Citrus Sinensis ID: 047942

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MVILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPCKLPDKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALKVFFTPYCNSVTVYFFG
cEEEcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cEEEcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEEEEEEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHcccEEEcc
mvilggagsqSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTaavfkvgpcklpdklngaRLTLEAVKRTMdqkigpgagIALLHVSKELDklqsanvganISIKLFQHALKVFftpycnsvtvyffg
mvilggagsqsaIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAvfkvgpcklpdkLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALKVFFTPYCNSVTVYFFG
MVILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPCKLPDKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALKVFFTPYCNSVTVYFFG
*************************LSTSGYEVKLLKQRLHYLSNTAAVFKVGPCKLPDKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALKVFFTPYCNSVTVYFF*
MVILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPCKLPDKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALKVFFTPYCNSVTVYFFG
******************QLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPCKLPDKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALKVFFTPYCNSVTVYFFG
MVILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPCKLPDKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALKVFFTPYCNSVTVYFFG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPCKLPDKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALKVFFTPYCNSVTVYFFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q05046575 Chaperonin CPN60-2, mitoc N/A no 0.871 0.2 0.466 5e-21
P29185577 Chaperonin CPN60-1, mitoc N/A no 0.871 0.199 0.466 5e-20
Q43298576 Chaperonin CPN60-2, mitoc N/A no 0.871 0.199 0.457 8e-20
Q05045575 Chaperonin CPN60-1, mitoc N/A no 0.871 0.2 0.457 2e-19
P29197577 Chaperonin CPN60, mitocho yes no 0.871 0.199 0.440 9e-19
Q8L7B5585 Chaperonin CPN60-like 1, no no 0.871 0.196 0.423 9e-18
P35480587 Chaperonin CPN60, mitocho N/A no 0.871 0.195 0.428 8e-17
Q93ZM7572 Chaperonin CPN60-like 2, no no 0.939 0.216 0.375 2e-14
P35471542 60 kDa chaperonin 5 OS=Rh yes no 0.863 0.210 0.350 3e-12
A6U901542 60 kDa chaperonin 3 OS=Si yes no 0.863 0.210 0.350 4e-12
>sp|Q05046|CH62_CUCMA Chaperonin CPN60-2, mitochondrial OS=Cucurbita maxima GN=CPN60-2 PE=1 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/118 (46%), Positives = 77/118 (65%), Gaps = 3/118 (2%)

Query: 2   VILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVG---PCKLP 58
           VIL GAG + +IEER  Q+RSAIELSTS Y+ + L++RL  LS   AV K+G     ++ 
Sbjct: 362 VILDGAGDKKSIEERCEQIRSAIELSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVG 421

Query: 59  DKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALK 116
           +K +     L A K  +++ I PG G+ALL+ SKELDKL +AN    I +++ Q+ALK
Sbjct: 422 EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELDKLSTANFDQKIGVQIIQNALK 479
Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix.
Cucurbita maxima (taxid: 3661)
>sp|P29185|CH61_MAIZE Chaperonin CPN60-1, mitochondrial OS=Zea mays GN=CPN60I PE=1 SV=2 Back     alignment and function description
>sp|Q43298|CH62_MAIZE Chaperonin CPN60-2, mitochondrial OS=Zea mays GN=CPN60II PE=2 SV=1 Back     alignment and function description
>sp|Q05045|CH61_CUCMA Chaperonin CPN60-1, mitochondrial OS=Cucurbita maxima GN=CPN60-1 PE=1 SV=1 Back     alignment and function description
>sp|P29197|CH60A_ARATH Chaperonin CPN60, mitochondrial OS=Arabidopsis thaliana GN=CPN60 PE=1 SV=2 Back     alignment and function description
>sp|Q8L7B5|CH60B_ARATH Chaperonin CPN60-like 1, mitochondrial OS=Arabidopsis thaliana GN=At2g33210 PE=1 SV=1 Back     alignment and function description
>sp|P35480|CH60_BRANA Chaperonin CPN60, mitochondrial OS=Brassica napus PE=2 SV=1 Back     alignment and function description
>sp|Q93ZM7|CH60C_ARATH Chaperonin CPN60-like 2, mitochondrial OS=Arabidopsis thaliana GN=At3g13860 PE=1 SV=2 Back     alignment and function description
>sp|P35471|CH605_RHIME 60 kDa chaperonin 5 OS=Rhizobium meliloti (strain 1021) GN=groL5 PE=2 SV=2 Back     alignment and function description
>sp|A6U901|CH603_SINMW 60 kDa chaperonin 3 OS=Sinorhizobium medicae (strain WSM419) GN=groL3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
115450675 577 Os03g0143400 [Oryza sativa Japonica Grou 0.871 0.199 0.483 2e-20
161702919 526 heat shock protein 60 [Ageratina adenoph 0.871 0.218 0.483 3e-20
144600706 359 heat shock protein 60 [Ageratina adenoph 0.871 0.320 0.483 4e-20
359477860 571 PREDICTED: chaperonin CPN60-2, mitochond 0.939 0.217 0.453 1e-19
225433375 575 PREDICTED: chaperonin CPN60-2, mitochond 0.939 0.215 0.453 1e-19
356575182 575 PREDICTED: chaperonin CPN60-2, mitochond 0.871 0.2 0.466 1e-19
356575184 571 PREDICTED: chaperonin CPN60-2, mitochond 0.871 0.201 0.466 1e-19
115482382 574 Os10g0462900 [Oryza sativa Japonica Grou 0.871 0.200 0.466 3e-19
110289207 634 Chaperonin CPN60-1, mitochondrial precur 0.871 0.181 0.466 3e-19
461736 575 RecName: Full=Chaperonin CPN60-2, mitoch 0.871 0.2 0.466 4e-19
>gi|115450675|ref|NP_001048938.1| Os03g0143400 [Oryza sativa Japonica Group] gi|108706134|gb|ABF93929.1| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] gi|113547409|dbj|BAF10852.1| Os03g0143400 [Oryza sativa Japonica Group] gi|215704319|dbj|BAG93753.1| unnamed protein product [Oryza sativa Japonica Group] gi|218192069|gb|EEC74496.1| hypothetical protein OsI_09970 [Oryza sativa Indica Group] gi|222624174|gb|EEE58306.1| hypothetical protein OsJ_09368 [Oryza sativa Japonica Group] gi|284431758|gb|ADB84620.1| chaperonin [Oryza sativa Japonica Group] Back     alignment and taxonomy information
 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 2   VILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVG---PCKLP 58
           VIL GAG + AIEER  QLRSAIELSTS Y+ + L++RL  LS   AV K+G     ++ 
Sbjct: 362 VILDGAGDKKAIEERAEQLRSAIELSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVG 421

Query: 59  DKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALK 116
           +K +     L A K  +++ I PG G+ALL+ SK+LDKLQ+AN    I +++ Q+ALK
Sbjct: 422 EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKDLDKLQTANFDQKIGVQIIQNALK 479

Source: Oryza sativa Japonica Group

Species: Oryza sativa

Genus: Oryza

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|161702919|gb|ABX76300.1| heat shock protein 60 [Ageratina adenophora] Back     alignment and taxonomy information
>gi|144600706|gb|ABP01596.1| heat shock protein 60 [Ageratina adenophora] Back     alignment and taxonomy information
>gi|359477860|ref|XP_003632036.1| PREDICTED: chaperonin CPN60-2, mitochondrial isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225433375|ref|XP_002285608.1| PREDICTED: chaperonin CPN60-2, mitochondrial isoform 1 [Vitis vinifera] gi|297741894|emb|CBI33329.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356575182|ref|XP_003555721.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356575184|ref|XP_003555722.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|115482382|ref|NP_001064784.1| Os10g0462900 [Oryza sativa Japonica Group] gi|22758324|gb|AAN05528.1| mitochondrial chaperonin-60 [Oryza sativa Japonica Group] gi|113639393|dbj|BAF26698.1| Os10g0462900 [Oryza sativa Japonica Group] gi|218184691|gb|EEC67118.1| hypothetical protein OsI_33923 [Oryza sativa Indica Group] gi|222612963|gb|EEE51095.1| hypothetical protein OsJ_31804 [Oryza sativa Japonica Group] gi|313575773|gb|ADR66966.1| 60 kDa chaperonin [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|110289207|gb|AAP54159.2| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|461736|sp|Q05046.1|CH62_CUCMA RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; Flags: Precursor gi|478786|pir||S29316 chaperonin 60 - cucurbit gi|12546|emb|CAA50218.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
TAIR|locus:2076081577 HSP60 "heat shock protein 60" 0.871 0.199 0.440 2.5e-18
TAIR|locus:2046590585 HSP60-2 "heat shock protein 60 0.871 0.196 0.423 1.5e-17
TAIR|locus:2087959572 HSP60-3A "heat shock protein 6 0.939 0.216 0.375 5.1e-14
GENEDB_PFALCIPARUM|PF10_0153580 PF10_0153 "hsp60" [Plasmodium 0.848 0.193 0.338 2.6e-11
UNIPROTKB|Q8IJN9580 PF10_0153 "Heat shock protein 0.848 0.193 0.338 2.6e-11
FB|FBgn0031728576 Hsp60C "Hsp60C" [Drosophila me 0.878 0.201 0.327 4.2e-11
UNIPROTKB|Q5ZL72573 HSPD1 "60 kDa heat shock prote 0.878 0.202 0.336 8.7e-11
ZFIN|ZDB-GENE-021206-1575 hspd1 "heat shock 60kD protein 0.878 0.201 0.327 1.1e-10
UNIPROTKB|Q9KLC6530 groL2 "60 kDa chaperonin 2" [V 0.863 0.215 0.316 1.6e-10
TIGR_CMR|VC_A0820530 VC_A0820 "chaperonin, 60 Kd su 0.863 0.215 0.316 1.6e-10
TAIR|locus:2076081 HSP60 "heat shock protein 60" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 230 (86.0 bits), Expect = 2.5e-18, P = 2.5e-18
 Identities = 52/118 (44%), Positives = 76/118 (64%)

Query:     2 VILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVG---PCKLP 58
             VIL GAG +  IEER  Q+RSAIELSTS Y+ + L++RL  LS   AV K+G     ++ 
Sbjct:   361 VILDGAGDKKGIEERCEQIRSAIELSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVG 420

Query:    59 DKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALK 116
             +K +     L A K  +++ I PG G+ALL+ ++EL+KL +AN    I +++ Q+ALK
Sbjct:   421 EKKDRVTDALNATKAAVEEGILPGGGVALLYAARELEKLPTANFDQKIGVQIIQNALK 478
GO:0005524 "ATP binding" evidence=IEA;IDA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006457 "protein folding" evidence=IEA;RCA
GO:0042026 "protein refolding" evidence=IEA
GO:0044267 "cellular protein metabolic process" evidence=IEA
GO:0051131 "chaperone-mediated protein complex assembly" evidence=TAS
GO:0007005 "mitochondrion organization" evidence=TAS
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0005759 "mitochondrial matrix" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA;IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2046590 HSP60-2 "heat shock protein 60-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087959 HSP60-3A "heat shock protein 60-3A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF10_0153 PF10_0153 "hsp60" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IJN9 PF10_0153 "Heat shock protein 60" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
FB|FBgn0031728 Hsp60C "Hsp60C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZL72 HSPD1 "60 kDa heat shock protein, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021206-1 hspd1 "heat shock 60kD protein 1 (chaperonin)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KLC6 groL2 "60 kDa chaperonin 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0820 VC_A0820 "chaperonin, 60 Kd subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
cd03344520 cd03344, GroEL, GroEL_like type I chaperonin 7e-20
PTZ00114555 PTZ00114, PTZ00114, Heat shock protein 60; Provisi 2e-18
PRK12849542 PRK12849, groEL, chaperonin GroEL; Reviewed 5e-18
PRK00013542 PRK00013, groEL, chaperonin GroEL; Reviewed 8e-16
PRK12851541 PRK12851, groEL, chaperonin GroEL; Reviewed 2e-15
TIGR02348524 TIGR02348, GroEL, chaperonin GroL 5e-15
PRK12850544 PRK12850, groEL, chaperonin GroEL; Reviewed 3e-13
PRK12852545 PRK12852, groEL, chaperonin GroEL; Reviewed 4e-13
PRK14104546 PRK14104, PRK14104, chaperonin GroEL; Provisional 3e-12
CHL00093529 CHL00093, groEL, chaperonin GroEL 1e-10
PLN03167600 PLN03167, PLN03167, Chaperonin-60 beta subunit; Pr 1e-08
>gnl|CDD|239460 cd03344, GroEL, GroEL_like type I chaperonin Back     alignment and domain information 
 Score = 83.7 bits (208), Expect = 7e-20
 Identities = 46/121 (38%), Positives = 72/121 (59%), Gaps = 7/121 (5%)

Query: 2   VILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVG---PCKLP 58
            I+GGAG ++AI+ R +Q+R  IE +TS Y+ + L++RL  LS   AV KVG     +L 
Sbjct: 328 TIIGGAGDKAAIKARIAQIRKQIEETTSDYDKEKLQERLAKLSGGVAVIKVGGATEVELK 387

Query: 59  DKLNGARLT--LEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALK 116
           +K    R+   L A +  +++ I PG G+ALL  S  LDKL++ N    + I++ + AL+
Sbjct: 388 EKK--DRVEDALNATRAAVEEGIVPGGGVALLRASPALDKLKALNGDEKLGIEIVRRALE 445

Query: 117 V 117
            
Sbjct: 446 A 446

Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). With the aid of cochaperonin GroES, GroEL encapsulates non-native substrate proteins inside the cavity of the GroEL-ES complex and promotes folding by using energy derived from ATP hydrolysis. Length = 520
>gnl|CDD|185455 PTZ00114, PTZ00114, Heat shock protein 60; Provisional Back     alignment and domain information
>gnl|CDD|237230 PRK12849, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|234573 PRK00013, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|171770 PRK12851, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|233828 TIGR02348, GroEL, chaperonin GroL Back     alignment and domain information
>gnl|CDD|237231 PRK12850, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|237232 PRK12852, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|172594 PRK14104, PRK14104, chaperonin GroEL; Provisional Back     alignment and domain information
>gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL Back     alignment and domain information
>gnl|CDD|215611 PLN03167, PLN03167, Chaperonin-60 beta subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
KOG0356550 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [ 100.0
PRK12852545 groEL chaperonin GroEL; Reviewed 100.0
PRK14104546 chaperonin GroEL; Provisional 100.0
PRK00013542 groEL chaperonin GroEL; Reviewed 99.98
PRK12851541 groEL chaperonin GroEL; Reviewed 99.98
PRK12850544 groEL chaperonin GroEL; Reviewed 99.98
TIGR02348524 GroEL chaperonin GroL. This family consists of Gro 99.98
PRK12849542 groEL chaperonin GroEL; Reviewed 99.98
CHL00093529 groEL chaperonin GroEL 99.98
cd03344520 GroEL GroEL_like type I chaperonin. Chaperonins ar 99.97
PTZ00114555 Heat shock protein 60; Provisional 99.97
PLN03167600 Chaperonin-60 beta subunit; Provisional 99.97
COG0459524 GroL Chaperonin GroEL (HSP60 family) [Posttranslat 99.9
TIGR02345522 chap_CCT_eta T-complex protein 1, eta subunit. Mem 99.8
cd03342484 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper 99.77
cd03336517 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper 99.76
TIGR02340536 chap_CCT_alpha T-complex protein 1, alpha subunit. 99.76
cd03338515 TCP1_delta TCP-1 (CTT or eukaryotic type II) chape 99.76
TIGR02346531 chap_CCT_theta T-complex protein 1, theta subunit. 99.76
cd03335527 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape 99.76
TIGR02347531 chap_CCT_zeta T-complex protein 1, zeta subunit. M 99.76
PTZ00212533 T-complex protein 1 subunit beta; Provisional 99.76
TIGR02341519 chap_CCT_beta T-complex protein 1, beta subunit. M 99.76
cd03341472 TCP1_theta TCP-1 (CTT or eukaryotic type II) chape 99.75
TIGR02342517 chap_CCT_delta T-complex protein 1, delta subunit. 99.75
cd03339526 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha 99.74
cd03343517 cpn60 cpn60 chaperonin family. Chaperonins are inv 99.74
cd00309464 chaperonin_type_I_II chaperonin families, type I a 99.72
TIGR02344525 chap_CCT_gamma T-complex protein 1, gamma subunit. 99.72
TIGR02343532 chap_CCT_epsi T-complex protein 1, epsilon subunit 99.72
TIGR02339519 thermosome_arch thermosome, various subunits, arch 99.69
cd03340522 TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero 99.68
cd03337480 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape 99.68
PF00118485 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon 99.61
KOG0357400 consensus Chaperonin complex component, TCP-1 epsi 99.2
KOG0361543 consensus Chaperonin complex component, TCP-1 eta 99.16
KOG0359520 consensus Chaperonin complex component, TCP-1 zeta 98.97
KOG0358534 consensus Chaperonin complex component, TCP-1 delt 98.88
KOG0363527 consensus Chaperonin complex component, TCP-1 beta 98.84
KOG0362537 consensus Chaperonin complex component, TCP-1 thet 98.61
KOG0360545 consensus Chaperonin complex component, TCP-1 alph 98.47
KOG0364527 consensus Chaperonin complex component, TCP-1 gamm 98.21
cd03333209 chaperonin_like chaperonin_like superfamily. Chape 94.79
PF08717199 nsp8: nsp8 replicase; InterPro: IPR014829 Viral Ns 82.54
cd03334261 Fab1_TCP TCP-1 like domain of the eukaryotic phosp 80.99
>KOG0356 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-35  Score=256.70  Aligned_cols=129  Identities=30%  Similarity=0.457  Sum_probs=125.1

Q ss_pred             EEecCCCCHHHHHHHHHHHHHHhHhhcChHHHHHHHHHHHHhcCcceEEeeCCc---chhhhHhHHHHHHHHHHHHhhcc
Q 047942            2 VILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPC---KLPDKLNGARLTLEAVKRTMDQK   78 (132)
Q Consensus         2 ~ii~g~g~~~~i~~r~~~l~~~i~~~~~~~~~~~L~eRlarL~ggvavI~VGg~---Ei~erk~ri~dAlna~~aAl~~G   78 (132)
                      +|+.|.+++++++.||+||+..++.++++|++++|+||+++|+||+|||+|||.   |++|||+|++||||++++|+++|
T Consensus       345 ~ll~g~~~~~~v~~rIeqik~~~e~t~~~ye~ekl~er~a~ls~gvavi~vGg~se~Ev~ekk~rv~dalnat~aaveeG  424 (550)
T KOG0356|consen  345 MLLKGKGNKAQVEGRIEQIKEMIEETTSDYEKEKLNERLAKLSGGVAVIKVGGHSEVEVNEKKDRVEDALNATRAAVEEG  424 (550)
T ss_pred             eeeCCCCCHHHHHHHHHHHHHHHHhhhhhhhHhHHHHHHHHhcCCeEEEEecCcchhhhhhhhhhHHHHHHHHHHHhhcC
Confidence            588999999999999999999999999999999999999999999999999999   99999999999999999999999


Q ss_pred             ccCCchHHHHHHHHHHhhhcc-CcHHHHHHHHHHHHHHHHHHHHHHHhcCCCc
Q 047942           79 IGPGAGIALLHVSKELDKLQS-ANVGANISIKLFQHALKVFFTPYCNSVTVYF  130 (132)
Q Consensus        79 iVpGGG~all~a~~~L~~~~~-~~~~e~~Gi~iv~~AL~~p~~~ia~NaG~~~  130 (132)
                      ||||||++|++|++.|+++.. .+.+++.|++||++||..|+++|++|||+|-
T Consensus       425 ivpGGG~all~~~~~l~~lk~~~~~~~k~G~eiv~~Al~~P~~~IakNAGvdg  477 (550)
T KOG0356|consen  425 IVPGGGTALLRAIPVLDELKATNNFDQKVGVEIVKKALRLPAQTIAKNAGVDG  477 (550)
T ss_pred             cccCCchHHHHhhhhhhhcccccchHhhhhHHHHHHHHhhhHHHHHHhcCCch
Confidence            999999999999999999887 5889999999999999999999999999873

>PRK12852 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK14104 chaperonin GroEL; Provisional Back     alignment and domain information
>PRK00013 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12851 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12850 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>TIGR02348 GroEL chaperonin GroL Back     alignment and domain information
>PRK12849 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>CHL00093 groEL chaperonin GroEL Back     alignment and domain information
>cd03344 GroEL GroEL_like type I chaperonin Back     alignment and domain information
>PTZ00114 Heat shock protein 60; Provisional Back     alignment and domain information
>PLN03167 Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit Back     alignment and domain information
>cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit Back     alignment and domain information
>cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit Back     alignment and domain information
>cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information
>TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit Back     alignment and domain information
>PTZ00212 T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit Back     alignment and domain information
>cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit Back     alignment and domain information
>cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>cd03343 cpn60 cpn60 chaperonin family Back     alignment and domain information
>cd00309 chaperonin_type_I_II chaperonin families, type I and type II Back     alignment and domain information
>TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit Back     alignment and domain information
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit Back     alignment and domain information
>TIGR02339 thermosome_arch thermosome, various subunits, archaeal Back     alignment and domain information
>cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism Back     alignment and domain information
>KOG0357 consensus Chaperonin complex component, TCP-1 epsilon subunit (CCT5) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0361 consensus Chaperonin complex component, TCP-1 eta subunit (CCT7) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0359 consensus Chaperonin complex component, TCP-1 zeta subunit (CCT6) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0358 consensus Chaperonin complex component, TCP-1 delta subunit (CCT4) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0363 consensus Chaperonin complex component, TCP-1 beta subunit (CCT2) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0362 consensus Chaperonin complex component, TCP-1 theta subunit (CCT8) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0360 consensus Chaperonin complex component, TCP-1 alpha subunit (CCT1) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0364 consensus Chaperonin complex component, TCP-1 gamma subunit (CCT3) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03333 chaperonin_like chaperonin_like superfamily Back     alignment and domain information
>PF08717 nsp8: nsp8 replicase; InterPro: IPR014829 Viral Nsp8 (non structural protein 8) forms a hexadecameric supercomplex with Nsp7 that adopts a hollow cylinder-like structure [] Back     alignment and domain information
>cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1j4z_A547 Structural And Mechanistic Basis For Allostery In T 5e-11
1kp8_A547 Structural Basis For Groel-Assisted Protein Folding 9e-11
4aaq_A548 Atp-Triggered Molecular Mechanics Of The Chaperonin 9e-11
1aon_A547 Crystal Structure Of The Asymmetric Chaperonin Comp 2e-10
1gr5_A547 Solution Structure Of Apo Groel By Cryo-Electron Mi 2e-10
1grl_A548 The Crystal Structure Of The Bacterial Chaperonin G 2e-10
1oel_A547 Conformational Variability In The Refined Structure 2e-10
2yey_A524 Crystal Structure Of The Allosteric-Defective Chape 2e-10
2eu1_A548 Crystal Structure Of The Chaperonin Groel-E461k Len 2e-10
1pcq_A524 Crystal Structure Of Groel-Groes Length = 524 2e-10
1sx3_A525 Groel14-(Atpgammas)14 Length = 525 2e-10
1ss8_A524 Groel Length = 524 2e-10
3cau_A526 D7 Symmetrized Structure Of Unliganded Groel At 4.2 2e-10
3c9v_A526 C7 Symmetrized Structure Of Unliganded Groel At 4.7 2e-10
1iok_A545 Crystal Structure Of Chaperonin-60 From Paracoccus 1e-09
1sjp_A504 Mycobacterium Tuberculosis Chaperonin60.2 Length = 4e-07
3rtk_A546 Crystal Structure Of Cpn60.2 From Mycobacterium Tub 4e-07
1we3_A543 Crystal Structure Of The Chaperonin Complex Cpn60CP 5e-06
>pdb|1J4Z|A Chain A, Structural And Mechanistic Basis For Allostery In The Bacterial Chaperonin Groel; See Remark 400 Length = 547 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 36/117 (30%), Positives = 66/117 (56%), Gaps = 3/117 (2%)
Query: 3   ILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPC---KLPD 59
           I+ G G ++AI+ R +Q+R  IE +TS Y+ + L++R+  L+   AV KVG     ++ +
Sbjct: 331 IIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKE 390
Query: 60  KLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALK 116
           K       L A +  +++ +  G G+AL+ V+ +L  L+  N   N+ IK+   A++
Sbjct: 391 KKARVEAALHATRAAVEEGVVAGGGVALIRVASKLADLRGQNADQNVGIKVALRAME 447
>pdb|1KP8|A Chain A, Structural Basis For Groel-Assisted Protein Folding From The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A Resolution Length = 547 Back     alignment and structure
>pdb|4AAQ|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel Length = 548 Back     alignment and structure
>pdb|1AON|A Chain A, Crystal Structure Of The Asymmetric Chaperonin Complex GroelGROES(ADP)7 Length = 547 Back     alignment and structure
>pdb|1GR5|A Chain A, Solution Structure Of Apo Groel By Cryo-Electron Microscopy Length = 547 Back     alignment and structure
>pdb|1GRL|A Chain A, The Crystal Structure Of The Bacterial Chaperonin Groel At 2.8 Angstroms Length = 548 Back     alignment and structure
>pdb|1OEL|A Chain A, Conformational Variability In The Refined Structure Of The Chaperonin Groel At 2.8 Angstrom Resolution Length = 547 Back     alignment and structure
>pdb|2YEY|A Chain A, Crystal Structure Of The Allosteric-Defective Chaperonin Groel E434k Mutant Length = 524 Back     alignment and structure
>pdb|2EU1|A Chain A, Crystal Structure Of The Chaperonin Groel-E461k Length = 548 Back     alignment and structure
>pdb|1PCQ|A Chain A, Crystal Structure Of Groel-Groes Length = 524 Back     alignment and structure
>pdb|1SX3|A Chain A, Groel14-(Atpgammas)14 Length = 525 Back     alignment and structure
>pdb|1SS8|A Chain A, Groel Length = 524 Back     alignment and structure
>pdb|3CAU|A Chain A, D7 Symmetrized Structure Of Unliganded Groel At 4.2 Angstrom Resolution By Cryoem Length = 526 Back     alignment and structure
>pdb|3C9V|A Chain A, C7 Symmetrized Structure Of Unliganded Groel At 4.7 Angstrom Resolution From Cryoem Length = 526 Back     alignment and structure
>pdb|1IOK|A Chain A, Crystal Structure Of Chaperonin-60 From Paracoccus Denitrificans Length = 545 Back     alignment and structure
>pdb|1SJP|A Chain A, Mycobacterium Tuberculosis Chaperonin60.2 Length = 504 Back     alignment and structure
>pdb|3RTK|A Chain A, Crystal Structure Of Cpn60.2 From Mycobacterium Tuberculosis At 2.8a Length = 546 Back     alignment and structure
>pdb|1WE3|A Chain A, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 543 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1iok_A545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 2e-14
1kp8_A547 Groel protein; chaperonin, assisted protein foldin 5e-14
3rtk_A546 60 kDa chaperonin 2; heat shock protein, chaperone 9e-14
1we3_A543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 5e-13
3m6c_A194 60 kDa chaperonin 1; chaperone, ATP-binding, nucle 3e-06
3osx_A201 60 kDa chaperonin; alpha, beta, apical domain, cha 3e-06
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Length = 545 Back     alignment and structure
 Score = 68.0 bits (167), Expect = 2e-14
 Identities = 38/119 (31%), Positives = 59/119 (49%), Gaps = 21/119 (17%)

Query: 2   VILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPC------ 55
            I+ GAG ++ IE R SQ+R  IE +TS Y+ + L++R+  L+   AV +VG        
Sbjct: 331 TIVDGAGEKAEIEARVSQIRQQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEIEVK 390

Query: 56  ----KLPDKLNGARLTLEAVKRTMDQKIGPGAGIALLHVSKELDKLQSAN----VGANI 106
               ++ D LN  R  ++       + I  G G+AL+  +K L+ L  AN     G  I
Sbjct: 391 ERKDRVDDALNATRAAVQ-------EGIVVGGGVALVQGAKVLEGLSGANSDQDAGIAI 442
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Length = 547 Back     alignment and structure
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Length = 546 Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Length = 543 Back     alignment and structure
>3m6c_A 60 kDa chaperonin 1; chaperone, ATP-binding, nucleotide-binding; 2.20A {Mycobacterium tuberculosis} Length = 194 Back     alignment and structure
>3osx_A 60 kDa chaperonin; alpha, beta, apical domain, chaperone; 1.55A {Xenorhabdus nematophila} PDB: 1kid_A 1fy9_A 1la1_A 1fya_A 1jon_A 1dk7_A 1dkd_A Length = 201 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
3rtk_A546 60 kDa chaperonin 2; heat shock protein, chaperone 100.0
1kp8_A547 Groel protein; chaperonin, assisted protein foldin 100.0
1iok_A545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 100.0
1we3_A543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 100.0
3p9d_C590 T-complex protein 1 subunit gamma; HSP60, eukaryot 99.97
3p9d_B527 T-complex protein 1 subunit beta; HSP60, eukaryoti 99.88
3iyg_Q512 T-complex protein 1 subunit theta; TRIC/CCT, asymm 99.86
3p9d_A559 T-complex protein 1 subunit alpha; HSP60, eukaryot 99.84
3iyg_D518 T-complex protein 1 subunit delta; TRIC/CCT, asymm 99.84
3iyg_B513 T-complex protein 1 subunit beta; TRIC/CCT, asymme 99.83
3p9d_G550 T-complex protein 1 subunit ETA; HSP60, eukaryotic 99.83
3iyg_E515 T-complex protein 1 subunit; TRIC/CCT, asymmetric, 99.82
3aq1_B500 Thermosome subunit; group II chaperonin, protein f 99.82
3p9d_D528 T-complex protein 1 subunit delta; HSP60, eukaryot 99.82
3p9d_F546 T-complex protein 1 subunit zeta; HSP60, eukaryoti 99.82
1a6d_A545 Thermosome (alpha subunit); group II chaperonin, C 99.82
3iyg_H515 T-complex protein 1 subunit ETA; TRIC/CCT, asymmet 99.81
1q3q_A548 Thermosome alpha subunit; chaperone, chaperonin; H 99.81
3p9d_E562 T-complex protein 1 subunit epsilon; HSP60, eukary 99.81
3iyg_G515 T-complex protein 1 subunit gamma; TRIC/CCT, asymm 99.8
3iyg_A529 T-complex protein 1 subunit alpha; TRIC/CCT, asymm 99.8
1a6d_B543 Thermosome (beta subunit); group II chaperonin, CC 99.8
3iyg_Z517 T-complex protein 1 subunit zeta; TRIC/CCT, asymme 99.8
3p9d_H568 T-complex protein 1 subunit theta; HSP60, eukaryot 99.79
3ruv_A543 Chaperonin, CPN; double-ring, protein folding mach 99.78
3ko1_A553 Chaperonin; 9-fold symmetry, double ring, ATP hydr 99.78
3m6c_A194 60 kDa chaperonin 1; chaperone, ATP-binding, nucle 99.65
3osx_A201 60 kDa chaperonin; alpha, beta, apical domain, cha 99.62
4e18_B59 Catenin alpha-1; four helix bundle, cell adhesion; 84.12
4ehp_B111 Catenin alpha-1; adherens junctions, vinculin bind 81.11
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Back     alignment and structure
Probab=100.00  E-value=3.2e-36  Score=262.00  Aligned_cols=129  Identities=26%  Similarity=0.377  Sum_probs=124.7

Q ss_pred             CEEecCCCCHHHHHHHHHHHHHHhHhhcChHHHHHHHHHHHHhcCcceEEeeCCc---chhhhHhHHHHHHHHHHHHhhc
Q 047942            1 MVILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLSNTAAVFKVGPC---KLPDKLNGARLTLEAVKRTMDQ   77 (132)
Q Consensus         1 ~~ii~g~g~~~~i~~r~~~l~~~i~~~~~~~~~~~L~eRlarL~ggvavI~VGg~---Ei~erk~ri~dAlna~~aAl~~   77 (132)
                      ++++.|.+++++|+.|++||+++++.++|+||||+|+|||+||+||++||.|||+   +++|++++++||||++++++++
T Consensus       328 ~~~i~g~~~~~~i~~r~~~i~~~~~~~~s~~~~ekl~erlakl~g~~atI~vrG~te~~l~E~er~l~DAl~a~r~av~~  407 (546)
T 3rtk_A          328 TTIVEGAGDTDAIAGRVAQIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEE  407 (546)
T ss_dssp             EEEEEECSCHHHHHHHHHHHHHHHHTCSCHHHHHHHHHHHHHHHHCEEEEECCCCSSTHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEcCCCCHHHHHHHHHHHHHHHhhccchhhHHHHHHHHHHhcCCeEEEEeCCCCHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            4789999999999999999999999999999999999999999999999999998   9999999999999999999999


Q ss_pred             cccCCchHHHHHHHHHHhhhccCcHHHHHHHHHHHHHHHHHHHHHHHhcCCCc
Q 047942           78 KIGPGAGIALLHVSKELDKLQSANVGANISIKLFQHALKVFFTPYCNSVTVYF  130 (132)
Q Consensus        78 GiVpGGG~all~a~~~L~~~~~~~~~e~~Gi~iv~~AL~~p~~~ia~NaG~~~  130 (132)
                      |+|||||++++++++.|+++. .++++|+|+++|++||+.|+++||+|||+|-
T Consensus       408 giVpGGGa~e~~~s~~L~~~~-~~g~eq~~i~~~a~ALe~ip~~La~NaG~d~  459 (546)
T 3rtk_A          408 GIVAGGGVTLLQAAPTLDELK-LEGDEATGANIVKVALEAPLKQIAFNSGLEP  459 (546)
T ss_dssp             CEEETTTHHHHTTGGGSTTSC-CCTTHHHHHHHHHHHTTHHHHHHHTTTTCCH
T ss_pred             CcccCCcHHHHHHHHHHHHhc-cccHHHHHHHHHHHHHHHHHHHHHHHcCCCH
Confidence            999999999999999999876 6789999999999999999999999999973
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Back     alignment and structure
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Back     alignment and structure
>3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B Back     alignment and structure
>3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* Back     alignment and structure
>3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* Back     alignment and structure
>3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Back     alignment and structure
>3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* Back     alignment and structure
>3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Back     alignment and structure
>3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* Back     alignment and structure
>3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* Back     alignment and structure
>1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Back     alignment and structure
>3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Back     alignment and structure
>3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* Back     alignment and structure
>3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Back     alignment and structure
>3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* Back     alignment and structure
>3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Back     alignment and structure
>3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Back     alignment and structure
>3m6c_A 60 kDa chaperonin 1; chaperone, ATP-binding, nucleotide-binding; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3osx_A 60 kDa chaperonin; alpha, beta, apical domain, chaperone; 1.55A {Xenorhabdus nematophila} SCOP: c.8.5.1 PDB: 1kid_A 1fy9_A 1la1_A 1fya_A 1jon_A 1dk7_A 1dkd_A Back     alignment and structure
>4e18_B Catenin alpha-1; four helix bundle, cell adhesion; 2.40A {Mus musculus} Back     alignment and structure
>4ehp_B Catenin alpha-1; adherens junctions, vinculin binding site, vinculin binding helix bundle, cell adhesion; 2.66A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d1kida_193 c.8.5.1 (A:) GroEL, A domain {Escherichia coli [Ta 4e-09
d1sjpa2184 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium 1e-06
d1ioka2176 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus de 7e-05
>d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: The "swivelling" beta/beta/alpha domain
superfamily: GroEL apical domain-like
family: GroEL-like chaperone, apical domain
domain: GroEL, A domain
species: Escherichia coli [TaxId: 562]

 Score = 50.2 bits (120), Expect = 4e-09
 Identities = 16/43 (37%), Positives = 29/43 (67%)

Query: 2   VILGGAGSQSAIEERHSQLRSAIELSTSGYEVKLLKQRLHYLS 44
            I+ G G ++AI+ R +Q+R  IE +TS Y+ + L++R+  L+
Sbjct: 148 TIIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLA 190
>d1sjpa2 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 184 Back     information, alignment and structure
>d1ioka2 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1we3a1255 GroEL, E domain {Thermus thermophilus [TaxId: 274] 99.51
d1ioka1252 GroEL, E domain {Paracoccus denitrificans [TaxId: 99.5
d1kida_193 GroEL, A domain {Escherichia coli [TaxId: 562]} 99.2
d1kp8a1252 GroEL, E domain {Escherichia coli [TaxId: 562]} 99.2
d1a6db1243 Thermosome, E domain {Archaeon Thermoplasma acidop 99.17
d1sjpa2184 GroEL, A domain {Mycobacterium tuberculosis, GroEL 99.13
d1sjpa1180 GroEL, E domain {Mycobacterium tuberculosis, GroEL 99.04
d1a6da1245 Thermosome, E domain {Archaeon Thermoplasma acidop 99.02
d1ioka397 GroEL, I domain {Paracoccus denitrificans [TaxId: 98.57
d1kp8a397 GroEL, I domain {Escherichia coli [TaxId: 562]} 98.4
d1q3qa1258 Thermosome, E domain {Archaeon Thermococcus sp. ks 98.31
d2ij9a1 219 Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax 80.34
>d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: GroEL equatorial domain-like
superfamily: GroEL equatorial domain-like
family: GroEL chaperone, ATPase domain
domain: GroEL, E domain
species: Thermus thermophilus [TaxId: 274]

Probab=99.51  E-value=2.4e-15  Score=116.34  Aligned_cols=123  Identities=14%  Similarity=0.109  Sum_probs=102.0

Q ss_pred             CCHHHHHHHHHHHHHHhHhhcChHHHHHHHHHH----HHhcCcceEEeeCCc---chhhhHhHHHHHHHHHHH-Hhhccc
Q 047942            8 GSQSAIEERHSQLRSAIELSTSGYEVKLLKQRL----HYLSNTAAVFKVGPC---KLPDKLNGARLTLEAVKR-TMDQKI   79 (132)
Q Consensus         8 g~~~~i~~r~~~l~~~i~~~~~~~~~~~L~eRl----arL~ggvavI~VGg~---Ei~erk~ri~dAlna~~a-Al~~Gi   79 (132)
                      ..++.++.+.+++..++..+++++..+.....+    +.+..++..|..|..   .+++.+..+++++++++. +...++
T Consensus        59 ~l~d~~e~~~a~~~~~~~~~~~~~~gDgttt~~vl~~~~l~~~~~~i~~G~~~~~i~~g~~~a~~~al~~l~~~~~~~~~  138 (255)
T d1we3a1          59 ELEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIEKAVEAAVEKIKALAIPVGI  138 (255)
T ss_dssp             CCSSHHHHHHHHHHHHHHHHHHHHHSSCHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHTCBCCCE
T ss_pred             cccchhhhhHHHHHHHhhhhhHHHhhcchhHHHHHHHHHHHhhhhHHhcCCccchhhhhhhhhhHHHHHHHHHHhhhcce
Confidence            445677899999999999888777544444433    456667777777776   778899999999999997 555589


Q ss_pred             cCCchHHHHHHHHHHhhhccC-cHHHHHHHHHHHHHHHHHHHHHHHhcCCCc
Q 047942           80 GPGAGIALLHVSKELDKLQSA-NVGANISIKLFQHALKVFFTPYCNSVTVYF  130 (132)
Q Consensus        80 VpGGG~all~a~~~L~~~~~~-~~~e~~Gi~iv~~AL~~p~~~ia~NaG~~~  130 (132)
                      |||||++++++...++..... ++++++|++++++||+.|++++++|+|++.
T Consensus       139 v~ggg~~~~~~~~~~~~~~~~~~g~~~~g~~iva~Al~~~~~~~~~nag~~~  190 (255)
T d1we3a1         139 VPGGGVTLLRAISAVEELIKKLEGDEATGAKIVRRALEEPARQIAENAGYEG  190 (255)
T ss_dssp             EETTTHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHTTHHHHHHHHHHTSCH
T ss_pred             eccchhhhhhhhhhhHhhccCCChHHHHHHHHHHHHHhhhHHHHHhhccccc
Confidence            999999999999999887665 899999999999999999999999999874
>d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Back     information, alignment and structure
>d1sjpa2 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
>d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
>d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Back     information, alignment and structure
>d1ioka3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure