Citrus Sinensis ID: 047931

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MATIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLHRNKRRNLILSNLSGNSAYNYSIDEEKLVSVELDFPLEQDANRDGSGYLARIVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGCTAEDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHWRLQKHGGDFVLAAFDLVEERFKEFPLPDASTSFRFFGTGVLGDCLCLQFFKGKMKEHWIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGSEDVAVADVPNWNSACVYVESLVSPN
cccccHHHHHHHHccccHHHHHHHHcccHHHHHHcccHHHHHHHHHHcccccEEEEEcccccccccccccccccEEEcccccccccccccccccEEEEEEEcEEEEEEccccEEEEEccccccEEEccccccccccccccEEEEEEccccccEEEEEEEEcccccEEEEEEcccccEEEEccccccccccccccEEEcccEEEEEEEccccEEEEEEEccccEEEEEccccccccccEEEEEEEccEEEEEEEcccEEEEEEEEEccccccEEEEEEEccccccEEEEEEEcccEEEEEcccEEEEEEccccEEEEEEEEccccccEEEEEEccccccc
cccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccEEEEEEEcccEEEEEEccccccccccccccccccccccccEEEEEEEcccEEEEEEcccccEEEEccccccEEEEccccccccccEEEEEEEEccccccEEEEEEEEcccccEEEEEEEccccccEEEEcccccccccccccEEEEcEEEEEEEcccccEEEEEEEcccccccccccccccccccEEEEEEEccEEEEEEEcccEEEEEEEEccccccccEEEEEEcccccccccEEEccccEEEEEcccEEEEEEcccccEEEEEEEEccccEEEEEEEccccccc
MATIPHEIIFEILLRLpvkslcrfkcvssswlalisdpQFVMLQLHRNKRRNLILsnlsgnsaynysideekLVSVeldfpleqdanrdgsGYLARIVGScnglvcttpkpkiffvlnpltreskripdvpfepfprssddlygfgctaedcKFIKvsfglkpnmSVAIFSLRMNSWRRVLAsgytrplinvpgtltngALHWRLQKHGGDFVLAAFDLVEErfkefplpdastsfrffgtgvlgdclclQFFKGKMKEHWIMKEYGVKESWTRVFihqdpnnvwplclwknSTKLLVINRKnllvcdcnnegsedvavadvpnwnSACVYVESLVSPN
MATIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLHRNKRRNLILSNLSGNSAYNYSIDEEKLVSVELDFPLEQDANRDGSGYLARIVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGCTAEDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHWRLQKHGGDFVLAAFDLVEERFKEFPLPDASTSFRFFGTGVLGDCLCLQFFKGKMKEHWIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGSEDVAVADVPNWNSACVYVESLVSPN
MATIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLHRNKRRNLILSNLSGNSAYNYSIDEEKLVSVELDFPLEQDANRDGSGYLARIVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGCTAEDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHWRLQKHGGDFVLAAFDLVEERFKEFPLPDASTSFRFFGTGVLGDCLCLQFFKGKMKEHWIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGSEDVAVADVPNWNSACVYVESLVSPN
****PHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLHRNKRRNLILSNLSGNSAYNYSIDEEKLVSVELDFPLEQDANRDGSGYLARIVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGCTAEDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHWRLQKHGGDFVLAAFDLVEERFKEFPLPDASTSFRFFGTGVLGDCLCLQFFKGKMKEHWIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGSEDVAVADVPNWNSACVYVESL****
MATIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLHRNKRRNLILSNLSGNSAYNYSIDEEKLVSVELDFPLEQDANRDGSGYLARIVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGCTAEDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHWRLQKHGGDFVLAAFDLVEERFKEFPLPDASTSFRFFGTGVLGDCLCLQFFKGKMKEHWIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGSEDVAVADVPNWNSACVYVESLVSPN
MATIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLHRNKRRNLILSNLSGNSAYNYSIDEEKLVSVELDFPLEQDANRDGSGYLARIVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGCTAEDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHWRLQKHGGDFVLAAFDLVEERFKEFPLPDASTSFRFFGTGVLGDCLCLQFFKGKMKEHWIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGSEDVAVADVPNWNSACVYVESLVSPN
*ATIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLHRNKRRNLILSNLSGNSAYNYSIDEEKLVSVELDFPLEQDANRDGSGYLARIVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGCTAEDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHWRLQKHGGDFVLAAFDLVEERFKEFPLPDASTSFRFFGTGVLGDCLCLQFFKGKMKEHWIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGSEDVAVADVPNWNSACVYVESLVS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLHRNKRRNLILSNLSGNSAYNYSIDEEKLVSVELDFPLEQDANRDGSGYLARIVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGCTAEDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHWRLQKHGGDFVLAAFDLVEERFKEFPLPDASTSFRFFGTGVLGDCLCLQFFKGKMKEHWIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGSEDVAVADVPNWNSACVYVESLVSPN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query339 2.2.26 [Sep-21-2011]
Q8GXC7427 F-box/kelch-repeat protei yes no 0.991 0.786 0.329 3e-38
Q9SU30413 F-box protein CPR30 OS=Ar no no 0.970 0.796 0.301 4e-32
Q9LIR8364 F-box/kelch-repeat protei no no 0.970 0.903 0.292 8e-23
Q9LU24360 Putative F-box protein At no no 0.752 0.708 0.275 9e-19
Q9FGY4359 F-box protein At5g49610 O no no 0.640 0.604 0.303 2e-18
Q9SUY0402 F-box protein At4g22390 O no no 0.964 0.813 0.265 5e-17
Q9SFC7417 F-box protein At3g07870 O no no 0.964 0.784 0.250 2e-15
Q9C800441 Putative F-box protein At no no 0.752 0.578 0.256 2e-14
Q9LPW4462 Putative F-box protein At no no 0.805 0.590 0.240 1e-12
Q9LUP5388 F-box/kelch-repeat protei no no 0.663 0.579 0.265 2e-12
>sp|Q8GXC7|FBK50_ARATH F-box/kelch-repeat protein At3g06240 OS=Arabidopsis thaliana GN=At3g06240 PE=2 SV=1 Back     alignment and function desciption
 Score =  159 bits (402), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 128/388 (32%), Positives = 192/388 (49%), Gaps = 52/388 (13%)

Query: 3   TIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLH--------RNKRRNLI 54
            +P EII EILLRLP KS+ RF+CVS  +  L SDP F  + L         R+  R LI
Sbjct: 35  VLPPEIITEILLRLPAKSIGRFRCVSKLFCTLSSDPGFAKIHLDLILRNESVRSLHRKLI 94

Query: 55  LSNLSGNSAYNYSIDE--EKLVSVELDFPLEQDAN------RDGSG---YLAR------- 96
           +S+ +  S    SI +    L +VE ++PL+ D +      R+  G   Y  R       
Sbjct: 95  VSSHNLYSLDFNSIGDGIRDLAAVEHNYPLKDDPSIFSEMIRNYVGDHLYDDRRVMLKLN 154

Query: 97  ----------IVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEP----FPRSSDDL 142
                     IVGS NGLVC +P     F+ NP T +SKR+P+  F P    + R +   
Sbjct: 155 AKSYRRNWVEIVGSSNGLVCISPGEGAVFLYNPTTGDSKRLPE-NFRPKSVEYERDNFQT 213

Query: 143 YGFGCTA--EDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLIN-VPGTLTNG 199
           YGFG     +D K +K+    +  +  +++SL+ +SWRR+    Y     +   G   NG
Sbjct: 214 YGFGFDGLTDDYKLVKLVATSEDILDASVYSLKADSWRRICNLNYEHNDGSYTSGVHFNG 273

Query: 200 ALHWRL-QKHGGDFVLAAFDLVEERFKEFPLPDAST--SFRF--FGTGVLGDCLCLQFFK 254
           A+HW   +      V+ AFD+  E F+E P+PD +   S RF  F  G L   LC+    
Sbjct: 274 AIHWVFTESRHNQRVVVAFDIQTEEFREMPVPDEAEDCSHRFSNFVVGSLNGRLCVVNSC 333

Query: 255 GKMKEH-WIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEG 313
             + +  W+M EYG  +SW+R+ I+    ++ PLC  KN  ++L+    +L++ +     
Sbjct: 334 YDVHDDIWVMSEYGEAKSWSRIRINLLYRSMKPLCSTKNDEEVLLELDGDLVLYNFETNA 393

Query: 314 SEDVAVADV--PNWNSACVYVESLVSPN 339
           S ++ +  V   +   A  YVESL+SPN
Sbjct: 394 SSNLGICGVKLSDGFEANTYVESLISPN 421

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SU30|CPR30_ARATH F-box protein CPR30 OS=Arabidopsis thaliana GN=CPR30 PE=1 SV=2 Back     alignment and function description
>sp|Q9LIR8|FBK67_ARATH F-box/kelch-repeat protein At3g23880 OS=Arabidopsis thaliana GN=At3g23880 PE=2 SV=1 Back     alignment and function description
>sp|Q9LU24|FB145_ARATH Putative F-box protein At3g16210 OS=Arabidopsis thaliana GN=At3g16210 PE=4 SV=1 Back     alignment and function description
>sp|Q9FGY4|FB341_ARATH F-box protein At5g49610 OS=Arabidopsis thaliana GN=At5g49610 PE=1 SV=1 Back     alignment and function description
>sp|Q9SUY0|FB244_ARATH F-box protein At4g22390 OS=Arabidopsis thaliana GN=At4g22390 PE=2 SV=3 Back     alignment and function description
>sp|Q9SFC7|FB135_ARATH F-box protein At3g07870 OS=Arabidopsis thaliana GN=At3g07870 PE=2 SV=1 Back     alignment and function description
>sp|Q9C800|FB34_ARATH Putative F-box protein At1g33530 OS=Arabidopsis thaliana GN=At1g33530 PE=4 SV=1 Back     alignment and function description
>sp|Q9LPW4|FB7_ARATH Putative F-box protein At1g12855 OS=Arabidopsis thaliana GN=At1g12855 PE=4 SV=1 Back     alignment and function description
>sp|Q9LUP5|FBK59_ARATH F-box/kelch-repeat protein At3g17530 OS=Arabidopsis thaliana GN=At3g17530 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
255551523358 ubiquitin-protein ligase, putative [Rici 0.955 0.905 0.357 1e-45
255551521403 conserved hypothetical protein [Ricinus 0.958 0.806 0.339 1e-39
255580390 1029 Transitional endoplasmic reticulum ATPas 0.952 0.313 0.350 4e-39
224129168374 predicted protein [Populus trichocarpa] 0.943 0.855 0.353 4e-38
297829152414 hypothetical protein ARALYDRAFT_896735 [ 0.964 0.789 0.332 2e-37
225433744408 PREDICTED: F-box protein CPR30 [Vitis vi 0.938 0.779 0.346 3e-37
6862928416 hypothetical protein [Arabidopsis thalia 0.988 0.805 0.330 2e-36
30679777427 F-box/kelch-repeat protein [Arabidopsis 0.991 0.786 0.329 2e-36
225433770360 PREDICTED: F-box/kelch-repeat protein At 0.958 0.902 0.341 7e-35
297829150427 F-box family protein [Arabidopsis lyrata 0.991 0.786 0.311 5e-34
>gi|255551523|ref|XP_002516807.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223543895|gb|EEF45421.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 129/361 (35%), Positives = 197/361 (54%), Gaps = 37/361 (10%)

Query: 1   MATIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQFVMLQLHRNKRRNLI------ 54
           MA +  +++  ILLRLPVKSLCRFK V  SW  LISDP F+ + L    + N I      
Sbjct: 1   MANLVQDVVLHILLRLPVKSLCRFKVVCKSWWLLISDPHFISMHLSLATKNNCINCHRWR 60

Query: 55  --LSNLSGNSAYNYSID-EEKLVSVELDFPLEQDANRDGSGYLARIVGSCNGLVCTTPKP 111
             L++ S  S Y+   +  ++ ++++L +PL+ D   +      + +GSCNGL+C   +P
Sbjct: 61  LCLTSFSLPSVYSVGYEASDRAIAIKLGYPLKSDCYDE-----VKFIGSCNGLLCVASEP 115

Query: 112 KIFFVLNPLTRESKRIPDVP-FEPFPRSS-DDLYGFGC--TAEDCKFIKVSFGLKPNMSV 167
            +  +LNP TR ++ IP +    PF +SS   +YGFG   +  D K +K+S        V
Sbjct: 116 GVLLLLNPSTRAAQEIPRLGNRRPFTQSSLPYMYGFGYAHSINDYKLVKISC----RGCV 171

Query: 168 AIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHW---RLQKHGGDFVLAAFDLVEERF 224
            ++S++ NSWR V    Y+   ++ PG   NGA+HW   R +      ++ AFDLVEE+F
Sbjct: 172 FVYSVKENSWRSVGGFPYSILALD-PGIQLNGAIHWVVSRSKDSTKSQIIGAFDLVEEKF 230

Query: 225 KEFPLPDASTSFRFFGTGVLGDCLCLQFFKGKMKEH---WIMKEYGVKESWTRVFIHQDP 281
            + P P   +   F+G GV G+CLC+      +  H   W+MK YG+++SWT+V I+   
Sbjct: 231 WDVPPP--VSVHNFYGIGVFGECLCI-LPGSDVTSHNDFWVMKRYGIRDSWTKVVINISY 287

Query: 282 NNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGS-EDVAVADVPNWNSACV--YVESLVSP 338
             + PL ++ N   LL I+ K  LV     EG+ +D+ +  +P      V  Y ESLVSP
Sbjct: 288 FRMKPLGVFDNHKALLEIDGK--LVLYSFREGTYQDLVIQGIPVGIEFDVETYAESLVSP 345

Query: 339 N 339
           +
Sbjct: 346 H 346

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255551521|ref|XP_002516806.1| conserved hypothetical protein [Ricinus communis] gi|223543894|gb|EEF45420.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255580390|ref|XP_002531022.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] gi|223529397|gb|EEF31360.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224129168|ref|XP_002328907.1| predicted protein [Populus trichocarpa] gi|222839337|gb|EEE77674.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297829152|ref|XP_002882458.1| hypothetical protein ARALYDRAFT_896735 [Arabidopsis lyrata subsp. lyrata] gi|297328298|gb|EFH58717.1| hypothetical protein ARALYDRAFT_896735 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225433744|ref|XP_002267358.1| PREDICTED: F-box protein CPR30 [Vitis vinifera] Back     alignment and taxonomy information
>gi|6862928|gb|AAF30317.1|AC018907_17 hypothetical protein [Arabidopsis thaliana] gi|21536665|gb|AAM60997.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30679777|ref|NP_566277.2| F-box/kelch-repeat protein [Arabidopsis thaliana] gi|75151183|sp|Q8GXC7.1|FBK50_ARATH RecName: Full=F-box/kelch-repeat protein At3g06240 gi|26451648|dbj|BAC42921.1| unknown protein [Arabidopsis thaliana] gi|29824145|gb|AAP04033.1| putative F-box protein family [Arabidopsis thaliana] gi|332640843|gb|AEE74364.1| F-box/kelch-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225433770|ref|XP_002268486.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297829150|ref|XP_002882457.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297328297|gb|EFH58716.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
TAIR|locus:2082410427 AT3G06240 "AT3G06240" [Arabido 0.713 0.566 0.333 1.5e-41
TAIR|locus:2135615413 CPR1 "AT4G12560" [Arabidopsis 0.510 0.418 0.338 2.7e-29
TAIR|locus:2076196364 AT3G23880 "AT3G23880" [Arabido 0.979 0.912 0.294 1.9e-28
TAIR|locus:2157834359 AT5G49610 "AT5G49610" [Arabido 0.941 0.888 0.290 1.4e-20
TAIR|locus:2094947360 AT3G16210 "AT3G16210" [Arabido 0.758 0.713 0.270 3.6e-19
TAIR|locus:2127465402 AT4G22390 "AT4G22390" [Arabido 0.504 0.425 0.280 2.9e-18
TAIR|locus:2006902441 AT1G33530 "AT1G33530" [Arabido 0.749 0.575 0.261 5.9e-15
TAIR|locus:2077452417 AT3G07870 "AT3G07870" [Arabido 0.342 0.278 0.346 3.9e-14
TAIR|locus:2027397363 AT1G11620 "AT1G11620" [Arabido 0.855 0.798 0.261 7.9e-13
TAIR|locus:2090577396 AT3G17540 "AT3G17540" [Arabido 0.893 0.765 0.263 1.4e-12
TAIR|locus:2082410 AT3G06240 "AT3G06240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 325 (119.5 bits), Expect = 1.5e-41, Sum P(2) = 1.5e-41
 Identities = 86/258 (33%), Positives = 134/258 (51%)

Query:    97 IVGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEP----FPRSSDDLYGFGCTA--E 150
             IVGS NGLVC +P     F+ NP T +SKR+P+  F P    + R +   YGFG     +
Sbjct:   165 IVGSSNGLVCISPGEGAVFLYNPTTGDSKRLPE-NFRPKSVEYERDNFQTYGFGFDGLTD 223

Query:   151 DCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLIN-VPGTLTNGALHWRL-QKH 208
             D K +K+    +  +  +++SL+ +SWRR+    Y     +   G   NGA+HW   +  
Sbjct:   224 DYKLVKLVATSEDILDASVYSLKADSWRRICNLNYEHNDGSYTSGVHFNGAIHWVFTESR 283

Query:   209 GGDFVLAAFDLVEERFKEFPLPDAST--SFRF--FGTGVLGDCLCLQFFKGKMKEH-WIM 263
                 V+ AFD+  E F+E P+PD +   S RF  F  G L   LC+      + +  W+M
Sbjct:   284 HNQRVVVAFDIQTEEFREMPVPDEAEDCSHRFSNFVVGSLNGRLCVVNSCYDVHDDIWVM 343

Query:   264 KEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEGSEDVAVADVP 323
              EYG  +SW+R+ I+    ++ PLC  KN  ++L+    +L++ +     S ++ +  V 
Sbjct:   344 SEYGEAKSWSRIRINLLYRSMKPLCSTKNDEEVLLELDGDLVLYNFETNASSNLGICGVK 403

Query:   324 --NWNSACVYVESLVSPN 339
               +   A  YVESL+SPN
Sbjct:   404 LSDGFEANTYVESLISPN 421
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2135615 CPR1 "AT4G12560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076196 AT3G23880 "AT3G23880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157834 AT5G49610 "AT5G49610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094947 AT3G16210 "AT3G16210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127465 AT4G22390 "AT4G22390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2006902 AT1G33530 "AT1G33530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077452 AT3G07870 "AT3G07870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027397 AT1G11620 "AT1G11620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090577 AT3G17540 "AT3G17540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
TIGR01640230 TIGR01640, F_box_assoc_1, F-box protein interactio 2e-13
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 1e-06
pfam1293747 pfam12937, F-box-like, F-box-like 4e-06
pfam0064648 pfam00646, F-box, F-box domain 9e-06
>gnl|CDD|233502 TIGR01640, F_box_assoc_1, F-box protein interaction domain Back     alignment and domain information 
 Score = 68.2 bits (167), Expect = 2e-13
 Identities = 53/233 (22%), Positives = 95/233 (40%), Gaps = 31/233 (13%)

Query: 98  VGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFG----------- 146
           V  C+GL+C +   ++  V NP T +S+ +P        + SD  Y  G           
Sbjct: 1   VVPCDGLICFSYGKRLV-VWNPSTGQSRWLPTPKSRRSNKESDT-YFLGYDPIEKQYKVL 58

Query: 147 CTAEDCKFIKVSFGLKPNMSVAIFSLRMNSWRRVLASGYTRPLINVPGTLTNGALHWRLQ 206
           C ++     +     +      +++L  NSWR +  S    PL +  G   NG L++   
Sbjct: 59  CFSDRSGN-RNQSEHQ------VYTLGSNSWRTIECSPPHHPLKS-RGVCINGVLYYLAY 110

Query: 207 KHGG--DFVLAAFDLVEERFKEF-PLP-DASTSFRFFGTGVLGDCLCL--QFFKGKMKEH 260
                 D+ + +FD+  ERFKEF PLP   S S  +         L +  Q       + 
Sbjct: 111 TLKTNPDYFIVSFDVSSERFKEFIPLPCGNSDSVDYLSLINYKGKLAVLKQKKDTNNFDL 170

Query: 261 WIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINRKNLLVCDCNNEG 313
           W++ + G K+ W+++F    P    P  L  ++      ++  +++C  +   
Sbjct: 171 WVLNDAG-KQEWSKLFTVPIPP--LPD-LVDDNFLSGFTDKGEIVLCCEDENP 219

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain. Length = 230
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 339
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 100.0
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 99.75
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 99.65
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 99.46
PHA02713557 hypothetical protein; Provisional 99.43
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.36
PHA02790480 Kelch-like protein; Provisional 99.29
PHA02713557 hypothetical protein; Provisional 99.29
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.29
PHA03098534 kelch-like protein; Provisional 99.24
PLN02153341 epithiospecifier protein 99.09
PLN02193470 nitrile-specifier protein 99.02
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.96
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.95
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.95
PHA03098534 kelch-like protein; Provisional 98.86
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.84
PHA02790480 Kelch-like protein; Provisional 98.82
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.8
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.7
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.66
PLN02193470 nitrile-specifier protein 98.65
PLN02153341 epithiospecifier protein 98.64
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.61
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.43
KOG1230 521 consensus Protein containing repeated kelch motifs 98.02
KOG4693392 consensus Uncharacterized conserved protein, conta 97.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.36
KOG4693392 consensus Uncharacterized conserved protein, conta 97.35
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.21
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.18
KOG1230 521 consensus Protein containing repeated kelch motifs 96.8
KOG2997366 consensus F-box protein FBX9 [General function pre 96.58
PF1396450 Kelch_6: Kelch motif 95.94
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.91
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 95.78
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.64
smart00284255 OLF Olfactomedin-like domains. 95.33
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 94.98
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 94.62
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 94.45
COG3055381 Uncharacterized protein conserved in bacteria [Fun 94.22
COG3055381 Uncharacterized protein conserved in bacteria [Fun 93.77
PF07762131 DUF1618: Protein of unknown function (DUF1618); In 93.55
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 92.82
KOG2055 514 consensus WD40 repeat protein [General function pr 92.39
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 91.84
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 91.81
PF1396450 Kelch_6: Kelch motif 91.24
smart0061247 Kelch Kelch domain. 90.15
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 89.95
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 89.64
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 89.57
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 89.4
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 88.4
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 87.83
COG1520 370 FOG: WD40-like repeat [Function unknown] 87.58
smart0061247 Kelch Kelch domain. 87.2
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 87.01
KOG4341483 consensus F-box protein containing LRR [General fu 86.26
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 86.02
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 85.87
KOG3545249 consensus Olfactomedin and related extracellular m 85.72
PLN02772 398 guanylate kinase 84.57
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 84.05
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 84.05
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 84.0
KOG0294 362 consensus WD40 repeat-containing protein [Function 83.99
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 83.57
KOG0649325 consensus WD40 repeat protein [General function pr 83.47
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 83.28
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 81.84
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 81.14
KOG0279315 consensus G protein beta subunit-like protein [Sig 81.14
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 81.03
PRK11028 330 6-phosphogluconolactonase; Provisional 80.9
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information 
Probab=100.00  E-value=2.4e-34  Score=243.73  Aligned_cols=211  Identities=21%  Similarity=0.373  Sum_probs=161.6

Q ss_pred             EeeeCceEEEccCCCEEEEEcccccceeecCCCCCCCCCCCCCCeeEEee--eCCceEEEEEeeEe--CCCcEEEEEEeC
Q 047931           98 VGSCNGLVCTTPKPKIFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGC--TAEDCKFIKVSFGL--KPNMSVAIFSLR  173 (339)
Q Consensus        98 ~~s~~GLl~~~~~~~~~~V~NP~T~~~~~LP~~~~~~~~~~~~~~~~~g~--~~~~ykvv~~~~~~--~~~~~~~vyss~  173 (339)
                      ++|||||+|+... ..++||||+||+++.||+++... ........||||  .+++|||+++....  .....++||+++
T Consensus         1 ~~sCnGLlc~~~~-~~~~V~NP~T~~~~~LP~~~~~~-~~~~~~~~~~G~d~~~~~YKVv~~~~~~~~~~~~~~~Vys~~   78 (230)
T TIGR01640         1 VVPCDGLICFSYG-KRLVVWNPSTGQSRWLPTPKSRR-SNKESDTYFLGYDPIEKQYKVLCFSDRSGNRNQSEHQVYTLG   78 (230)
T ss_pred             CcccceEEEEecC-CcEEEECCCCCCEEecCCCCCcc-cccccceEEEeecccCCcEEEEEEEeecCCCCCccEEEEEeC
Confidence            4799999998864 78999999999999999866421 001111578999  78999999997321  135789999999


Q ss_pred             CCceEEecccCCccCccCCCceEECCeEEEEEecC-CCC-eEEEEEECCCceee-eecCCCCCCC-CceeEEEEECCeEE
Q 047931          174 MNSWRRVLASGYTRPLINVPGTLTNGALHWRLQKH-GGD-FVLAAFDLVEERFK-EFPLPDASTS-FRFFGTGVLGDCLC  249 (339)
Q Consensus       174 ~~~W~~~~~~~~~~~~~~~~~v~~~G~lyw~~~~~-~~~-~~il~fD~~~~~~~-~i~lP~~~~~-~~~~~l~~~~G~L~  249 (339)
                      +++||.+...+.... ....+|++||++||++... +.. ..|++||+++|+|+ .+++|..... .....|++++|+|+
T Consensus        79 ~~~Wr~~~~~~~~~~-~~~~~v~~~G~lyw~~~~~~~~~~~~IvsFDl~~E~f~~~i~~P~~~~~~~~~~~L~~~~G~L~  157 (230)
T TIGR01640        79 SNSWRTIECSPPHHP-LKSRGVCINGVLYYLAYTLKTNPDYFIVSFDVSSERFKEFIPLPCGNSDSVDYLSLINYKGKLA  157 (230)
T ss_pred             CCCccccccCCCCcc-ccCCeEEECCEEEEEEEECCCCCcEEEEEEEcccceEeeeeecCccccccccceEEEEECCEEE
Confidence            999999974333222 2233899999999999765 122 38999999999999 5899976532 13467999999999


Q ss_pred             EEEe--CCCeEEEEEEcccCCCCCeEEEEEecC-C---C--CeeEEEEEeCCeEEEEECC--cE-EEEEECCCC
Q 047931          250 LQFF--KGKMKEHWIMKEYGVKESWTRVFIHQD-P---N--NVWPLCLWKNSTKLLVINR--KN-LLVCDCNNE  312 (339)
Q Consensus       250 ~v~~--~~~~l~iW~l~~~~~~~~W~~~~~i~~-~---~--~~~~~~~~~~~~i~~~~~~--~~-~~~yd~~t~  312 (339)
                      ++..  ....++||+|++++. .+|+++++|+. .   +  ...|+++..+|+|++....  .. ++.||++++
T Consensus       158 ~v~~~~~~~~~~IWvl~d~~~-~~W~k~~~i~~~~~~~~~~~~~~~~~~~~g~I~~~~~~~~~~~~~~y~~~~~  230 (230)
T TIGR01640       158 VLKQKKDTNNFDLWVLNDAGK-QEWSKLFTVPIPPLPDLVDDNFLSGFTDKGEIVLCCEDENPFYIFYYNVGEN  230 (230)
T ss_pred             EEEecCCCCcEEEEEECCCCC-CceeEEEEEcCcchhhhhhheeEeEEeeCCEEEEEeCCCCceEEEEEeccCC
Confidence            9998  335699999999875 45999999974 2   1  1458899889999998764  34 999999885

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain.
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07762 DUF1618: Protein of unknown function (DUF1618); InterPro: IPR011676 The proteins of this entry are mainly hypothetical proteins expressed by Oryza sativa Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG3545 consensus Olfactomedin and related extracellular matrix glycoproteins [Extracellular structures] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 2e-04
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 3e-04
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 7e-04
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure
 Score = 43.8 bits (102), Expect = 4e-05
 Identities = 10/50 (20%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 1   MATIPHEIIFEILLRLPVKSLCRF-KCVSSSWLALISDPQFVMLQLHRNK 49
           +A +P  ++  +L  LP   L +  + V   W  L+      +L+  +  
Sbjct: 51  LAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEG 100
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.43
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.41
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.39
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.39
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.38
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.37
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.31
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.3
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.29
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.21
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.11
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 99.1
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.1
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.1
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.97
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.95
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 98.91
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.82
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.77
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.47
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.35
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.09
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.99
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.41
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 96.9
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 96.4
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 95.73
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.41
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.0
3jrp_A 379 Fusion protein of protein transport protein SEC13 94.95
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.56
3jro_A 753 Fusion protein of protein transport protein SEC13 94.46
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.13
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.97
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 93.95
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 93.9
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 93.65
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 93.45
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 93.33
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 93.14
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 93.11
4g56_B357 MGC81050 protein; protein arginine methyltransfera 92.9
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 92.89
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 92.8
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 92.68
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 92.38
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 92.08
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.62
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 91.51
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 91.49
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 91.4
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 91.39
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 90.88
4e54_B435 DNA damage-binding protein 2; beta barrel, double 90.28
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 90.19
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.75
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 89.75
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 89.49
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 89.39
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 89.0
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 88.47
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 88.06
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 87.71
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 87.11
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 86.51
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 86.34
3ow8_A321 WD repeat-containing protein 61; structural genomi 85.82
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 85.8
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 85.6
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 85.6
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 85.53
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 85.11
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 84.92
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 84.85
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 84.41
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 83.99
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 83.71
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 83.63
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 83.46
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 83.31
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 83.29
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 82.99
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 82.88
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 82.77
3jrp_A 379 Fusion protein of protein transport protein SEC13 82.77
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 82.51
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 82.07
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 81.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 81.68
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 81.61
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 81.61
3v9f_A 781 Two-component system sensor histidine kinase/RESP 81.24
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 81.2
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 81.13
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 81.09
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 80.95
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 80.88
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 80.86
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 80.82
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 80.75
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 80.21
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 80.04
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
Probab=99.43  E-value=3.5e-11  Score=105.57  Aligned_cols=187  Identities=14%  Similarity=0.076  Sum_probs=127.9

Q ss_pred             EEEEEcccccceeecCCCCCCCCCCCCCCeeEEee--eCCceEEEEEee-E----eCCCcEEEEEEeCCCceEEecccCC
Q 047931          113 IFFVLNPLTRESKRIPDVPFEPFPRSSDDLYGFGC--TAEDCKFIKVSF-G----LKPNMSVAIFSLRMNSWRRVLASGY  185 (339)
Q Consensus       113 ~~~V~NP~T~~~~~LP~~~~~~~~~~~~~~~~~g~--~~~~ykvv~~~~-~----~~~~~~~~vyss~~~~W~~~~~~~~  185 (339)
                      .++++||.|++|..+|+++..        ..+.+.  ..+  ++..+.- .    ......+++|+..+++|+.++.+|.
T Consensus        68 ~~~~~d~~~~~W~~~~~~p~~--------r~~~~~~~~~~--~lyv~GG~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~  137 (315)
T 4asc_A           68 YFLQFDHLDSEWLGMPPLPSP--------RCLFGLGEALN--SIYVVGGREIKDGERCLDSVMCYDRLSFKWGESDPLPY  137 (315)
T ss_dssp             EEEEEETTTTEEEECCCBSSC--------EESCEEEEETT--EEEEECCEESSTTCCBCCCEEEEETTTTEEEECCCCSS
T ss_pred             ceEEecCCCCeEEECCCCCcc--------hhceeEEEECC--EEEEEeCCcCCCCCcccceEEEECCCCCcEeECCCCCC
Confidence            488999999999999988755        222222  222  3333331 1    1125679999999999999987776


Q ss_pred             ccCccCCCceEECCeEEEEEecC---CCCeEEEEEECCCceeeee-cCCCCCCCCceeEEEEECCeEEEEEe-CC--CeE
Q 047931          186 TRPLINVPGTLTNGALHWRLQKH---GGDFVLAAFDLVEERFKEF-PLPDASTSFRFFGTGVLGDCLCLQFF-KG--KMK  258 (339)
Q Consensus       186 ~~~~~~~~~v~~~G~lyw~~~~~---~~~~~il~fD~~~~~~~~i-~lP~~~~~~~~~~l~~~~G~L~~v~~-~~--~~l  258 (339)
                      ..  .....+.++|.+|.++...   .....+..||+.+++|+.+ ++|...   .....+..+|+|+++.. ..  ..-
T Consensus       138 ~r--~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r---~~~~~~~~~~~iyv~GG~~~~~~~~  212 (315)
T 4asc_A          138 VV--YGHTVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKFEWKELAPMQTAR---SLFGATVHDGRIIVAAGVTDTGLTS  212 (315)
T ss_dssp             CC--BSCEEEEETTEEEEECCBCTTSCBCCCEEEEETTTTEEEECCCCSSCC---BSCEEEEETTEEEEEEEECSSSEEE
T ss_pred             cc--cceeEEEECCEEEEEeCCCCCCcccceEEEEeCCCCeEEECCCCCCch---hceEEEEECCEEEEEeccCCCCccc
Confidence            53  3455788999999998763   2245799999999999998 455443   34566788999999998 22  234


Q ss_pred             EEEEEcccCCCCCeEEEEEecCCCCeeEEEEEeCCeEEEEECC---------------cEEEEEECCCCcEEEe
Q 047931          259 EHWIMKEYGVKESWTRVFIHQDPNNVWPLCLWKNSTKLLVINR---------------KNLLVCDCNNEGSEDV  317 (339)
Q Consensus       259 ~iW~l~~~~~~~~W~~~~~i~~~~~~~~~~~~~~~~i~~~~~~---------------~~~~~yd~~t~~~~~v  317 (339)
                      ++|.++-.  ..+|..+..++.+......++ -++.+++..+.               ..+..||+++++|+.+
T Consensus       213 ~~~~yd~~--~~~W~~~~~~p~~r~~~~~~~-~~~~l~v~GG~~~~~~~~~~~~~~~~~~v~~yd~~~~~W~~~  283 (315)
T 4asc_A          213 SAEVYSIT--DNKWAPFEAFPQERSSLSLVS-LVGTLYAIGGFATLETESGELVPTELNDIWRYNEEEKKWEGV  283 (315)
T ss_dssp             EEEEEETT--TTEEEEECCCSSCCBSCEEEE-ETTEEEEEEEEEEEECTTSCEEEEEEEEEEEEETTTTEEEEE
T ss_pred             eEEEEECC--CCeEEECCCCCCcccceeEEE-ECCEEEEECCccccCcCCccccccccCcEEEecCCCChhhhh
Confidence            67777642  367998866554331222223 35677765432               2489999999999999
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 339
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 2e-08
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 2e-05
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 5e-05
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 0.004
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.4 bits (113), Expect = 2e-08
 Identities = 10/38 (26%), Positives = 16/38 (42%)

Query: 3  TIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQF 40
          ++P E++  I   L +  L +   V   W  L SD   
Sbjct: 3  SLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL 40
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.78
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.77
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.72
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.56
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.24
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.05
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 97.64
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 93.43
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 91.12
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 87.81
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 87.76
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 86.69
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 84.44
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 83.72
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 83.05
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 81.76
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 81.06
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 81.05
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.24  E-value=2.8e-13  Score=78.37  Aligned_cols=39  Identities=26%  Similarity=0.502  Sum_probs=36.6

Q ss_pred             CCCcHHHHHHHHccCCcccceeeeeccccccccCCChHH
Q 047931            2 ATIPHEIIFEILLRLPVKSLCRFKCVSSSWLALISDPQF   40 (339)
Q Consensus         2 ~~Lp~Dll~eIL~rLP~~~l~r~~~VcK~W~~li~sp~F   40 (339)
                      +.||+|++.+||++||+++|.|+++|||+|+++++++.+
T Consensus         2 ~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~~~~l   40 (41)
T d1fs1a1           2 DSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL   40 (41)
T ss_dssp             CSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHTCGGG
T ss_pred             CcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCccc
Confidence            579999999999999999999999999999999988763
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure