Citrus Sinensis ID: 047986

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----

LARRLGLPPRQIAVWYQNRRAREKIHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHELKKSQQMLLASNPSATLLPSVSTSGDNDLTSSSSPLNMTCNWEDTGLLPMDELYSCLIRPQGQPENHSMNDLSIV

ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

cHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccc

larrlglpprqIAVWYQNRRAREKIHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHELKKSQQMLlasnpsatllpsvstsgdndltssssplnmtcnwedtgllpmdelysclirpqgqpenhsmndlsiv

larrlglpprqiavwyqnrrarekiHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHELKKSQQMLLASNPSATLLPSVSTSGDNDLTSSSSPLNMTCNWEDTGLLPMDELYSCLIrpqgqpenhsmndlsiv

LARRLGLPPRQIAVWYQNRRAREKIHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHELKKSQQMLLASNPSATLLPSVSTSGDNDLTSSSSPLNMTCNWEDTGLLPMDELYSCLIRPQGQPENHSMNDLSIV

*********RQIAVWYQNRRAREKIHTIELDYKTIQQELDNVLA****************************************************MTCNWEDTGLLPMDELYSCLI*****************

*******PPRQIAVWYQNRR******************************************************************************************************************

LARRLGLPPRQIAVWYQNRRAREKIHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHELKKSQQMLLASNPSATLLPS************SSPLNMTCNWEDTGLLPMDELYSCLIRPQGQPENHSMNDLSIV

LA*RLGLPPRQIAVWYQNRRAREKIHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHELKKSQQMLLA************************************LLPMDELYSCLIRPQ**************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

LARRLGLPPRQIAVWYQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLASNPSATLLPSVSTSGDNDLTSSSSPLNMTCNWEDTGLLPMDELYSCLIRPQGQPENHSMNDLSIV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		134	2.2.26 [Sep-21-2011]
Q9FN29		156	Homeobox-leucine zipper p	yes	no	0.768	0.660	0.347	2e-13
Q00466		314	Homeobox-leucine zipper p	no	no	0.492	0.210	0.445	1e-10
Q8S7W9		366	Homeobox-leucine zipper p	yes	no	0.425	0.155	0.5	2e-10
A2XD08		360	Homeobox-leucine zipper p	N/A	no	0.425	0.158	0.5	2e-10
Q8LC03		294	Homeobox-leucine zipper p	no	no	0.432	0.197	0.492	2e-10
Q05466		284	Homeobox-leucine zipper p	no	no	0.559	0.264	0.434	4e-10
P46600		282	Homeobox-leucine zipper p	no	no	0.567	0.269	0.415	7e-10
Q9LZR0		235	Putative homeobox-leucine	no	no	0.656	0.374	0.430	8e-10
Q6Z248		269	Homeobox-leucine zipper p	yes	no	0.567	0.282	0.407	9e-10
A2YWC0		269	Homeobox-leucine zipper p	N/A	no	0.567	0.282	0.407	9e-10

>sp\|Q9FN29\|ATB52_ARATH Homeobox-leucine zipper protein ATHB-52 OS=Arabidopsis thaliana GN=ATHB-52 PE=2 SV=1	Back alignment and function desciption

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 68/118 (57%), Gaps = 15/118 (12%)

Query: 1   LARRLGLPPRQIAVWYQNRRAREKIHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHEL 60
           L+ +LGLP RQ+AVW+QN+RAR K  ++E+ + T+Q + +  L++  KLE +V  L+ EL
Sbjct: 41  LSNQLGLPQRQVAVWFQNKRARFKTQSLEVQHCTLQSKHEAALSDKAKLEHQVQFLQDEL 100

Query: 61  KKSQ-QMLLASNPSATLLPSVSTSGDNDLTSSSSPLNMTCNWEDTGLLPMDELYSCLI 117
           K+++ Q+ L +N  + +  S   S D D               D  ++  DELY+C +
Sbjct: 101 KRARNQLALFTNQDSPVDNSNLGSCDED--------------HDDQVVVFDELYACFV 144

Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q00466\|HAT7_ARATH Homeobox-leucine zipper protein HAT7 OS=Arabidopsis thaliana GN=HAT7 PE=2 SV=4	Back alignment and function description

>sp\|Q8S7W9\|HOX21_ORYSJ Homeobox-leucine zipper protein HOX21 OS=Oryza sativa subsp. japonica GN=HOX21 PE=2 SV=1	Back alignment and function description

>sp\|A2XD08\|HOX21_ORYSI Homeobox-leucine zipper protein HOX21 OS=Oryza sativa subsp. indica GN=HOX21 PE=2 SV=2	Back alignment and function description

>sp\|Q8LC03\|ATB13_ARATH Homeobox-leucine zipper protein ATHB-13 OS=Arabidopsis thaliana GN=ATHB-13 PE=2 SV=2	Back alignment and function description

>sp\|Q05466\|HAT4_ARATH Homeobox-leucine zipper protein HAT4 OS=Arabidopsis thaliana GN=HAT4 PE=1 SV=1	Back alignment and function description

>sp\|P46600\|HAT1_ARATH Homeobox-leucine zipper protein HAT1 OS=Arabidopsis thaliana GN=HAT1 PE=2 SV=1	Back alignment and function description

>sp\|Q9LZR0\|ATB51_ARATH Putative homeobox-leucine zipper protein ATHB-51 OS=Arabidopsis thaliana GN=ATHB-51 PE=2 SV=2	Back alignment and function description

>sp\|Q6Z248\|HOX20_ORYSJ Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. japonica GN=HOX20 PE=2 SV=1	Back alignment and function description

>sp\|A2YWC0\|HOX20_ORYSI Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. indica GN=HOX20 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		134
224133390		179	predicted protein [Populus trichocarpa]	0.865	0.648	0.595	1e-30
224092950		179	predicted protein [Populus trichocarpa]	0.858	0.642	0.533	8e-27
225443586		171	PREDICTED: homeobox-leucine zipper prote	0.813	0.637	0.495	9e-21
225446465		168	PREDICTED: homeobox-leucine zipper prote	0.850	0.678	0.441	2e-18
255553613		150	homeobox protein, putative [Ricinus comm	0.537	0.48	0.643	9e-18
255639145		197	unknown [Glycine max]	0.865	0.588	0.384	6e-17
356517080		200	PREDICTED: homeobox-leucine zipper prote	0.865	0.58	0.376	1e-16
224121628		170	predicted protein [Populus trichocarpa]	0.880	0.694	0.459	2e-16
302142956		449	unnamed protein product [Vitis vinifera]	0.604	0.180	0.483	7e-14
225461543		161	PREDICTED: homeobox-leucine zipper prote	0.604	0.503	0.483	7e-14

>gi\|224133390\|ref\|XP_002328030.1\| predicted protein [Populus trichocarpa] gi\|222837439\|gb\|EEE75818.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 87/121 (71%), Gaps = 5/121 (4%)

Query: 1   LARRLGLPPRQIAVWYQNRRAREKIHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHEL 60
           LAR+LG+PP+Q+A+WYQNRRAR K   IE DY  IQ EL NVLAEN +LE++V MLK EL
Sbjct: 50  LARQLGVPPKQVAIWYQNRRARHKNDAIEHDYMNIQLELGNVLAENIRLEKQVSMLKFEL 109

Query: 61  KKSQQMLL-ASNPSATLLPSVSTSGDNDLTSSSSPLNMTCNWEDTG---LLPMDELYSCL 116
            K QQM+L     SA  LPSVS S D +  +SSSP NM CNW D G   + P++ELY+CL
Sbjct: 110 NKVQQMILFGPTSSAATLPSVSGSSD-EQANSSSPGNMICNWGDAGNDDMFPVEELYTCL 168

Query: 117 I 117
           I
Sbjct: 169 I 169

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224092950\|ref\|XP_002309768.1\| predicted protein [Populus trichocarpa] gi\|222852671\|gb\|EEE90218.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225443586\|ref\|XP_002273463.1\| PREDICTED: homeobox-leucine zipper protein ATHB-52 [Vitis vinifera] gi\|147785778\|emb\|CAN64250.1\| hypothetical protein VITISV_002432 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225446465\|ref\|XP_002275340.1\| PREDICTED: homeobox-leucine zipper protein HAT5 [Vitis vinifera] gi\|147819363\|emb\|CAN60172.1\| hypothetical protein VITISV_003668 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255553613\|ref\|XP_002517847.1\| homeobox protein, putative [Ricinus communis] gi\|223542829\|gb\|EEF44365.1\| homeobox protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255639145\|gb\|ACU19872.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|356517080\|ref\|XP_003527218.1\| PREDICTED: homeobox-leucine zipper protein ATHB-52-like [Glycine max]	Back alignment and taxonomy information

>gi\|224121628\|ref\|XP_002330748.1\| predicted protein [Populus trichocarpa] gi\|118486271\|gb\|ABK94977.1\| unknown [Populus trichocarpa] gi\|222872524\|gb\|EEF09655.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|302142956\|emb\|CBI20251.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225461543\|ref\|XP_002282682.1\| PREDICTED: homeobox-leucine zipper protein ATHB-52-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		134
TAIR\|locus:2154724		156	HB52 "homeobox protein 52" [Ar	0.768	0.660	0.338	1.5e-12
TAIR\|locus:2055028		318	HB4 "homeobox-leucine zipper p	0.723	0.305	0.37	3.2e-11
TAIR\|locus:2144578		235	HB51 "homeobox 51" [Arabidopsi	0.656	0.374	0.430	3.5e-11
TAIR\|locus:2129061		282	HAT1 [Arabidopsis thaliana (ta	0.694	0.329	0.392	5.9e-11
TAIR\|locus:2129136		284	HB-2 "homeobox protein 2" [Ara	0.559	0.264	0.434	6.1e-11
TAIR\|locus:2205075		294	ATHB13 [Arabidopsis thaliana (	0.641	0.292	0.409	6.9e-11
TAIR\|locus:2150901		314	HB-3 "homeobox 3" [Arabidopsis	0.694	0.296	0.384	1.1e-10
TAIR\|locus:2115215		216	HB40 "homeobox protein 40" [Ar	0.485	0.300	0.461	1.2e-10
TAIR\|locus:2103396		315	HAT3 "homeobox-leucine zipper	0.746	0.317	0.360	1.9e-10
TAIR\|locus:2173669		228	HB53 "homeobox 53" [Arabidopsi	0.701	0.412	0.329	2e-10

TAIR\|locus:2154724 HB52 "homeobox protein 52" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 167 (63.8 bits), Expect = 1.5e-12, P = 1.5e-12
 Identities = 40/118 (33%), Positives = 73/118 (61%)

Query:     1 LARRLGLPPRQIAVWYQNRRAREKIHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHEL 60
             L+ +LGLP RQ+AVW+QN+RAR K  ++E+ + T+Q + +  L++  KLE +V  L+ EL
Sbjct:    41 LSNQLGLPQRQVAVWFQNKRARFKTQSLEVQHCTLQSKHEAALSDKAKLEHQVQFLQDEL 100

Query:    61 KKSQQMLLASNPSATLLPSVSTSGDNDLTSSSSPLNMTCNWE-DTGLLPMDELYSCLI 117
             K+++  L           ++ T+ D+ + +S+  L  +C+ + D  ++  DELY+C +
Sbjct:   101 KRARNQL-----------ALFTNQDSPVDNSN--LG-SCDEDHDDQVVVFDELYACFV 144

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM;IEA;ISS

GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS

GO:0043565 "sequence-specific DNA binding" evidence=IEA

GO:0009637 "response to blue light" evidence=IEP

GO:0009646 "response to absence of light" evidence=IEP

TAIR\|locus:2055028 HB4 "homeobox-leucine zipper protein 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2144578 HB51 "homeobox 51" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2129061 HAT1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2129136 HB-2 "homeobox protein 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2205075 ATHB13 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2150901 HB-3 "homeobox 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2115215 HB40 "homeobox protein 40" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2103396 HAT3 "homeobox-leucine zipper protein 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2173669 HB53 "homeobox 53" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		134
pfam00046		57	pfam00046, Homeobox, Homeobox domain	6e-09
smart00389		57	smart00389, HOX, Homeodomain	9e-08
cd00086		59	cd00086, homeodomain, Homeodomain; DNA binding dom	2e-07
COG5576		156	COG5576, COG5576, Homeodomain-containing transcrip	0.003

>gnl\|CDD\|200956 pfam00046, Homeobox, Homeobox domain	Back alignment and domain information

 Score = 48.6 bits (117), Expect = 6e-09
 Identities = 15/24 (62%), Positives = 20/24 (83%)

Query: 1  LARRLGLPPRQIAVWYQNRRAREK 24
          LA++LGL  RQ+ VW+QNRRA+ K
Sbjct: 33 LAKKLGLTERQVKVWFQNRRAKWK 56

Length = 57

>gnl\|CDD\|197696 smart00389, HOX, Homeodomain	Back alignment and domain information

>gnl\|CDD\|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner	Back alignment and domain information

>gnl\|CDD\|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		134
KOG0483		198	consensus Transcription factor HEX, contains HOX a	99.73
KOG0489		261	consensus Transcription factor zerknullt and relat	99.11
KOG0848		317	consensus Transcription factor Caudal, contains HO	98.98
KOG0488		309	consensus Transcription factor BarH and related HO	98.9
KOG0842		307	consensus Transcription factor tinman/NKX2-3, cont	98.89
KOG0843		197	consensus Transcription factor EMX1 and related HO	98.88
KOG0850		245	consensus Transcription factor DLX and related pro	98.85
KOG0485		268	consensus Transcription factor NKX-5.1/HMX1, conta	98.84
KOG4577		383	consensus Transcription factor LIM3, contains LIM	98.82
KOG0492		246	consensus Transcription factor MSH, contains HOX d	98.65
KOG0844		408	consensus Transcription factor EVX1, contains HOX	98.56
KOG0494		332	consensus Transcription factor CHX10 and related H	98.54
KOG0484		125	consensus Transcription factor PHOX2/ARIX, contain	98.48
KOG0847		288	consensus Transcription factor, contains HOX domai	98.44
KOG2251		228	consensus Homeobox transcription factor [Transcrip	98.37
KOG0493		342	consensus Transcription factor Engrailed, contains	98.33
KOG0491		194	consensus Transcription factor BSH, contains HOX d	98.26
PF00046		57	Homeobox: Homeobox domain not present here.; Inter	98.19
COG5576		156	Homeodomain-containing transcription factor [Trans	98.11
cd00086		59	homeodomain Homeodomain; DNA binding domains invol	97.87
smart00389		56	HOX Homeodomain. DNA-binding factors that are invo	97.81
KOG0490		235	consensus Transcription factor, contains HOX domai	97.68
PF02183		45	HALZ: Homeobox associated leucine zipper; InterPro	97.4
smart00340		44	HALZ homeobox associated leucin zipper.	97.39
TIGR01565		58	homeo_ZF_HD homeobox domain, ZF-HD class. This mod	97.38
KOG0486		351	consensus Transcription factor PTX1, contains HOX	97.16
KOG0775		304	consensus Transcription factor SIX and related HOX	96.3
KOG0849		354	consensus Transcription factor PRD and related pro	96.26
KOG3802		398	consensus Transcription factor OCT-1, contains POU	95.73
PF02183		45	HALZ: Homeobox associated leucine zipper; InterPro	94.98
PF05920		40	Homeobox_KN: Homeobox KN domain; InterPro: IPR0084	94.7
PRK00888		105	ftsB cell division protein FtsB; Reviewed	93.62
KOG3119		269	consensus Basic region leucine zipper transcriptio	93.39
KOG0490		235	consensus Transcription factor, contains HOX domai	92.87
PF00170		64	bZIP_1: bZIP transcription factor cAMP response el	92.04
smart00338		65	BRLZ basic region leucin zipper.	91.88
PF06156		107	DUF972: Protein of unknown function (DUF972); Inte	91.32
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	91.21
KOG4571		294	consensus Activating transcription factor 4 [Trans	89.66
PRK13169		110	DNA replication intiation control protein YabA; Re	89.21
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	89.09
PF00170		64	bZIP_1: bZIP transcription factor cAMP response el	88.4
KOG0774		334	consensus Transcription factor PBX and related HOX	88.07
PF07716		54	bZIP_2: Basic region leucine zipper; InterPro: IPR	86.04
PF10224		80	DUF2205: Predicted coiled-coil protein (DUF2205);	86.01
PRK00888		105	ftsB cell division protein FtsB; Reviewed	84.93
smart00338		65	BRLZ basic region leucin zipper.	84.7
PRK13922		276	rod shape-determining protein MreC; Provisional	84.09
KOG4196		135	consensus bZIP transcription factor MafK [Transcri	83.71
KOG4005		292	consensus Transcription factor XBP-1 [Transcriptio	83.27
KOG4343		655	consensus bZIP transcription factor ATF6 [Transcri	81.81
PRK09413		121	IS2 repressor TnpA; Reviewed	81.42
PRK15422		79	septal ring assembly protein ZapB; Provisional	80.86
PF07407		420	Seadorna_VP6: Seadornavirus VP6 protein; InterPro:	80.83
KOG0773		342	consensus Transcription factor MEIS1 and related H	80.76

>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription]	Back alignment and domain information

Probab=99.73  E-value=2.6e-18  Score=133.99  Aligned_cols=84  Identities=37%  Similarity=0.625  Sum_probs=71.2

Q ss_pred             CcchhCCCCcccceecccchhhHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCc
Q 047986            1 LARRLGLPPRQIAVWYQNRRAREKIHTIELDYKTIQQELDNVLAENRKLEQEVGMLKHELKKSQQMLLASNPSATLLPSV   80 (134)
Q Consensus         1 LA~~l~L~e~qVkiWFQNRR~k~K~~~~~~~~~~lk~~~~~l~~en~~l~~e~~~L~~e~~~~~~~l~~~~~~~~~~~~~   80 (134)
                      ||+.|||.+|||+|||||||+|||.++.+.+|..|+.+++.|..++.+|+.++..|..++..+.......   .......
T Consensus        83 LAk~LgL~pRQVavWFQNRRARwK~kqlE~d~~~Lk~~~~~l~~~~~~Lq~e~~eL~~~~~~~~~~~~~~---~~~~~~~  159 (198)
T KOG0483|consen   83 LAKELGLQPRQVAVWFQNRRARWKTKQLEKDYESLKRQLESLRSENDRLQSEVQELVAELSSLKREMQKS---PENTLTM  159 (198)
T ss_pred             HHHhhCCChhHHHHHHhhccccccchhhhhhHHHHHHHHHHHhhhhhHHHHHHHHHHHHHhhhhhhhccC---ccccccc
Confidence            6899999999999999999999999999999999999999999999999999999999998776555322   2333455


Q ss_pred             CCCCCCC
Q 047986           81 STSGDND   87 (134)
Q Consensus        81 ~~S~~s~   87 (134)
                      ++.|...
T Consensus       160 ~~~~~~~  166 (198)
T KOG0483|consen  160 CPNSESS  166 (198)
T ss_pred             Ccccccc
Confidence            5666544

>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only]	Back alignment and domain information

>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription]	Back alignment and domain information

>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only]	Back alignment and domain information

>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription]	Back alignment and domain information

>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription]	Back alignment and domain information

>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription]	Back alignment and domain information

>KOG0485 consensus Transcription factor NKX-5	Back alignment and domain information

>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription]	Back alignment and domain information

>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only]	Back alignment and domain information

>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription]	Back alignment and domain information

>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only]	Back alignment and domain information

>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription]	Back alignment and domain information

>KOG0847 consensus Transcription factor, contains HOX domain [Transcription]	Back alignment and domain information

>KOG2251 consensus Homeobox transcription factor [Transcription]	Back alignment and domain information

>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only]	Back alignment and domain information

>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only]	Back alignment and domain information

>PF00046 Homeobox: Homeobox domain not present here	Back alignment and domain information

>COG5576 Homeodomain-containing transcription factor [Transcription]	Back alignment and domain information

>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner	Back alignment and domain information

>smart00389 HOX Homeodomain	Back alignment and domain information

>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only]	Back alignment and domain information

>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox []	Back alignment and domain information

>smart00340 HALZ homeobox associated leucin zipper	Back alignment and domain information

>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class	Back alignment and domain information

>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription]	Back alignment and domain information

>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription]	Back alignment and domain information

>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription]	Back alignment and domain information

>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription]	Back alignment and domain information

>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox []	Back alignment and domain information

>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants []	Back alignment and domain information

>PRK00888 ftsB cell division protein FtsB; Reviewed	Back alignment and domain information

>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription]	Back alignment and domain information

>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only]	Back alignment and domain information

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization

Back alignment and domain information

>smart00338 BRLZ basic region leucin zipper	Back alignment and domain information

>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>KOG4571 consensus Activating transcription factor 4 [Transcription]	Back alignment and domain information

>PRK13169 DNA replication intiation control protein YabA; Reviewed	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

Back alignment and domain information

>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription]	Back alignment and domain information

>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization	Back alignment and domain information

>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure	Back alignment and domain information

>PRK00888 ftsB cell division protein FtsB; Reviewed	Back alignment and domain information

>smart00338 BRLZ basic region leucin zipper	Back alignment and domain information

>PRK13922 rod shape-determining protein MreC; Provisional	Back alignment and domain information

>KOG4196 consensus bZIP transcription factor MafK [Transcription]	Back alignment and domain information

>KOG4005 consensus Transcription factor XBP-1 [Transcription]	Back alignment and domain information

>KOG4343 consensus bZIP transcription factor ATF6 [Transcription]	Back alignment and domain information

>PRK09413 IS2 repressor TnpA; Reviewed	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus	Back alignment and domain information

>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		134
1akh_A		61	Protein (mating-type protein A-1); complex (TWO DN	2e-10
2da3_A		80	Alpha-fetoprotein enhancer binding protein; homeob	3e-07
2da1_A		70	Alpha-fetoprotein enhancer binding protein; homeob	4e-07
2da2_A		70	Alpha-fetoprotein enhancer binding protein; homeob	4e-07
2dn0_A		76	Zinc fingers and homeoboxes protein 3; triple home	5e-07
1wi3_A		71	DNA-binding protein SATB2; homeodomain, helix-turn	2e-06
2d5v_A		164	Hepatocyte nuclear factor 6; transcription factor,	2e-06
1bw5_A		66	ISL-1HD, insulin gene enhancer protein ISL-1; DNA-	3e-06
1au7_A		146	Protein PIT-1, GHF-1; complex (DNA-binding protein	4e-06
2hi3_A		73	Homeodomain-only protein; transcription; NMR {Mus	4e-06
2xsd_C		164	POU domain, class 3, transcription factor 1; trans	4e-06
2dmq_A		80	LIM/homeobox protein LHX9; homeobox domain, three	9e-06
1e3o_C		160	Octamer-binding transcription factor 1; transcript	9e-06
2da5_A		75	Zinc fingers and homeoboxes protein 3; homeobox do	1e-05
2cqx_A		72	LAG1 longevity assurance homolog 5; homeodomain, D	2e-05
3d1n_I		151	POU domain, class 6, transcription factor 1; prote	2e-05
3nau_A		66	Zinc fingers and homeoboxes protein 2; ZHX2, corep	2e-05
2dmp_A		89	Zinc fingers and homeoboxes protein 2; homeobox do	4e-05
2djn_A		70	Homeobox protein DLX-5; structural genomics, NPPSF	4e-05
3rkq_A		58	Homeobox protein NKX-2.5; helix-turn-helix, DNA bi	5e-05
3l1p_A		155	POU domain, class 5, transcription factor 1; POU,	5e-05
2ecb_A		89	Zinc fingers and homeoboxes protein 1; homeobox do	6e-05
2hdd_A		61	Protein (engrailed homeodomain Q50K); DNA binding,	7e-05
3a03_A		56	T-cell leukemia homeobox protein 2; homeodomain, d	7e-05
1ig7_A		58	Homeotic protein MSX-1; helix-turn-helix, transcri	7e-05
3a02_A		60	Homeobox protein aristaless; homeodomain, developm	8e-05
1jgg_A		60	Segmentation protein EVEN-skipped; homeodomain, pr	9e-05
1uhs_A		72	HOP, homeodomain only protein; structural genomics	1e-04
2vi6_A		62	Homeobox protein nanog; homeodomain, DNA-binding,	1e-04
2dms_A		80	Homeobox protein OTX2; homeobox domain, three heli	1e-04
1zq3_P		68	PRD-4, homeotic bicoid protein; protein-DNA comple	1e-04
2l9r_A		69	Homeobox protein NKX-3.1; structural genomics, nor	1e-04
2e1o_A		70	Homeobox protein PRH; DNA binding protein, structu	2e-04
2cra_A		70	Homeobox protein HOX-B13; DNA-binding, transcripti	2e-04
1b8i_A		81	Ultrabithorax, protein (ultrabithorax homeotic pro	2e-04
2l7z_A		73	Homeobox protein HOX-A13; gene regulation; NMR {Ho	2e-04
1ftt_A		68	TTF-1 HD, thyroid transcription factor 1 homeodoma	2e-04
2k40_A		67	Homeobox expressed in ES cells 1; thermostable hom	2e-04
1yz8_P		68	Pituitary homeobox 2; DNA binding protein, transcr	2e-04
1nk2_P		77	Homeobox protein VND; homeodomain, DNA-binding pro	2e-04
2dmt_A		80	Homeobox protein BARH-like 1; homeobox domain, thr	3e-04
2dmu_A		70	Homeobox protein goosecoid; homeobox domain, three	3e-04
2cue_A		80	Paired box protein PAX6; homeobox domain, transcri	3e-04
2h1k_A		63	IPF-1, pancreatic and duodenal homeobox 1, homeodo	3e-04
2kt0_A		84	Nanog, homeobox protein nanog; homeodomain, struct	4e-04
1ahd_P		68	Antennapedia protein mutant; DNA binding protein/D	4e-04
1x2m_A		64	LAG1 longevity assurance homolog 6; homeobox domai	4e-04
1fjl_A		81	Paired protein; DNA-binding protein, paired BOX, t	4e-04
1puf_A		77	HOX-1.7, homeobox protein HOX-A9; homeodomian, pro	5e-04
3a01_A		93	Homeodomain-containing protein; homeodomain, prote	5e-04
2r5y_A		88	Homeotic protein sex combs reduced; homeodomain; H	5e-04

>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61	Back alignment and structure

 Score = 51.8 bits (125), Expect = 2e-10
 Identities = 10/24 (41%), Positives = 17/24 (70%)

Query: 1  LARRLGLPPRQIAVWYQNRRAREK 24
          +A++ G+ P Q+ VW+ N+R R K
Sbjct: 38 VAKKCGITPLQVRVWFINKRMRSK 61

PyMOL of 1akh

>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80	Back alignment and structure

>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76	Back alignment and structure

>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71	Back alignment and structure

>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164	Back alignment and structure

>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66	Back alignment and structure

>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146	Back alignment and structure

>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73	Back alignment and structure

>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164	Back alignment and structure

>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80	Back alignment and structure

>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160	Back alignment and structure

>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75	Back alignment and structure

>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72	Back alignment and structure

>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151	Back alignment and structure

>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66	Back alignment and structure

>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89	Back alignment and structure

>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70	Back alignment and structure

>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58	Back alignment and structure

>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155	Back alignment and structure

>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89	Back alignment and structure

>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61	Back alignment and structure

>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56	Back alignment and structure

>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58	Back alignment and structure

>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60	Back alignment and structure

>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60	Back alignment and structure

>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72	Back alignment and structure

>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62	Back alignment and structure

>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80	Back alignment and structure

>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68	Back alignment and structure

>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69	Back alignment and structure

>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70	Back alignment and structure

>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70	Back alignment and structure

>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81	Back alignment and structure

>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73	Back alignment and structure

>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68	Back alignment and structure

>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67	Back alignment and structure

>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68	Back alignment and structure

>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77	Back alignment and structure

>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80	Back alignment and structure

>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80	Back alignment and structure

>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63	Back alignment and structure

>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84	Back alignment and structure

>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68	Back alignment and structure

>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64	Back alignment and structure

>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81	Back alignment and structure

>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77	Back alignment and structure

>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93	Back alignment and structure

>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		134
1x2m_A		64	LAG1 longevity assurance homolog 6; homeobox domai	98.98
2nzz_A		37	Penetratin conjugated GAS (374-394) peptide; confo	98.94
3a01_A		93	Homeodomain-containing protein; homeodomain, prote	98.93
3a03_A		56	T-cell leukemia homeobox protein 2; homeodomain, d	98.92
2l9r_A		69	Homeobox protein NKX-3.1; structural genomics, nor	98.9
2ecb_A		89	Zinc fingers and homeoboxes protein 1; homeobox do	98.85
1uhs_A		72	HOP, homeodomain only protein; structural genomics	98.85
2cue_A		80	Paired box protein PAX6; homeobox domain, transcri	98.85
3a02_A		60	Homeobox protein aristaless; homeodomain, developm	98.84
2cqx_A		72	LAG1 longevity assurance homolog 5; homeodomain, D	98.83
1puf_A		77	HOX-1.7, homeobox protein HOX-A9; homeodomian, pro	98.83
1nk2_P		77	Homeobox protein VND; homeodomain, DNA-binding pro	98.83
2vi6_A		62	Homeobox protein nanog; homeodomain, DNA-binding,	98.83
2hi3_A		73	Homeodomain-only protein; transcription; NMR {Mus	98.83
2h1k_A		63	IPF-1, pancreatic and duodenal homeobox 1, homeodo	98.82
1ahd_P		68	Antennapedia protein mutant; DNA binding protein/D	98.81
3nau_A		66	Zinc fingers and homeoboxes protein 2; ZHX2, corep	98.8
1yz8_P		68	Pituitary homeobox 2; DNA binding protein, transcr	98.8
1zq3_P		68	PRD-4, homeotic bicoid protein; protein-DNA comple	98.8
2kt0_A		84	Nanog, homeobox protein nanog; homeodomain, struct	98.79
2hdd_A		61	Protein (engrailed homeodomain Q50K); DNA binding,	98.78
2dmq_A		80	LIM/homeobox protein LHX9; homeobox domain, three	98.78
1ig7_A		58	Homeotic protein MSX-1; helix-turn-helix, transcri	98.78
2dmt_A		80	Homeobox protein BARH-like 1; homeobox domain, thr	98.78
2da4_A		80	Hypothetical protein DKFZP686K21156; homeobox doma	98.77
2da5_A		75	Zinc fingers and homeoboxes protein 3; homeobox do	98.77
1fjl_A		81	Paired protein; DNA-binding protein, paired BOX, t	98.77
1ftt_A		68	TTF-1 HD, thyroid transcription factor 1 homeodoma	98.77
1b8i_A		81	Ultrabithorax, protein (ultrabithorax homeotic pro	98.77
2dmu_A		70	Homeobox protein goosecoid; homeobox domain, three	98.77
2dms_A		80	Homeobox protein OTX2; homeobox domain, three heli	98.76
2cra_A		70	Homeobox protein HOX-B13; DNA-binding, transcripti	98.76
1jgg_A		60	Segmentation protein EVEN-skipped; homeodomain, pr	98.75
2da3_A		80	Alpha-fetoprotein enhancer binding protein; homeob	98.75
2e1o_A		70	Homeobox protein PRH; DNA binding protein, structu	98.75
2ecc_A		76	Homeobox and leucine zipper protein homez; homeobo	98.75
2k40_A		67	Homeobox expressed in ES cells 1; thermostable hom	98.74
2da1_A		70	Alpha-fetoprotein enhancer binding protein; homeob	98.74
2e19_A		64	Transcription factor 8; homeobox domain, structura	98.73
2da2_A		70	Alpha-fetoprotein enhancer binding protein; homeob	98.73
2l7z_A		73	Homeobox protein HOX-A13; gene regulation; NMR {Ho	98.73
2ly9_A		74	Zinc fingers and homeoboxes protein 1; structural	98.73
3rkq_A		58	Homeobox protein NKX-2.5; helix-turn-helix, DNA bi	98.72
2dmp_A		89	Zinc fingers and homeoboxes protein 2; homeobox do	98.7
3nar_A		96	ZHX1, zinc fingers and homeoboxes protein 1; corep	98.7
2dn0_A		76	Zinc fingers and homeoboxes protein 3; triple home	98.69
2m0c_A		75	Homeobox protein aristaless-like 4; structural gen	98.69
2djn_A		70	Homeobox protein DLX-5; structural genomics, NPPSF	98.69
1wh5_A		80	ZF-HD homeobox family protein; structural genomics	98.69
1wh7_A		80	ZF-HD homeobox family protein; homeobox domain, st	98.68
1k61_A		60	Mating-type protein alpha-2; protein-DNA complex,	98.68
1bw5_A		66	ISL-1HD, insulin gene enhancer protein ISL-1; DNA-	98.68
1puf_B		73	PRE-B-cell leukemia transcription factor-1; homeod	98.68
1b72_B		87	Protein (PBX1); homeodomain, DNA, complex, DNA-bin	98.67
1x2n_A		73	Homeobox protein pknox1; homeobox domain, structur	98.65
1le8_B		83	Mating-type protein alpha-2; matalpha2, isothermal	98.64
1akh_A		61	Protein (mating-type protein A-1); complex (TWO DN	98.64
3k2a_A		67	Homeobox protein MEIS2; homeobox domain, DNA-bindi	98.63
1du6_A		64	PBX1, homeobox protein PBX1; homeodomain, gene reg	98.63
2dmn_A		83	Homeobox protein TGIF2LX; TGFB-induced factor 2-li	98.58
2cuf_A		95	FLJ21616 protein; homeobox domain, hepatocyte tran	98.49
2lk2_A		89	Homeobox protein TGIF1; NESG, structural genomics,	98.38
1wi3_A		71	DNA-binding protein SATB2; homeodomain, helix-turn	98.25
2da6_A		102	Hepatocyte nuclear factor 1-beta; homeobox domain,	98.24
1lfb_A		99	Liver transcription factor (LFB1); transcription r	98.19
2da7_A		71	Zinc finger homeobox protein 1B; homeobox domain,	98.03
2wt7_A		63	Proto-oncogene protein C-FOS; transcription, trans	94.87
1hjb_A		87	Ccaat/enhancer binding protein beta; transcription	94.86
1t2k_D		61	Cyclic-AMP-dependent transcription factor ATF-2; p	94.55
1ci6_A		63	Transcription factor ATF-4; BZIP; 2.60A {Homo sapi	94.23
1gu4_A		78	CAAT/enhancer binding protein beta; transcription/	93.92
1jnm_A		62	Proto-oncogene C-JUN; BZIP, protein-DNA complex, t	93.25
2yy0_A		53	C-MYC-binding protein; conserved hypothetical prot	90.41
1hjb_A		87	Ccaat/enhancer binding protein beta; transcription	90.14
2yy0_A		53	C-MYC-binding protein; conserved hypothetical prot	89.18
1t2k_D		61	Cyclic-AMP-dependent transcription factor ATF-2; p	88.56
1gd2_E		70	Transcription factor PAP1; basic leucine zipper, p	88.49
2oxj_A		34	Hybrid alpha/beta peptide based on the GCN4-P1 Se	88.36
2dgc_A		63	Protein (GCN4); basic domain, leucine zipper, DNA	88.14
1kd8_B		36	GABH BLL, GCN4 acid base heterodimer base-D12LA16L	87.16
3m48_A		33	General control protein GCN4; leucine zipper, synt	86.67
1ci6_A		63	Transcription factor ATF-4; BZIP; 2.60A {Homo sapi	85.86
3c3g_A		33	Alpha/beta peptide with the GCN4-PLI SIDE chain S	85.77
3c3f_A		34	Alpha/beta peptide with the GCN4-PLI SIDE chain S	85.7
1gu4_A		78	CAAT/enhancer binding protein beta; transcription/	85.12
1gd2_E		70	Transcription factor PAP1; basic leucine zipper, p	84.5
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	84.38
1kd8_A		36	GABH AIV, GCN4 acid base heterodimer acid-D12IA16V	83.48
2wt7_A		63	Proto-oncogene protein C-FOS; transcription, trans	83.47
1go4_E		100	MAD1 (mitotic arrest deficient)-like 1; mitotic sp	83.23
1jnm_A		62	Proto-oncogene C-JUN; BZIP, protein-DNA complex, t	81.45

>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1	Back alignment and structure

Probab=98.98  E-value=1.2e-11  Score=79.87  Aligned_cols=26  Identities=35%  Similarity=0.680  Sum_probs=24.0

Q ss_pred             CcchhCCCCcccceecccchhhHHHH
Q 047986            1 LARRLGLPPRQIAVWYQNRRAREKIH   26 (134)
Q Consensus         1 LA~~l~L~e~qVkiWFQNRR~k~K~~   26 (134)
                      ||.+|||+++||+|||||||+|+|..
T Consensus        34 LA~~l~LterQVkvWFqNRR~k~k~~   59 (64)
T 1x2m_A           34 LSKQLDWDVRSIQRWFRQRRNQEKPS   59 (64)
T ss_dssp             HHHHHCSCHHHHHHHHHHHHHHSCCS
T ss_pred             HHHHhCCCHHHHHHHHHHHHhccCCC
Confidence            68999999999999999999999853

PyMOL of 1x2m

>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A	Back alignment and structure

>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster}	Back alignment and structure

>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens}	Back alignment and structure

>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}	Back alignment and structure

>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1	Back alignment and structure

>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A	Back alignment and structure

>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1	Back alignment and structure

>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A	Back alignment and structure

>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A	Back alignment and structure

>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus}	Back alignment and structure

>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1	Back alignment and structure

>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus}	Back alignment and structure

>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A	Back alignment and structure

>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens}	Back alignment and structure

>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P	Back alignment and structure

>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1	Back alignment and structure

>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A	Back alignment and structure

>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1	Back alignment and structure

>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B	Back alignment and structure

>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1	Back alignment and structure

>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A*	Back alignment and structure

>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1	Back alignment and structure

>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens}	Back alignment and structure

>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A*	Back alignment and structure

>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}	Back alignment and structure

>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens}	Back alignment and structure

>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens}	Back alignment and structure

>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}	Back alignment and structure

>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1	Back alignment and structure

>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1	Back alignment and structure

>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1	Back alignment and structure

>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1	Back alignment and structure

>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B*	Back alignment and structure

>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P	Back alignment and structure

>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B*	Back alignment and structure

>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A*	Back alignment and structure

>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1	Back alignment and structure

>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens}	Back alignment and structure

>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens}	Back alignment and structure

>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A	Back alignment and structure

>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D	Back alignment and structure

>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A	Back alignment and structure

>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A	Back alignment and structure

>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens}	Back alignment and structure

>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens}	Back alignment and structure

>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1	Back alignment and structure

>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A*	Back alignment and structure

>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D	Back alignment and structure

>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B	Back alignment and structure

>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A	Back alignment and structure

>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A*	Back alignment and structure

>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1	Back alignment and structure

>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A	Back alignment and structure

>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A	Back alignment and structure

>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D	Back alignment and structure

>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1	Back alignment and structure

>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		134
d1x2ma1		52	a.4.1.1 (A:8-59) Lag1 longevity assurance homolog	3e-08
d1k61a_		60	a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast	3e-08
d2cuea1		68	a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H	4e-08
d1bw5a_		66	a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {	5e-08
d2cqxa1		59	a.4.1.1 (A:8-66) LAG1 longevity assurance homolog	1e-07
d1p7ia_		53	a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel	2e-07
d9anta_		56	a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila	2e-07
d2e1oa1		57	a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo	2e-07
d2craa1		58	a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (	2e-07
d1b72a_		88	a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo	3e-07
d1pufb_		73	a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96	3e-07
d1pufa_		77	a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m	3e-07
d1wh7a_		80	a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha	6e-07
d1x2na1		62	a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H	9e-07
d1jgga_		57	a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (	9e-07
d1au7a1		58	a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra	1e-06
d1ig7a_		58	a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu	1e-06
d1uhsa_		72	a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse	3e-06
d1ftta_		68	a.4.1.1 (A:) Thyroid transcription factor 1 homeod	4e-06
d1zq3p1		67	a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl	4e-06
d1wi3a_		71	a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom	4e-06
d1fjla_		65	a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila	4e-06
d1le8a_		53	a.4.1.1 (A:) Mating type protein A1 Homeodomain {B	6e-06
d2cufa1		82	a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM	2e-05
d1e3oc1		57	a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (	3e-05
d1yz8p1		60	a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo	3e-05
d1s7ea1		50	a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M	5e-05
d1ocpa_		67	a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus	8e-05
d1vnda_		77	a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi	2e-04
d2ecba1		76	a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote	2e-04
d1lfba_		78	a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN	4e-04

>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52	Back information, alignment and structure


class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Lag1 longevity assurance homolog 6, LASS6
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 44.7 bits (106), Expect = 3e-08
 Identities = 9/24 (37%), Positives = 15/24 (62%)

Query: 1  LARRLGLPPRQIAVWYQNRRAREK 24
          L+++L    R I  W++ RR +EK
Sbjct: 27 LSKQLDWDVRSIQRWFRQRRNQEK 50

PyMOL of d1x2ma1

>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60	Back information, alignment and structure

>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68	Back information, alignment and structure

>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66	Back information, alignment and structure

>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59	Back information, alignment and structure

>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53	Back information, alignment and structure

>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56	Back information, alignment and structure

>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57	Back information, alignment and structure

>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58	Back information, alignment and structure

>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73	Back information, alignment and structure

>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77	Back information, alignment and structure

>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80	Back information, alignment and structure

>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62	Back information, alignment and structure

>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57	Back information, alignment and structure

>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58	Back information, alignment and structure

>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58	Back information, alignment and structure

>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72	Back information, alignment and structure

>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68	Back information, alignment and structure

>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67	Back information, alignment and structure

>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65	Back information, alignment and structure

>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53	Back information, alignment and structure

>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82	Back information, alignment and structure

>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57	Back information, alignment and structure

>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60	Back information, alignment and structure

>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50	Back information, alignment and structure

>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67	Back information, alignment and structure

>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77	Back information, alignment and structure

>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76	Back information, alignment and structure

>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		134
d9anta_		56	Antennapedia Homeodomain {Drosophila melanogaster	99.04
d1zq3p1		67	Homeotic bicoid protein {Fruit fly (Drosophila mel	98.92
d1uhsa_		72	Homeodomain-only protein, Hop {Mouse (Mus musculus	98.92
d1jgga_		57	Even-skipped homeodomain {Fruit fly (Drosophila me	98.91
d2craa1		58	Homeobox protein hox-b13 {Human (Homo sapiens) [Ta	98.91
d2e1oa1		57	Homeobox protein prh {Human (Homo sapiens) [TaxId:	98.88
d1pufa_		77	Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax	98.87
d1ig7a_		58	Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10	98.84
d1p7ia_		53	Engrailed Homeodomain {Drosophila melanogaster [Ta	98.81
d1fjla_		65	Paired protein {Fruit fly (Drosophila melanogaster	98.78
d1yz8p1		60	Pituitary homeobox 2 {Human (Homo sapiens) [TaxId:	98.76
d2cuea1		68	Paired box protein pax6 {Human (Homo sapiens) [Tax	98.73
d1x2ma1		52	Lag1 longevity assurance homolog 6, LASS6 {Mouse (	98.73
d1vnda_		77	VND/NK-2 protein {Fruit fly (Drosophila melanogast	98.7
d1le8a_		53	Mating type protein A1 Homeodomain {Baker's yeast	98.69
d1ftta_		68	Thyroid transcription factor 1 homeodomain {Rat (R	98.69
d1e3oc1		57	Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId	98.68
d1au7a1		58	Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta	98.65
d2cqxa1		59	LAG1 longevity assurance homolog 5, LASS5 {Mouse (	98.58
d2ecba1		76	Zinc fingers and homeoboxes protein 1, ZHX1 {Human	98.55
d1wi3a_		71	DNA-binding protein SATB2 {Human (Homo sapiens) [T	98.54
d1ocpa_		67	Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId	98.52
d1bw5a_		66	Insulin gene enhancer protein isl-1 {Rat (Rattus n	98.51
d2ecca1		76	Homeobox-leucine zipper protein Homez {Human (Homo	98.44
d2cufa1		82	Homeobox-containing protein 1, HMBOX1 (Flj21616) {	98.39
d1s7ea1		50	Hepatocyte nuclear factor 6 {Mouse (Mus musculus)	98.38
d1k61a_		60	mat alpha2 Homeodomain {Baker's yeast (Saccharomyc	98.37
d1pufb_		73	pbx1 {Human (Homo sapiens) [TaxId: 9606]}	98.37
d1wh7a_		80	ZF-HD homeobox protein At4g24660 {Thale cress (Ara	98.3
d1lfba_		78	Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat	98.03
d1x2na1		62	Homeobox protein pknox1 {Human (Homo sapiens) [Tax	97.96
d2jn6a1		89	Uncharacterized protein Cgl2762 {Corynebacterium g	80.12

>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]

Probab=99.04  E-value=3.8e-12  Score=78.71  Aligned_cols=26  Identities=46%  Similarity=0.791  Sum_probs=24.3

Q ss_pred             CcchhCCCCcccceecccchhhHHHH
Q 047986            1 LARRLGLPPRQIAVWYQNRRAREKIH   26 (134)
Q Consensus         1 LA~~l~L~e~qVkiWFQNRR~k~K~~   26 (134)
                      ||..|||++++|+|||||||+|+|++
T Consensus        30 LA~~l~l~~~~V~iWFQNrRak~kk~   55 (56)
T d9anta_          30 IAHALSLTERQIKIWFQNRRMKWKKE   55 (56)
T ss_dssp             HHHHHTCCHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHhCCChhHeeeccccchhhhhhc
Confidence            68899999999999999999999974

PyMOL of d9anta_

>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]}	Back information, alignment and structure