.14 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 92.01 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 91.96 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 91.7 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 91.52 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 91.49 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 91.47 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 91.45 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 91.32 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 91.3 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 91.23 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 91.2 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 91.19 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 91.15 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 91.12 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 91.1 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 90.76 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 90.69 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 90.55 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 90.48 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 90.46 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 90.42 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 90.34 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 90.26 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 90.2 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 90.17 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 90.0 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 89.52 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 89.36 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 89.33 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 89.15 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 88.71 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 88.58 | |
| 3hyn_A | 189 | Putative signal transduction protein; DUF1863 fami | 88.56 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 88.27 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 88.19 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 88.1 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 88.1 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 87.94 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 87.73 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 87.43 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 86.9 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 86.87 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 86.86 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 86.38 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 86.3 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 86.15 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 85.91 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 85.81 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 85.62 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 85.61 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 84.52 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 84.45 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 84.12 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 83.6 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 83.48 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 83.39 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 83.31 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 83.21 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 83.19 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 83.14 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 82.94 | |
| 1eiw_A | 111 | Hypothetical protein MTH538; CHEY-like fold, flavo | 82.9 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 82.34 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 81.93 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 81.55 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 81.25 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 80.99 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 80.92 |
| >3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-47 Score=285.91 Aligned_cols=139 Identities=35% Similarity=0.589 Sum_probs=115.9
Q ss_pred CCCeeEEEeC-CCCCcccchHHHHHHhhcccceEEEecCCCcCchhhHHHHHHHHHhhhcCCeeEEeEEeecCCcccccc
Q 047923 2 RQNIQTFIDD-QLNRGDEISESIAYAIESPAISVIIFSEGYPFSRWCLHELVKILKYKKEYAHIVIPGFYRGDPSEVRSQ 80 (190)
Q Consensus 2 ~~gi~~f~d~-~~~~g~~~~~~l~~ai~~s~~~ivv~S~~y~~S~wcl~El~~i~~~~~~~~~~v~PvFy~v~ps~Vr~q 80 (190)
++||++|+|+ ++.+|++|.++|.+||++|+++|+|||+||++|+|||+||++|++|++.+++.|+||||+|+|++||+|
T Consensus 34 ~~gi~~f~D~~~l~~G~~i~~~l~~aIe~Sri~IvV~S~ny~~S~WCl~EL~~i~~~~~~~~~~ViPIfy~V~ps~Vr~q 113 (176)
T 3jrn_A 34 RRSIRTFKDDKELENGQRFSPELKSPIEVSRFAVVVVSENYAASSWCLDELVTIMDFEKKGSITVMPIFYGVEPNHVRWQ 113 (176)
T ss_dssp HTTCCEECCCC--------------CCTTEEEEEEEECTTTTTCHHHHHHHHHHHHHHHTTSCEEEEEECSSCHHHHHHT
T ss_pred HCCCEEEEEcccccCCCchHHHHHHHHHhCCEEEEEecCCcCCChhHHHHHHHHHhhhccCCCEEEEEEecCCHHHhhhc
Confidence 5799999998 999999999999999999999999999999999999999999999999899999999999999999999
Q ss_pred CCchhhHHHHHHHhhhhhhHHHHhHHHHHHHhhccccccCc--hhhhHHHHHHHHHhhhhhhhh
Q 047923 81 TGSFGNSFSKLEERFNENSEKLQSWRNATKEAASFMAFILP--ESELIKEVVNQILKRLAEVLL 142 (190)
Q Consensus 81 ~g~~~~~f~~~~~~~~~~~e~v~kWr~AL~ev~~~~g~~~~--e~~~i~~iv~~v~~~l~~~~~ 142 (190)
+|.||++|.+|+.+ .+.+++++||.||+++++++|+++. |+++|++||++|+++|+.++|
T Consensus 114 ~g~fg~af~~~~~~--~~~~~~~~Wr~AL~~va~~~G~~~~~~e~~~i~~Iv~~v~~~l~~~~~ 175 (176)
T 3jrn_A 114 TGVLAEQFKKHASR--EDPEKVLKWRQALTNFAQLSGDCSGDDDSKLVDKIANEISNKKTIYAT 175 (176)
T ss_dssp CTHHHHHHHHHHTT--SCHHHHHHHHHHHHHHTTSCCEECCSCHHHHHHHHHHHHHTTCC----
T ss_pred cCcHHHHHHHHHhc--cCHHHHHHHHHHHHHHhcccceecCCCHHHHHHHHHHHHHHHhcCCCC
Confidence 99999999999887 4557899999999999999999986 999999999999999987765
|
| >3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} | Back alignment and structure |
|---|
| >3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} | Back alignment and structure |
|---|
| >3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A | Back alignment and structure |
|---|
| >1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A | Back alignment and structure |
|---|
| >2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A | Back alignment and structure |
|---|
| >1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >3hyn_A Putative signal transduction protein; DUF1863 family protein, nucleotide-binding protein, structur genomics; HET: MSE; 1.20A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 190 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 1e-06 | |
| d1fyva_ | 161 | c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H | 2e-05 | |
| d1fyxa_ | 149 | c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H | 1e-04 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 45.6 bits (107), Expect = 1e-06
Identities = 13/46 (28%), Positives = 20/46 (43%), Gaps = 1/46 (2%)
Query: 145 KENQLVGRESRVE-IIESLLAAESKDVYILGIWGVGSIGKTTIARA 189
K+ RE V+ +I+ L D + L + G GK+ IA
Sbjct: 18 KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQ 63
|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| d1fyva_ | 161 | Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ | 99.4 | |
| d1fyxa_ | 149 | Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ | 99.37 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.27 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.59 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.09 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.87 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.65 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.49 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.34 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.28 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.11 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.81 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.66 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 95.6 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.56 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 95.43 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.32 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 95.09 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 95.02 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 94.95 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 94.83 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 94.45 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 93.91 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 93.87 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 92.85 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.76 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 92.55 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 91.27 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 90.14 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 89.7 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 89.0 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 86.14 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 86.07 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 85.56 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 85.23 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 85.23 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 82.28 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 82.06 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 80.68 |
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Toll/Interleukin receptor TIR domain family: Toll/Interleukin receptor TIR domain domain: Toll-like receptor 1, TLR1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.40 E-value=1.8e-14 Score=104.37 Aligned_cols=70 Identities=23% Similarity=0.347 Sum_probs=63.7
Q ss_pred CCCeeEEEeC-CCCCcccchHHHHHHhhcccceEEEecCCCcCchhhHHHHHHHHHhh-hcCCeeEEeEEee
Q 047923 2 RQNIQTFIDD-QLNRGDEISESIAYAIESPAISVIIFSEGYPFSRWCLHELVKILKYK-KEYAHIVIPGFYR 71 (190)
Q Consensus 2 ~~gi~~f~d~-~~~~g~~~~~~l~~ai~~s~~~ivv~S~~y~~S~wcl~El~~i~~~~-~~~~~~v~PvFy~ 71 (190)
++|+++|+|+ ++.+|+.+.++|.+||++|+..|+|+|++|..|.||..|+..++.+. +.+...+|||++.
T Consensus 37 ~~g~~v~~d~~d~~~G~~~~~~i~~~i~~s~~~i~vlS~~~~~s~w~~~E~~~a~~~~~~~~~~~lIpV~l~ 108 (161)
T d1fyva_ 37 KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEGSNSLILILLE 108 (161)
T ss_dssp TTTCCEECTTTTCCTTSCHHHHHHHHHHHEEEEEEEESHHHHHHTSHHHHHHTTSCCCSCSSCSSEEEEESS
T ss_pred hCCCcceEeccccccccccHHHHHHHHHhCCEEEEEecCccccChHHHHHHHHHHHHHHHcCCCceeEEEEe
Confidence 5799999999 99999999999999999999999999999999999999999887654 3455689999887
|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|