Citrus Sinensis ID: 048004

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940---

QRCRIIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSEDLGRDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQCFSRNLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLTNSRPGFLAPSILPKLLKPQRLRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGKLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAMEAQMDGKKNLKELSLKWTCSTDGSSSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFCGNDPPCLETLRFENMREWEDWIPHGSGQRVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKLHIGGCKKVVWRRPLKLRLPKLEELEIENMKEQTYIWKSHKELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEAWMCGTNSSLEILSIQGCHSLTYIAGVQLPPSLKRLEIDFCDNLRTLTVEEGIQSSSSSSSSSRSIWTCENLKFLPSGLHNLRQLQEIEIWECENLVSFPQGGLPCAKLSMLTVYGCERLKALPKGLHNLTNLHSLEIHGNTKIWKSMIEWGRGFHRFSSLRELKISRCDDDMVSFPPEDIRLGTTLPLPASLTSLEIGYFPNLERLSSSIVDLQNLTSLFLYHCPKLKYFPEKGLPSSLLELIIYRCPLIAEKCGKDGGQYWDLLTHIPHVAIDGKSIFGDKYSRE

ccccccHHHHHcccccccccccccccccccccccEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccEEccccccEEEcHHHHHHHHHHHHccEEEEEccccccccccccccEEEEEEEEccccccccccccccccccEEEEEccccccccccccccHHHcccccccEEEEEccccccccccccccccccccEEEccccccccccccccccccccEEcccccccccccHHHccccccccEEEEccccccccccccccccccccccccEEEcccccccHHHHccccccccEEEEccccccccccHHHHcccccccccccEEEEEcccccccccccHHHHHHHHccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEEcccccEEEcccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEccccccEEccccccccccccEEEEEEccccccccccHHHHHcccccccEEEEcccccccccccHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccEEEEEcccccEEcccccccccccEEEEccccccccccHHHcccccccccEEEEEccccccccccccccccccEEEEEEccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEEccccEEccccccccccccEEEEEEccccccccccccccccccEEEEEccccccHHHHHHcccccccccccEEEEEEccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEEEccccccc

ccccccHHHHEcHHccccHHHHHHHEHEcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHHcccEEEEEccccccccEEccccEEEEEEEcccccccccccHHHHHHccEEEEEccccccccccHHHHHHHHHHHccEEEEEEEcccccccccccccccHHHEEEEcccccHcHcccHHHHHHHHHHHHHccccHHHHccHHHHccccccEEEccccccHHcccccccccccccEccEEEEcccccccHHHHHcHHHcccEEEEEcccccccHHHHHHHHHcccccccEEEEEEccccccccccccHHHHHHHHHccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccEEEccccHHHHHcccccccccccccccccEEEEccccHHccccccccccccEEEEcccccccccccccccHcEEEEccccccEcccccccccccccEEEEcccccccccHHHHHHHccccccccEEEEcccccccccccccccccccccccccccccEEEEcccccHHHccHHccccccccEEEEcccccccccccccccccccEEEEcccccHccccHHHcccccccccEEEEcccccccccccccccccccEEEEcccccHccccHHccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccHcccccccccEEEEcccHHHHHccHHccccccccccccEEEEcccccccccccHHHccccccccccccccEEEEcccccHHcccccccccccccEEEEcccccHcccccccccccHcEEEEcccHHHHHHHHcccccccccEccccEEEEcccEEEcHHHHcc

QRCRIIPALAVsyyylpptlkqcfahcsllpkdyefeEEEIILLWCAAgfldhkedenpsedlGRDFFKELCsrsffqqsatdASLFVMHDLINDLARWAAGETYFTLEYTsevnkqqcfsrNLRHLSyirgdydgvqrfgdlydIQHLRTFLPvmltnsrpgflapsilpkllkpqrlrAFSLRGYyifelpdsvgdlrYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGnlaklhhlknsntksleempvgigkLTSLQTLCNFvvgkgsgsglRELKLLTHLHgtlnisklenvkcVGDAMEAQMDGKKNLKELSLkwtcstdgsssreaetemgvldmlkphtnleqfcikgyggmkfptwlgdslfsnlvtlefedcgmctalpsvgqlpslkhltVRGMSRVkrlgsefcgndppcletlrfenmrewedwiphgsgqrvegfpklRELHILRCSklkgtfpehlpALEMLVIEGCEELLVSVSSlpalcklhiggckkvvwrrplklrlpkleELEIENMKEQTYIWKSHKELLQDICSLkrltidscpklqSLVAEEEKDQQQQLCELSCRLEyltlsgcqglvklpqsslslnslreIEIYKcsslvsfpevalpsklkkIEIRECDAlkslpeawmcgtnssleilsiqgchsltyiagvqlppslkrleiDFCDNLRTLTVEEgiqsssssssssrsiwtcenlkflpsglhnLRQLQEIEIWEcenlvsfpqgglpcaklsmltVYGCERLkalpkglhnltnlhsleihGNTKIWKSMIEWGRGFHRFSSLRELkisrcdddmvsfppedirlgttlplpasltsleigyfpnlerlsssivdlqnltslflyhcpklkyfpekglpssLLELIIYRCpliaekcgkdggqYWDLLthiphvaidgksifgdkysre

QRCRIIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSEDLGRDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQCFSRNLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLTNSRPGFLAPsilpkllkpQRLRAFSLRGYYIFelpdsvgdlrYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKlhhlknsntkslEEMPVGIGKLTSLQTLCNFVVGKGSGSGLRELKLLTHLHgtlnisklenVKCVGDAMEAQMDGKKNLKELSLKwtcstdgsssreAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALpsvgqlpslkhLTVRGMSRVKrlgsefcgndppCLETLRFENMREWEDWIPHGSGQRVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKLHiggckkvvwrrpLKLRLPKLEELEIENMKEQTYIWKSHKELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEAWMCGTNSSLEILSIQGCHSLTYIAGVQLPPSLKRLEIDFCDNLRTLTVeegiqsssssssssrsiWTCENLKFLPSGLHNLRQLQEIEIWECENLVSFPQGGLPCAKLSMLTVYGCERLKALPKGLHNLTNLHSLEIHGNTKIWKSMIEWGRGFHRFSSLRELKISRCDDDMVSFPPEDIRLGTTLPLPASLTSLEIGYFPNLERLSSSIVDLQNLTSLFLYHCPKLKYFPEKGLPSSLLELIIYRCPLIAEKCGKDGGQYWDLLTHIPhvaidgksifgdkysre

QRCRIIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSEDLGRDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQCFSRNLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLTNSRPGFLAPSILPKLLKPQRLRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGKLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAMEAQMDGKKNLKELSLKWTCSTDGSSSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFCGNDPPCLETLRFENMREWEDWIPHGSGQRVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKLHIGGCKKVVWrrplklrlpkleeleIENMKEQTYIWKSHKELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEAWMCGTNSSLEILSIQGCHSLTYIAGVQLPPSLKRLEIDFCDNLRTLTVEEGIQsssssssssrsIWTCENLKFLPSGLHNLRQLQEIEIWECENLVSFPQGGLPCAKLSMLTVYGCERLKALPKGLHNLTNLHSLEIHGNTKIWKSMIEWGRGFHRFSSLRELKISRCDDDMVSFPPEDIRlgttlplpasltslEIGYFPNLERLSSSIVDLQNLTSLFLYHCPKLKYFPEKGLPSSLLELIIYRCPLIAEKCGKDGGQYWDLLTHIPHVAIDGKSIFGDKYSRE

**CRIIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDH**********GRDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQCFSRNLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLTNSRPGFLAPSILPKLLKPQRLRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKN*****LEEMPVGIGKLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAM*************SLKWT****************VLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFCGNDPPCLETLRFENMREWEDWIPHGSGQRVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKLHIGGCKKVVWRRPLKLRLPKLEELEIENMKEQTYIWKSHKELLQDICSLKRLTIDSCPKLQSLVA*******QQLCELSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEAWMCGTNSSLEILSIQGCHSLTYIAGVQLPPSLKRLEIDFCDNLRTLTV****************IWTCENLKFLPSGLHNLRQLQEIEIWECENLVSFPQGGLPCAKLSMLTVYGCERLKALPKGLHNLTNLHSLEIHGNTKIWKSMIEWGRGFHRFSSLRELKISRCDDDMVSFPPEDIRLGTTLPLPASLTSLEIGYFPNLERLSSSIVDLQNLTSLFLYHCPKLKYFPEKGLPSSLLELIIYRCPLIAEKCGKDGGQYWDLLTHIPHVAIDGKSIFG******

*RCRIIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSEDLGRDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEV***QCFSRNLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLTNSRPGFLAPSILPKLLKPQRLRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGKLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAMEAQMDGKKNLKELSLKWTCSTDG******ETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFCGNDPPCLETLRFENMREWEDWIPHGSGQRVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKLHIGGCKKVVWRRPLKLRLPKLEELEIENMKEQTYIWKSHKELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEA*MC*TNSSLEILSIQGCHSLTYIAGVQLPPSLKRLEIDFCDNLRTL*************SSSRSIWTCENLKF**S**HNLRQLQEIEIWECENLVSFPQGGLPCAKLSMLTVYGCERLKALPKGLHNLTNLHSLEIHGNTKIWKSMI*****FHRFSSLRELKISRCDDDMVSFPPEDIRLGTTLPLPASLTSLEIGYFPNLERLSSSIVDLQNLTSLFLYHCPKLKYFPEKGLPSSLLELIIYRCPLIAEKCGKDGGQYWDLLTHIPHVAIDGKSIFGD*****

QRCRIIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSEDLGRDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQCFSRNLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLTNSRPGFLAPSILPKLLKPQRLRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGKLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAMEAQMDGKKNLKELSLKW*************TEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFCGNDPPCLETLRFENMREWEDWIPHGSGQRVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKLHIGGCKKVVWRRPLKLRLPKLEELEIENMKEQTYIWKSHKELLQDICSLKRLTIDSCPKLQSLV*********QLCELSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEAWMCGTNSSLEILSIQGCHSLTYIAGVQLPPSLKRLEIDFCDNLRTLTVE***************IWTCENLKFLPSGLHNLRQLQEIEIWECENLVSFPQGGLPCAKLSMLTVYGCERLKALPKGLHNLTNLHSLEIHGNTKIWKSMIEWGRGFHRFSSLRELKISRCDDDMVSFPPEDIRLGTTLPLPASLTSLEIGYFPNLERLSSSIVDLQNLTSLFLYHCPKLKYFPEKGLPSSLLELIIYRCPLIAEKCGKDGGQYWDLLTHIPHVAIDGKSIFGDKYSRE

**CRIIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSEDLGRDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQCFSRNLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLTNSRPGFLAPSILPKLLKPQRLRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGKLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAMEAQMDGKKNLKELSLKWTCSTDGSSSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFCGNDPPCLETLRFENMREWEDWIPHGSGQRVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKLHIGGCKKVVWRRPLKLRLPKLEELEIENMKEQTYIWKSHKELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEIYKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEAWMCGTNSSLEILSIQGCHSLTYIAGVQLPPSLKRLEIDFCDNLRTLTVEEGIQSSSSSSSSSRSIWTCENLKFLPSGLHNLRQLQEIEIWECENLVSFPQGGLPCAKLSMLTVYGCERLKALPKGLHNLTNLHSLEIHGNTKIWKSMIEWGRGFHRFSSLRELKISRCDDDMVSFPPEDIRLGTTLPLPASLTSLEIGYFPNLERLSSSIVDLQNLTSLFLYHCPKLKYFPEKGLPSSLLELIIYRCPLIAEKCGKDGGQYWDLLTHIPHVAIDGKSIFGDK****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		943	2.2.26 [Sep-21-2011]
Q9LRR4		1054	Putative disease resistan	yes	no	0.611	0.547	0.370	2e-96
Q9LRR5		1424	Putative disease resistan	no	no	0.509	0.337	0.405	6e-88
Q7XBQ9		970	Disease resistance protei	N/A	no	0.581	0.564	0.333	9e-67
Q7XA42		979	Putative disease resistan	N/A	no	0.572	0.551	0.318	6e-64
Q7XA39		988	Putative disease resistan	N/A	no	0.599	0.571	0.315	8e-62
Q7XA40		992	Putative disease resistan	N/A	no	0.607	0.577	0.315	8e-61
O81825		919	Probable disease resistan	no	no	0.254	0.261	0.256	7e-16
Q38834		852	Disease resistance RPP13-	no	no	0.365	0.404	0.269	2e-15
Q9STE7		847	Putative disease resistan	no	no	0.289	0.322	0.274	2e-15
Q9LVT4		843	Probable disease resistan	no	no	0.325	0.364	0.26	8e-15

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function desciption

 Score =  354 bits (909), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 228/615 (37%), Positives = 335/615 (54%), Gaps = 38/615 (6%)

Query: 2    RCRIIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSE 61
            +  ++P L VSYYYLP  LK+CFA+CS+ PK + FE+++++LLW A GFL         E
Sbjct: 408  KSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLE 467

Query: 62   DLGRDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQCFS 121
            +LG ++F EL SRS  Q++ T    ++MHD IN+LA++A+GE  F+ ++      Q   S
Sbjct: 468  ELGNEYFSELESRSLLQKTKTR---YIMHDFINELAQFASGE--FSSKFEDGCKLQ--VS 520

Query: 122  RNLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLTNSRPG-----FLAPSILPKLLKP 176
               R+LSY+R +Y     F  L +++ LRTFLP+ LTNS         ++  +LP L   
Sbjct: 521  ERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTL--- 577

Query: 177  QRLRAFSLRGYYIFEL-PDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDR 235
             RLR  SL  Y I  L PD   ++ + R+L+L  T++  LP+S+  +YNL +LLL  C  
Sbjct: 578  TRLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSS 637

Query: 236  LKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGKLTSLQTLCNFVVGKGSGSGLRELKLL 295
            LK+L  D+ NL  L +L    TK L +MP   G+L SLQTL  F V    GS + EL  L
Sbjct: 638  LKELPTDISNLINLRYLDLIGTK-LRQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGL 696

Query: 296  THLHGTLNISKLENVKCVGDAMEAQMDGKKNLKELSLKW----TCSTDGSSSREAETEMG 351
              LHG L I +L+ V  V DA EA ++ KK+L+E+   W    + S + ++    + E  
Sbjct: 697  HDLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAE 756

Query: 352  VLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLK 411
            V + L+PH ++E+  I+ Y G +FP WL D  FS +V +   +C  CT+LPS+GQLP LK
Sbjct: 757  VFEKLRPHRHIEKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLK 816

Query: 412  HLTVRGMSRVKRLGSEFCGNDPP----------CLETLRFENMREWEDWIPHGSGQRVEG 461
             L + GM  ++ +G +F  +D             LETLRF+N+ +W++W+      R + 
Sbjct: 817  ELHISGMVGLQSIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWL-DVRVTRGDL 875

Query: 462  FPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVS----SLPALCKLHIGGCK 517
            FP L++L ILRC +L GT P  LP+L  L I  C  L         S   L  L I    
Sbjct: 876  FPSLKKLFILRCPELTGTLPTFLPSLISLHIYKCGLLDFQPDHHEYSYRNLQTLSIKSSC 935

Query: 518  KVVWRRPLKLRLPKLEELEIENMKEQTYIWKSHKELLQDICSLKRLTIDSCPKLQSLVAE 577
              + + PL      L++LE++      Y  +   E L+   +L+ L I+ C  LQ L   
Sbjct: 936  DTLVKFPLN-HFANLDKLEVDQCT-SLYSLELSNEHLRGPNALRNLRINDCQNLQLLPKL 993

Query: 578  EEKDQQQQLCELSCR 592
                Q  Q+   +CR
Sbjct: 994  NALPQNLQVTITNCR 1008

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|O81825\|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1	Back alignment and function description

>sp\|Q38834\|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2	Back alignment and function description

>sp\|Q9STE7\|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1	Back alignment and function description

>sp\|Q9LVT4\|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		943
400131587		1388	FB_MR5 [Malus x robusta]	0.942	0.640	0.432	0.0
284026888		1424	CC-NBS-LRR protein [Quercus suber]	0.965	0.639	0.404	1e-178
356554923		1399	PREDICTED: putative disease resistance R	0.962	0.649	0.393	1e-169
225450023		1396	PREDICTED: putative disease resistance p	0.967	0.653	0.394	1e-169
451798992		1440	disease resistance protein At3g14460-lik	0.962	0.630	0.390	1e-167
359487416		1472	PREDICTED: putative disease resistance p	0.959	0.614	0.391	1e-167
147825318		1824	hypothetical protein VITISV_003723 [Viti	0.910	0.470	0.401	1e-166
147766392		1471	hypothetical protein VITISV_007674 [Viti	0.965	0.618	0.391	1e-164
225450019		1394	PREDICTED: putative disease resistance p	0.966	0.653	0.393	1e-164
359487424		1453	PREDICTED: putative disease resistance R	0.965	0.626	0.383	1e-163

>gi\|400131587\|emb\|CCH50986.1\| FB_MR5 [Malus x robusta]	Back alignment and taxonomy information

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1025 (43%), Positives = 589/1025 (57%), Gaps = 136/1025 (13%)

Query: 5    IIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGF-LDHKEDENPSEDL 63
            I+P L ++Y+YLP  LK+CFA+CS+LP DYEFEE+++ILLW A GF L   ED+   EDL
Sbjct: 406  ILPVLRLTYFYLPSHLKRCFAYCSILPNDYEFEEKQMILLWMAEGFILPRPEDKKQIEDL 465

Query: 64   GRDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQ--CFS 121
            G D+F++L SRS FQ+S    S +VMHDLI DLARWAAGE  F LE     + +Q  CF 
Sbjct: 466  GADYFRDLVSRSLFQKSTKCISKYVMHDLIGDLARWAAGEICFRLEDKQNDDGEQLRCFP 525

Query: 122  RNLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVM---LTNSRPGFLAPSILPKLLKPQR 178
            +  RH SYIRG  DGV+RF    ++++LRTFLP+      N     +A  +LPKL   Q 
Sbjct: 526  KA-RHSSYIRGLSDGVKRFEVFSELKYLRTFLPLRKDSFWNYLSRQVAFDLLPKL---QY 581

Query: 179  LRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKK 238
            LR  S   Y I ELPDS+GDLRYLRYL+L  T I +LP+S + LYNL +L+LE C +LK 
Sbjct: 582  LRVLSFNCYKITELPDSIGDLRYLRYLDLSYTDITSLPKSTSTLYNLQTLILEGCSKLKA 641

Query: 239  LCADMGNLAKLHHLKNSNTKSLEEMPVGIGKLTSLQTLCNFVVG---KGSGSGLRELKLL 295
            L  DM NL  L HL NSN   LE+MP  +G+L +LQ+L  FVV     G  SG+REL+ L
Sbjct: 642  LPIDMSNLVNLRHLNNSNVSLLEDMPPQLGRLVNLQSLTKFVVSGGGGGDRSGIRELEFL 701

Query: 296  THLHGTLNISKLENVKCVGDAMEAQMDGKKNLKELSLKWTCSTDGSSSREAETEMGVLDM 355
             HL GTL IS+LENV  V DA  A ++ K+ L  L L+W+ S+D       ETE  VLDM
Sbjct: 702  MHLRGTLCISRLENVTDVEDAQRANLNCKERLDSLVLEWSHSSDTR-----ETESAVLDM 756

Query: 356  LKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTV 415
            L+PHT L++  IK Y G +F +W+G  LFSN+V +  E+C  C +LP +G+LP LK L +
Sbjct: 757  LQPHTKLKELTIKSYAGKEFSSWVGVPLFSNMVLVRLEECNNCLSLPPLGKLPHLKELYI 816

Query: 416  RGMSRVKRLGSEF---CGNDPPCLETLRFENMREWEDWIPHGSGQRVEGFPKLRELHILR 472
            RGM+ V+ +G+EF   C    P LETL F +M+ W+ W+P  +  R   FP L+ L + +
Sbjct: 817  RGMNAVESVGAEFYGECSLPFPLLETLEFVDMQHWKVWLPFQTDHRGSVFPCLKTLLVRK 876

Query: 473  CSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKLHIGGCKKVVWRRPLKLRLPKL 532
            CSKL+G  PE+L +L  L I  CEELLVS+++   L +L+I GCK VV     K+    L
Sbjct: 877  CSKLEGKLPENLDSLASLEIVKCEELLVSIANYKQLRQLNIDGCKGVV-HTAAKVEFELL 935

Query: 533  EELEIENMKEQTYI---------------------------WKSHKELLQDICSLKRLTI 565
            E L + N+ E T +                            K+   LLQ + SL RL I
Sbjct: 936  ESLYLSNISELTSLQTGELCRNGLNMVRDLKINGCEELTSSLKNEAILLQQLISLGRLEI 995

Query: 566  DSCPKLQSLVAEE---EKDQQQQLCELSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEI 622
            +      SL+ EE   E D+  QL  L C+LE+L L  C+ L+KLP+    L+SL+E+ I
Sbjct: 996  ED----NSLLVEELGKEADELLQLQILGCKLEFLKLKKCKNLLKLPEGLNQLSSLQELRI 1051

Query: 623  YKCSSLVSFPEVALPSKLKKIEIRECDALKSLPEAWMCGTNSSLEILSIQGCHSLTYIAG 682
            ++CSSLVSFP+V LP  LK IEI E                          CHSL Y A 
Sbjct: 1052 HECSSLVSFPDVGLPPSLKDIEITE--------------------------CHSLIYFAK 1085

Query: 683  VQLPPSLKRLEIDFCDNLRTLTVEEGIQSSSSSSSS------------------------ 718
             Q+P +L+R++I  C +LR+L   E + S SSSS +                        
Sbjct: 1086 SQIPQNLRRIQIRDCRSLRSLVDNEAVGSCSSSSHNCLEYLNIERCQSLTLLSLSDQLVR 1145

Query: 719  ---SRSIWTCENLKFL-PSGL--HNLRQ-LQEIEIWECENLVSFPQ--GGLPCAKLSMLT 769
                  I+ CE L+FL P GL  +N    L+   I  C+NL S P+  GG+  + L  + 
Sbjct: 1146 ALRELDIYDCEQLEFLAPDGLFCNNTNYFLENFRIRRCQNLKSLPRLSGGIRGSNLREIR 1205

Query: 770  VYGCERLKALPKGLHNLTNLHSLEIH-------------GNTKIW-----KSMIEWGRGF 811
            +  C+RL+ALP+ +HN  +L  L I               +  IW     KS+ E   G 
Sbjct: 1206 ITDCDRLEALPEDMHNFNSLEKLIIDYREGLTCSFPANLTSLMIWKVKSCKSLWELEWGL 1265

Query: 812  HRFSSLRELKISRCDDDMVSFPPEDIRLGTTLPLPASLTSLEIGYFPNLERLSSSIVD-L 870
            HR +SLR L I   D DMVSFPP+ +R+ T   LP SLT L IG FPNL++LSS     L
Sbjct: 1266 HRLTSLRYLWIGGEDPDMVSFPPDMVRMETL--LPKSLTELSIGGFPNLKKLSSKGFQFL 1323

Query: 871  QNLTSLFLYHCPKLKYFPEKGLPSSLLELIIYRCPLIAEKCGKDGGQYWDLLTHIPHVAI 930
             +L SL L+ CPKL   P++GLP SL EL IY CP++ E+C    G+YW  ++HIP++ I
Sbjct: 1324 TSLESLELWDCPKLASIPKEGLPLSLTELCIYGCPVLKERCQPGKGRYWHKISHIPYIDI 1383

Query: 931  DGKSI 935
            D K I
Sbjct: 1384 DWKMI 1388

Source: Malus x robusta

Species: Malus x robusta

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|284026888\|gb\|ADB66335.1\| CC-NBS-LRR protein [Quercus suber]	Back alignment and taxonomy information

>gi\|356554923\|ref\|XP_003545790.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|225450023\|ref\|XP_002272823.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi\|451798994\|gb\|AGF69195.1\| disease resistance protein At3g14460-like protein 2 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|451798992\|gb\|AGF69194.1\| disease resistance protein At3g14460-like protein 1 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|359487416\|ref\|XP_002272889.2\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147825318\|emb\|CAN73260.1\| hypothetical protein VITISV_003723 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147766392\|emb\|CAN67818.1\| hypothetical protein VITISV_007674 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450019\|ref\|XP_002272632.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] gi\|451798996\|gb\|AGF69196.1\| disease resistance protein At3g14460-like protein 3 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|359487424\|ref\|XP_002271822.2\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		943
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.518	0.343	0.409	8.9e-113
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.514	0.460	0.405	2e-98
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.483	0.253	0.282	5.4e-36
TAIR\|locus:504956186		1138	AT1G58602 [Arabidopsis thalian	0.414	0.343	0.256	2.4e-19
TAIR\|locus:2131689		919	AT4G27220 [Arabidopsis thalian	0.277	0.285	0.283	4.2e-17
TAIR\|locus:2031366		898	AT1G63350 "AT1G63350" [Arabido	0.251	0.263	0.283	5.8e-17
TAIR\|locus:2078012		852	ZAR1 "HOPZ-ACTIVATED RESISTANC	0.365	0.404	0.277	6e-16
TAIR\|locus:2201986		885	RFL1 "AT1G12210" [Arabidopsis	0.386	0.411	0.249	1.5e-15
TAIR\|locus:504956184		1017	AT1G58807 "AT1G58807" [Arabido	0.327	0.303	0.247	1.9e-15
TAIR\|locus:2827038		1017	AT1G59124 "AT1G59124" [Arabido	0.327	0.303	0.247	1.9e-15

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 849 (303.9 bits), Expect = 8.9e-113, Sum P(3) = 8.9e-113
 Identities = 209/511 (40%), Positives = 282/511 (55%)

Query:     5 IIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSEDLG 64
             I+P L +SY  LPP LK+CFA CS+ PK + F+ EE++LLW A   L         ED+G
Sbjct:   403 ILPVLKLSYDSLPPQLKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIG 462

Query:    65 RDFFKELCSRSFFQQSATDASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQCFSRNL 124
              D+  +L ++SFFQ+     + FVMHDL+NDLA+  +G+  F LE   + N  +  S   
Sbjct:   463 NDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRLE---DDNIPEIPSTT- 518

Query:   125 RHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLTNSRPGF-LAPSILPKLLKP-QRLRAF 182
             RH S+ R   D    F  +   + LRT LP     S     L   +L  LL     LR  
Sbjct:   519 RHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRIL 578

Query:   183 SLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCAD 242
             SL  Y I  LP S+  L+ LRYL+L  TKI+ LPE V  L NL +LLL +C  L  L   
Sbjct:   579 SLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKS 638

Query:   243 MGNLAKLHHLKNSNTKSLEEMPVGIGKLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTL 302
             +  L  L  L    T  L EMP GI KL SLQ L NFV+G+ SG+GL ELK L+HL GTL
Sbjct:   639 IAELINLRLLDLVGTP-LVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTL 697

Query:   303 NISKLENVKCVGDAMEAQMDGKKNLKELSLKWTCS----TDGSSSREAETEMGVLDMLKP 358
              IS+L+NV    +A +A +  K  L  L LKWT        GS +  A  +  VL ML+P
Sbjct:   698 RISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEP 757

Query:   359 HTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTALPSVGQLPSLKHLTVRGM 418
             H +L+ FCI+ Y G  FP WLGDS F  + ++    C +C +LP VGQLPSLK+L++   
Sbjct:   758 HPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKF 817

Query:   419 SRVKRLGSEFC-GND-----P-PCLETLRFENMREWEDWIPHGSGQRVEG-FPKLRELHI 470
             + ++++G +F  G +     P   L+ L+F  M  W++WI     +  +G FP L++L I
Sbjct:   818 NILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWI---CPELEDGIFPCLQKLII 874

Query:   471 LRCSKLKGTFPEHLPALEMLVIEGCEELLVS 501
              RC  L+  FPE LP+   + I  C    VS
Sbjct:   875 QRCPSLRKKFPEGLPSSTEVTISDCPLRAVS 905

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00028724001	SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (1188 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		943
PLN03210		1153	PLN03210, PLN03210, Resistant to P	7e-11
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-07
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-07
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	6e-07
PLN03210		1153	PLN03210, PLN03210, Resistant to P	9e-07
PLN03210		1153	PLN03210, PLN03210, Resistant to P	6e-05
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	2e-04
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	5e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.004

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score = 66.1 bits (161), Expect = 7e-11
 Identities = 60/211 (28%), Positives = 95/211 (45%), Gaps = 24/211 (11%)

Query: 589 LSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEIYKCSSLVSFPEVALPSKLKKIEIREC 648
           ++  LE L LS C  LV+LP S   LN L ++++ +C +L   P       L ++ +  C
Sbjct: 655 MATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGC 714

Query: 649 DALKSLPEAWMCGTNSSLEILSIQGCHSLTYIAGVQLPPSLKRLE----IDFCDNLRTLT 704
             LKS P+     TN S   L                 PS  RLE    +  C+ +++  
Sbjct: 715 SRLKSFPD---ISTNISWLDLDETAIEEF---------PSNLRLENLDELILCE-MKSEK 761

Query: 705 VEEGIQSSS------SSSSSSRSIWTCENLKFLPSGLHNLRQLQEIEIWECENLVSFPQG 758
           + E +Q  +      S S +   +    +L  LPS + NL +L+ +EI  C NL + P  
Sbjct: 762 LWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPT- 820

Query: 759 GLPCAKLSMLTVYGCERLKALPKGLHNLTNL 789
           G+    L  L + GC RL+  P    N+++L
Sbjct: 821 GINLESLESLDLSGCSRLRTFPDISTNISDL 851

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		943
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.95
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.94
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.93
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.93
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.93
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.92
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.91
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.89
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.87
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.71
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.66
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.58
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.57
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.52
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.49
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.47
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.37
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.3
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.26
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.22
KOG4341		483	consensus F-box protein containing LRR [General fu	98.93
KOG4341		483	consensus F-box protein containing LRR [General fu	98.85
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.81
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.78
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.67
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.67
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.67
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.65
PRK15386		426	type III secretion protein GogB; Provisional	98.65
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.56
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.56
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.54
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.48
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.43
PRK15386		426	type III secretion protein GogB; Provisional	98.36
PLN03150		623	hypothetical protein; Provisional	98.35
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.26
PLN03150		623	hypothetical protein; Provisional	98.2
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.19
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.18
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.12
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.08
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.06
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.98
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.97
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.85
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.83
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.82
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.67
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.6
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.33
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.32
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.19
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.19
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.16
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.13
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.06
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.66
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.5
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.36
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.3
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.22
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.84
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.3
KOG0473		326	consensus Leucine-rich repeat protein [Function un	95.03
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	94.95
KOG0473		326	consensus Leucine-rich repeat protein [Function un	94.87
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.35
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	94.3
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.84
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	93.75
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.11
smart00370		26	LRR Leucine-rich repeats, outliers.	92.43
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	92.43
KOG3864		221	consensus Uncharacterized conserved protein [Funct	88.04
KOG3864		221	consensus Uncharacterized conserved protein [Funct	86.87
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	84.08
smart00370		26	LRR Leucine-rich repeats, outliers.	84.08

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=1.2e-45  Score=427.52  Aligned_cols=249  Identities=30%  Similarity=0.476  Sum_probs=209.1

Q ss_pred             CCCcchhhhhcccCCCcchhhhhhhhccCCCCceeChhhHHHHHHHcCCccCCCCCCcHHHHHHHHHHHHHhCCcccccc
Q 048004            2 RCRIIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSEDLGRDFFKELCSRSFFQQSA   81 (943)
Q Consensus         2 ~~~i~~~L~lSY~~L~~~lk~cfl~cslfpe~~~i~~~~Li~~wiaeG~i~~~~~~~~~~~~~~~~~~~L~~~~ll~~~~   81 (943)
                      ++.|+++|++|||+||.++|.||+|||+|||||+|++++||.|||||||+++..++++++++|++|+++||+|||++..+
T Consensus       394 ~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~  473 (889)
T KOG4658|consen  394 EESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEER  473 (889)
T ss_pred             hhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcc
Confidence            46799999999999998899999999999999999999999999999999987778999999999999999999999865


Q ss_pred             --CCCCceehhhHHHHHHHHhcc-----cceEEEeecccc--ccccccCCceeEEEEEccCcccccccccccCCCCccee
Q 048004           82 --TDASLFVMHDLINDLARWAAG-----ETYFTLEYTSEV--NKQQCFSRNLRHLSYIRGDYDGVQRFGDLYDIQHLRTF  152 (943)
Q Consensus        82 --~~~~~~~mHdlv~dla~~i~~-----~~~~~~~~~~~~--~~~~~~~~~~r~ls~~~~~~~~~~~~~~~~~~~~Lr~L  152 (943)
                        +...+|+|||+|||||.|+|+     ++...+......  ......+..+|+++........   ......+++|++|
T Consensus       474 ~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~---~~~~~~~~~L~tL  550 (889)
T KOG4658|consen  474 DEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEH---IAGSSENPKLRTL  550 (889)
T ss_pred             cccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhh---ccCCCCCCccceE
Confidence              456899999999999999999     565554432111  1122344678999998775543   3445567789999


Q ss_pred             eeecccCCCCCCCCCCcccccc-CCCcccEEEecCcc-ccccCccccCCCcccEEecCCCCCcccchhHhhcccCcEEec
Q 048004          153 LPVMLTNSRPGFLAPSILPKLL-KPQRLRAFSLRGYY-IFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLL  230 (943)
Q Consensus       153 ~~~~~~~~~~~~~~~~~~~~~~-~l~~L~~L~L~~~~-i~~lp~~~~~L~~L~~L~L~~n~i~~lp~~i~~L~~L~~L~L  230 (943)
                      .+.....     ....++..+| .|+.||||||++|. +..+|++|+.|.+||||+|+++.|+.+|..+++|++|.+||+
T Consensus       551 ll~~n~~-----~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl  625 (889)
T KOG4658|consen  551 LLQRNSD-----WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNL  625 (889)
T ss_pred             EEeecch-----hhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheecc
Confidence            8877531     1345666777 89999999999887 799999999999999999999999999999999999999999


Q ss_pred             CCCcchhhchHhhcccccccccccCCCC
Q 048004          231 EDCDRLKKLCADMGNLAKLHHLKNSNTK  258 (943)
Q Consensus       231 ~~~~~l~~lp~~~~~L~~L~~L~l~~~~  258 (943)
                      ..+..+..+|..+..|++||+|.+....
T Consensus       626 ~~~~~l~~~~~i~~~L~~Lr~L~l~~s~  653 (889)
T KOG4658|consen  626 EVTGRLESIPGILLELQSLRVLRLPRSA  653 (889)
T ss_pred             ccccccccccchhhhcccccEEEeeccc
Confidence            9977777777777779999999987654

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		943
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		1e-06

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 64/254 (25%), Positives = 113/254 (44%), Gaps = 41/254 (16%) Query: 548 KSHKELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLTLSGCQGLVKL 607 K+ +LL+D R+ ++ L+S+ + DQ +L L ++ T+ GL +L Sbjct: 69 KATADLLEDATQPGRVALE----LRSVPLPQFPDQAFRLSHL----QHXTIDAA-GLXEL 119 Query: 608 PQSSLSLNSLREIEIYKCSSLVSFP-EVALPSKLKKIEIRECDALKSLPEAWMCGTNSSL 666 P + L + + + + L + P +A ++L+++ IR C L LPE + T++S Sbjct: 120 PDTXQQFAGLETLTLAR-NPLRALPASIASLNRLRELSIRACPELTELPEP-LASTDASG 177 Query: 667 EILSIQGCHSLT--YIAGVQLPPSLKRLEIDFCDNLRTLTVEEGIQXXXXXXXXXXXIWT 724 E + SL + LP S+ L+ NL++L + Sbjct: 178 EHQGLVNLQSLRLEWTGIRSLPASIANLQ-----NLKSLKIRNS---------------- 216 Query: 725 CENLKFLPSGLHNLRQLQEIEIWECENLVSFPQ--GGLPCAKLSMLTVYGCERLKALPKG 782 L L +H+L +L+E+++ C L ++P GG A L L + C L LP Sbjct: 217 --PLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR--APLKRLILKDCSNLLTLPLD 272 Query: 783 LHNLTNLHSLEIHG 796 +H LT L L++ G Sbjct: 273 IHRLTQLEKLDLRG 286

PyMOL of 4fcg

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		943
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	1e-30
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-24
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-11
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-04
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	2e-22
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	7e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-05
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-05
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-12
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	8e-08
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	5e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-10
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-09
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-09
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-09
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-06
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	8e-08
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	7e-08
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	7e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	6e-07
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	7e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	5e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	7e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	9e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	4e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-04
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	6e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	8e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	8e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	9e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  127 bits (320), Expect = 1e-30
 Identities = 32/223 (14%), Positives = 72/223 (32%), Gaps = 36/223 (16%)

Query: 5   IIPALAVSYYYLPPTLKQCFAHCSLLPKDYEFEEEEIILLWCAAGFLDHKEDENPSEDLG 64
           +  A+++S   L   +K  +   S+L KD +   + + +LW                +  
Sbjct: 364 LDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDM------------ETEEV 411

Query: 65  RDFFKELCSRSFFQQSATD-ASLFVMHDLINDLARWAAGETYFTLEYTSEVNKQQCFSRN 123
            D  +E  ++S         +  + +HDL  D       +    L+       ++  ++ 
Sbjct: 412 EDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLT---EKNCSQLQD----LHKKIITQF 464

Query: 124 LRHLSYIRGDYDGVQRFGDLYDIQHLR---------TFLPVMLTNSRPGFLAPSILPKLL 174
            R+        D       +Y    L            L  ++ +    ++      +L+
Sbjct: 465 QRYHQPHTLSPDQ---EDCMYWYNFLAYHMASAKMHKELCALMFSLD--WIKAKT--ELV 517

Query: 175 KPQRLRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPE 217
            P  L    +   +I +  D      +  +L+L G  +   P 
Sbjct: 518 GPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPF 560

PyMOL of 1z6t

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		943
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.98
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.97
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.97
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.97
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.96
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.96
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.95
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.95
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.95
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.94
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.94
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.93
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.92
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.92
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.91
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.91
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.91
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.91
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.9
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.88
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.87
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.87
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.87
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.87
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.86
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.86
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.85
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.85
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.83
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.83
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.82
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.82
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.81
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.8
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.8
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.8
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.79
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.79
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.78
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.78
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.78
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.77
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.77
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.77
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.77
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.77
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.76
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.75
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.75
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.74
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.73
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.7
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.7
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.7
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.69
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.69
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.67
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.67
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.66
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.65
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.64
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.63
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.63
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.62
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.6
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.6
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.59
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.59
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.56
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.54
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.54
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.53
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.53
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.52
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.51
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.48
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.48
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.46
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.4
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.4
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.39
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.39
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.38
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.38
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.38
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.38
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.38
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.38
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.36
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.36
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.34
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.33
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.32
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.32
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.31
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.29
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.25
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.23
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.23
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.22
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.22
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.21
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.21
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.19
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.18
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.16
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.15
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.13
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.12
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.12
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.12
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.03
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.99
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.99
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.98
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.97
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.97
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.96
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.96
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.92
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.89
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.87
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	98.86
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.79
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.7
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.66
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	98.54
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.52
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.39
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.3
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.3
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.28
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.23
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.18
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.16
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.03
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.02
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.96
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.8
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.64
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.5
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.45
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.3
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.88
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	92.99
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	92.43

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=1.3e-51  Score=495.93  Aligned_cols=636  Identities=15%  Similarity=0.051  Sum_probs=343.3

Q ss_pred             ccccccCCCcccEEEecCccccccCccccCCCcccEEecCCCCCc-ccch--hHhhcccCcEEecCCCcchhhchHhh-c
Q 048004          169 ILPKLLKPQRLRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIR-TLPE--SVNKLYNLHSLLLEDCDRLKKLCADM-G  244 (943)
Q Consensus       169 ~~~~~~~l~~L~~L~L~~~~i~~lp~~~~~L~~L~~L~L~~n~i~-~lp~--~i~~L~~L~~L~L~~~~~l~~lp~~~-~  244 (943)
                      +++.+.+++.|+.++++.+.+..+|+.|+++++|++|+|++|.++ .+|.  .++++++|++|++++|......|..+ +
T Consensus        69 l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~  148 (768)
T 3rgz_A           69 VSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGL  148 (768)
T ss_dssp             HHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCC
T ss_pred             cChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhc
Confidence            444455666777777776666666666777777777777777665 4555  66677777777777655444555444 5


Q ss_pred             ccccccccccCCCCccccCCcc---cCCccccccccceeeccCCCCCchhhhcccccCCeeeeccccccCCcccchhhhc
Q 048004          245 NLAKLHHLKNSNTKSLEEMPVG---IGKLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKCVGDAMEAQM  321 (943)
Q Consensus       245 ~L~~L~~L~l~~~~~~~~~p~~---i~~L~~L~~L~~~~~~~~~~~~l~~l~~L~~L~~~l~~~~l~~~~~~~~~~~~~l  321 (943)
                      ++++|++|++++|......|..   ++++++|++|                                             
T Consensus       149 ~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L---------------------------------------------  183 (768)
T 3rgz_A          149 KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHL---------------------------------------------  183 (768)
T ss_dssp             CCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEE---------------------------------------------
T ss_pred             cCCCCCEEECCCCccCCcCChhhhhhccCCCCCEE---------------------------------------------
Confidence            6667777777666632333333   4455555555                                             


Q ss_pred             CCCCCCCeEEEEeecCCCCCCCcchhcHHhhhccCCCCCCcceEEEeccCCCCCCcCcCCCCCCCccEEEEecCCCCCCC
Q 048004          322 DGKKNLKELSLKWTCSTDGSSSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCTAL  401 (943)
Q Consensus       322 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~~~~L~~L~l~~~~~~~~p~~~~~~~l~~L~~L~L~~~~~~~~l  401 (943)
                               ++++|.....             .....+++|+.|++.++.....+..+..  +++|++|++++|.+.+.+
T Consensus       184 ---------~Ls~n~l~~~-------------~~~~~l~~L~~L~Ls~n~l~~~~~~l~~--l~~L~~L~Ls~n~l~~~~  239 (768)
T 3rgz_A          184 ---------AISGNKISGD-------------VDVSRCVNLEFLDVSSNNFSTGIPFLGD--CSALQHLDISGNKLSGDF  239 (768)
T ss_dssp             ---------ECCSSEEESC-------------CBCTTCTTCCEEECCSSCCCSCCCBCTT--CCSCCEEECCSSCCCSCH
T ss_pred             ---------ECCCCccccc-------------CCcccCCcCCEEECcCCcCCCCCccccc--CCCCCEEECcCCcCCCcc
Confidence                     3332211000             0001223333333333333332222332  566666666666665555


Q ss_pred             C-CCCCCCCCCeeEEccccCeeEeCccccCCCCCccceeecccccccccccccCCcccccCCCcccEEecccCcccccCC
Q 048004          402 P-SVGQLPSLKHLTVRGMSRVKRLGSEFCGNDPPCLETLRFENMREWEDWIPHGSGQRVEGFPKLRELHILRCSKLKGTF  480 (943)
Q Consensus       402 ~-~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~  480 (943)
                      | .++.+++|++|++++|.....++..    .+++|++|++.++.-. ...+...   ...+++|++|++++| .+++.+
T Consensus       240 ~~~l~~l~~L~~L~Ls~n~l~~~~~~~----~l~~L~~L~L~~n~l~-~~ip~~~---~~~~~~L~~L~Ls~n-~l~~~~  310 (768)
T 3rgz_A          240 SRAISTCTELKLLNISSNQFVGPIPPL----PLKSLQYLSLAENKFT-GEIPDFL---SGACDTLTGLDLSGN-HFYGAV  310 (768)
T ss_dssp             HHHTTTCSSCCEEECCSSCCEESCCCC----CCTTCCEEECCSSEEE-ESCCCCS---CTTCTTCSEEECCSS-EEEECC
T ss_pred             cHHHhcCCCCCEEECCCCcccCccCcc----ccCCCCEEECcCCccC-CccCHHH---HhhcCcCCEEECcCC-cCCCcc
Confidence            5 5666666666666666433322211    2444444444443211 0011000   112355555555553 333344


Q ss_pred             CCCCCccceEEeccccCccccCCCCCcccEEEEcCCcCeeeecc-ccCCCCCccEEEEecccccchhhhhhhhhhhccC-
Q 048004          481 PEHLPALEMLVIEGCEELLVSVSSLPALCKLHIGGCKKVVWRRP-LKLRLPKLEELEIENMKEQTYIWKSHKELLQDIC-  558 (943)
Q Consensus       481 p~~l~~L~~L~l~~~~~l~~~~~~l~~L~~L~l~~~~~~~~~~~-~~~~l~~L~~L~l~~~~~~~~i~~~~~~~~~~l~-  558 (943)
                      |                  ..+..+++|++|++++|.+.+..+. .+..+++|++|++++|.....+    +..+..++ 
T Consensus       311 p------------------~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~----p~~l~~l~~  368 (768)
T 3rgz_A          311 P------------------PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGEL----PESLTNLSA  368 (768)
T ss_dssp             C------------------GGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECC----CTTHHHHTT
T ss_pred             c------------------hHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccc----cHHHHhhhc
Confidence            4                  2334445555555555554432222 2444555555555554433221    11122333 


Q ss_pred             CccEEeecCCCCcccchhhhhhHHhhhhhcccccccEEEeecCCCCCCCCccccCccccceEEeccCCCccccCC-ccCC
Q 048004          559 SLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLTLSGCQGLVKLPQSSLSLNSLREIEIYKCSSLVSFPE-VALP  637 (943)
Q Consensus       559 ~L~~L~l~~~~~L~~l~~~~~~~~~~~l~~~~~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~~~~l~~~~~-~~~~  637 (943)
                      +|+.|++++|.--..++.....       ...++|++|++++|...+.+|..+..+++|++|++++|...+.+|. +..+
T Consensus       369 ~L~~L~Ls~N~l~~~~~~~~~~-------~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l  441 (768)
T 3rgz_A          369 SLLTLDLSSNNFSGPILPNLCQ-------NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL  441 (768)
T ss_dssp             TCSEEECCSSEEEEECCTTTTC-------STTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGC
T ss_pred             CCcEEEccCCCcCCCcChhhhh-------cccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcC
Confidence            4555555544221111110000       0013455555555555445555555555555555555543333332 3445


Q ss_pred             CCccEEEeccCCCCcccccccccCCCCCCCeEEEeecCCCccccCc-cCCCCccEEEeccCCCccccccccccccCCCCC
Q 048004          638 SKLKKIEIRECDALKSLPEAWMCGTNSSLEILSIQGCHSLTYIAGV-QLPPSLKRLEIDFCDNLRTLTVEEGIQSSSSSS  716 (943)
Q Consensus       638 ~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~-~~~~~L~~L~l~~c~~L~~l~~~~~~~~~~~~~  716 (943)
                      ++|++|++++|...+.+|..+  ..+++|++|++++|...+.+|.. .-.++|+.|++++|.-...++    ...+.+++
T Consensus       442 ~~L~~L~L~~n~l~~~~p~~~--~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p----~~~~~l~~  515 (768)
T 3rgz_A          442 SKLRDLKLWLNMLEGEIPQEL--MYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIP----KWIGRLEN  515 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCGGG--GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCC----GGGGGCTT
T ss_pred             CCCCEEECCCCcccCcCCHHH--cCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCC----hHHhcCCC
Confidence            555555555555444444444  44555555555555543333321 112233333333332111111    00123445


Q ss_pred             CCeeeeeccCCcccccccCCCCCCcCeEeecCCCCceecCCCCCCCCCcce-----------------------------
Q 048004          717 SSSRSIWTCENLKFLPSGLHNLRQLQEIEIWECENLVSFPQGGLPCAKLSM-----------------------------  767 (943)
Q Consensus       717 L~~l~l~~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~-----------------------------  767 (943)
                      |+.|++++|.-...+|..+.++++|+.|++++|+..+.+|..++....+..                             
T Consensus       516 L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  595 (768)
T 3rgz_A          516 LAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLE  595 (768)
T ss_dssp             CCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEE
T ss_pred             CCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccc
Confidence            666666666555567777777788888888887777777765544333322                             


Q ss_pred             -----------------EeecccCCCCccccccCCCCccceEEecCCCchhhhhhhhccccCCCCCcCEEEEeecCCCce
Q 048004          768 -----------------LTVYGCERLKALPKGLHNLTNLHSLEIHGNTKIWKSMIEWGRGFHRFSSLRELKISRCDDDMV  830 (943)
Q Consensus       768 -----------------L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~l~~L~~L~ls~n~~~~~  830 (943)
                                       ++++.+...+.+|..+..+++|+.||+++|...    +.+|..++.+++|++|++++| ...+
T Consensus       596 ~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~----g~ip~~l~~l~~L~~L~Ls~N-~l~g  670 (768)
T 3rgz_A          596 FQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS----GYIPKEIGSMPYLFILNLGHN-DISG  670 (768)
T ss_dssp             CTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCB----SCCCGGGGGCTTCCEEECCSS-CCCS
T ss_pred             cccccchhhhccccccccccccceecccCchhhhccccccEEECcCCccc----ccCCHHHhccccCCEEeCcCC-ccCC
Confidence                             222234444556667788899999999999744    334556899999999999996 4455


Q ss_pred             ecCCCccccCCCCCCCCccceeeccCCCCCcccccccccCCCCCeEEEcCCCCCCCCCCCCCCcccceeeecCCcchh--
Q 048004          831 SFPPEDIRLGTTLPLPASLTSLEIGYFPNLERLSSSIVDLQNLTSLFLYHCPKLKYFPEKGLPSSLLELIIYRCPLIA--  908 (943)
Q Consensus       831 ~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~i~~c~~l~--  908 (943)
                      .+|...       ..+++|+.|++++|...+.+|..+..+++|+.|++++|+--..+|..+.+.++....+.|||.+.  
T Consensus       671 ~ip~~l-------~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~  743 (768)
T 3rgz_A          671 SIPDEV-------GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGY  743 (768)
T ss_dssp             CCCGGG-------GGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEEST
T ss_pred             CCChHH-------hCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCC
Confidence            788766       68899999999998877799999999999999999998877899998888888888899988542  


Q ss_pred             --hhhcCCCCCCCccccCcceEE
Q 048004          909 --EKCGKDGGQYWDLLTHIPHVA  929 (943)
Q Consensus       909 --~~~~~~~~~~~~~~~~~~~~~  929 (943)
                        ..|...++++|++++|++.+.
T Consensus       744 ~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          744 PLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             TSCCCCSCC--------------
T ss_pred             CCcCCCCCccCCCCCCCCccccC
Confidence              268999999999999998754

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		943
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	3e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	0.002
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.003

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 41.6 bits (96), Expect = 3e-04
 Identities = 36/236 (15%), Positives = 74/236 (31%), Gaps = 22/236 (9%)

Query: 192 LPDSVGDL--RYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCD-RLKKLCADMGNLAK 248
            PD  G L  + +       + +          + +  + L +    +  L   +   +K
Sbjct: 13  HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSK 72

Query: 249 LHHLKNSNTKSLEEMPVGIGKLTSLQTL----CNFVVGKGSGSGLRELKLLTHLHGTLNI 304
           L +L     +  + +   + K ++L  L    C+        + L     L  L+ +   
Sbjct: 73  LQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCF 132

Query: 305 SKLENVKCVGDAMEAQMDGKKNLKELSLKWTCSTDGSSSREAETEMGVLDMLKPHTNLEQ 364
              E    V  A  ++   + NL         S   +             +++   NL  
Sbjct: 133 DFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLST-------------LVRRCPNLVH 179

Query: 365 FCIKGYGGMKFPTWLGDSLFSNLVTLEFEDCGMCT--ALPSVGQLPSLKHLTVRGM 418
             +     +K   +      + L  L    C       L  +G++P+LK L V G+
Sbjct: 180 LDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI 235

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		943
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.83
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.77
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.76
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.75
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.72
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.72
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.64
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.64
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.62
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.61
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.61
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.56
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.42
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.41
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.4
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.39
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.39
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.38
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.35
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.34
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.31
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.3
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.29
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.22
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.21
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.2
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.18
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.14
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.13
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.13
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.89
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.8
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.72
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.69
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.67
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.61
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.76
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.64
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.84
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.81
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.62
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.98

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.83  E-value=2.4e-19  Score=195.35  Aligned_cols=85  Identities=16%  Similarity=0.315  Sum_probs=71.8

Q ss_pred             CCCcccEEEecCccccccCccccCCCcccEEecCCCCCcccchhHhhcccCcEEecCCCcchhhchHhhccccccccccc
Q 048004          175 KPQRLRAFSLRGYYIFELPDSVGDLRYLRYLNLCGTKIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKN  254 (943)
Q Consensus       175 ~l~~L~~L~L~~~~i~~lp~~~~~L~~L~~L~L~~n~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~~~~L~~L~~L~l  254 (943)
                      .+.+|++|+++++.|+.+ +.+..+++|++|+|++|+|+.+|. ++++++|++|++++| .+..++ .++++++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n-~i~~i~-~l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNN-QIADIT-PLANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSS-CCCCCG-GGTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccc-cccccc-ccccccccccccc
Confidence            557899999999999888 468889999999999999999974 899999999999996 455565 4899999999999


Q ss_pred             CCCCccccCC
Q 048004          255 SNTKSLEEMP  264 (943)
Q Consensus       255 ~~~~~~~~~p  264 (943)
                      +++. ...++
T Consensus       118 ~~~~-~~~~~  126 (384)
T d2omza2         118 FNNQ-ITDID  126 (384)
T ss_dssp             CSSC-CCCCG
T ss_pred             cccc-ccccc
Confidence            8887 55444

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure