Citrus Sinensis ID: 048025
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| 47524507 | 344 | putative cysteine protease [Gossypium hi | 0.955 | 0.683 | 0.567 | 5e-75 | |
| 255564910 | 341 | cysteine protease, putative [Ricinus com | 0.983 | 0.709 | 0.562 | 3e-74 | |
| 50355621 | 361 | cysteine protease [Daucus carota] | 0.987 | 0.673 | 0.544 | 4e-74 | |
| 224076968 | 305 | predicted protein [Populus trichocarpa] | 0.951 | 0.767 | 0.563 | 6e-74 | |
| 224076970 | 340 | predicted protein [Populus trichocarpa] | 0.951 | 0.688 | 0.563 | 1e-73 | |
| 224114698 | 305 | predicted protein [Populus trichocarpa] | 0.943 | 0.760 | 0.579 | 1e-73 | |
| 255563110 | 344 | cysteine protease, putative [Ricinus com | 0.991 | 0.709 | 0.554 | 2e-73 | |
| 255564908 | 342 | cysteine protease, putative [Ricinus com | 0.983 | 0.707 | 0.554 | 3e-73 | |
| 225443827 | 340 | PREDICTED: vignain-like [Vitis vinifera] | 0.987 | 0.714 | 0.564 | 3e-72 | |
| 225446581 | 341 | PREDICTED: vignain [Vitis vinifera] | 0.979 | 0.706 | 0.544 | 6e-72 |
| >gi|47524507|gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
Score = 286 bits (732), Expect = 5e-75, Method: Compositional matrix adjust.
Identities = 138/243 (56%), Positives = 180/243 (74%), Gaps = 8/243 (3%)
Query: 9 KHEQWMAQHGRTYKDELE--KAMRLNIFKQNLEYIGKANKEGNRTYKLGTNEFSDLTNEE 66
+HE+WM+QHGR Y DE E K R N+FK+N+E I + N +T+KL N+F+DLTNEE
Sbjct: 36 RHEEWMSQHGRVYADEQEDHKNKRFNVFKENVERIEEFND--GKTFKLAINQFADLTNEE 93
Query: 67 FRASYTGYNTPVPSLSRQSSLPSNFKYQNVTD-VPTSIDWREKGAVTHIKDQGQTGSSWA 125
FRASY G+ P+ LS Q + P+ F+Y+NV+ +P S+DWR+KGAVT +K+QGQ G WA
Sbjct: 94 FRASYNGFKGPM-VLSSQITKPTPFRYENVSSALPVSVDWRKKGAVTPVKNQGQCGCCWA 152
Query: 126 FSAVAAVEGITQITSRKLIELSGQQLVDCSTD--NHGCSGGLMDKAFEYIIENKGLASEA 183
FSAVAA+EGITQI++ KLI LS Q+LVDC T +HGC GGLMD AFE+II N GL +E+
Sbjct: 153 FSAVAAIEGITQISTGKLISLSEQELVDCDTKGIDHGCEGGLMDTAFEFIINNGGLTTES 212
Query: 184 DYPYRREQGTCDKQKEKAVAATISKYEDLPQGDEQALLQAVSKQPVSVCVEASGRAFHFY 243
+YPY+ E GTC+ K +A +I+ YED+P DEQAL++AV+ QPVSV +EA G F FY
Sbjct: 213 NYPYKGEDGTCNFNKTNPIAVSITGYEDVPANDEQALMKAVAHQPVSVAIEAGGSDFQFY 272
Query: 244 KSG 246
SG
Sbjct: 273 SSG 275
|
Source: Gossypium hirsutum Species: Gossypium hirsutum Genus: Gossypium Family: Malvaceae Order: Malvales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255564910|ref|XP_002523448.1| cysteine protease, putative [Ricinus communis] gi|223537276|gb|EEF38907.1| cysteine protease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|50355621|dbj|BAD29959.1| cysteine protease [Daucus carota] | Back alignment and taxonomy information |
|---|
| >gi|224076968|ref|XP_002305072.1| predicted protein [Populus trichocarpa] gi|222848036|gb|EEE85583.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224076970|ref|XP_002305073.1| predicted protein [Populus trichocarpa] gi|222848037|gb|EEE85584.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224114698|ref|XP_002316833.1| predicted protein [Populus trichocarpa] gi|222859898|gb|EEE97445.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255563110|ref|XP_002522559.1| cysteine protease, putative [Ricinus communis] gi|223538250|gb|EEF39859.1| cysteine protease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255564908|ref|XP_002523447.1| cysteine protease, putative [Ricinus communis] gi|223537275|gb|EEF38906.1| cysteine protease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225443827|ref|XP_002274223.1| PREDICTED: vignain-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225446581|ref|XP_002280246.1| PREDICTED: vignain [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| TAIR|locus:2122113 | 355 | XCP1 "xylem cysteine peptidase | 0.947 | 0.656 | 0.544 | 4.5e-66 | |
| TAIR|locus:2038588 | 348 | AT2G27420 [Arabidopsis thalian | 0.995 | 0.704 | 0.533 | 1.2e-65 | |
| TAIR|locus:2082881 | 341 | AT3G49340 [Arabidopsis thalian | 0.987 | 0.712 | 0.516 | 1.2e-63 | |
| TAIR|locus:2152445 | 346 | SAG12 "senescence-associated g | 0.963 | 0.684 | 0.533 | 5.4e-63 | |
| TAIR|locus:2029924 | 355 | AT1G29090 [Arabidopsis thalian | 0.983 | 0.681 | 0.496 | 9e-61 | |
| TAIR|locus:2030427 | 356 | XCP2 "xylem cysteine peptidase | 0.983 | 0.679 | 0.471 | 9e-61 | |
| TAIR|locus:2055440 | 345 | AT2G34080 [Arabidopsis thalian | 0.979 | 0.698 | 0.504 | 5.7e-59 | |
| TAIR|locus:2157712 | 361 | CEP1 "cysteine endopeptidase 1 | 0.983 | 0.670 | 0.479 | 1.1e-57 | |
| TAIR|locus:2825832 | 462 | RD21A "responsive to dehydrati | 0.975 | 0.519 | 0.461 | 1.2e-56 | |
| TAIR|locus:2167821 | 463 | RD21B "esponsive to dehydratio | 0.934 | 0.496 | 0.479 | 2.5e-56 |
| TAIR|locus:2122113 XCP1 "xylem cysteine peptidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 672 (241.6 bits), Expect = 4.5e-66, P = 4.5e-66
Identities = 129/237 (54%), Positives = 167/237 (70%)
Query: 11 EQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKEGNRTYKLGTNEFSDLTNEEFRAS 70
E WM++H + YK EK R +F++NL +I + N E N +Y LG NEF+DLT+EEF+
Sbjct: 52 ESWMSEHSKAYKSVEEKVHRFEVFRENLMHIDQRNNEIN-SYWLGLNEFADLTHEEFKGR 110
Query: 71 YTGYNTPVPSLSRQSSLPSNFKYQNVTDVPTSIDWREKGAVTHIKDQGQTGSSWAFSAVA 130
Y G P S RQ S +NF+Y+++TD+P S+DWR+KGAV +KDQGQ GS WAFS VA
Sbjct: 111 YLGLAKPQFSRKRQPS--ANFRYRDITDLPKSVDWRKKGAVAPVKDQGQCGSCWAFSTVA 168
Query: 131 AVEGITQITSRKLIELSGQQLVDCSTD-NHGCSGGLMDKAFEYIIENKGLASEADYPYRR 189
AVEGI QIT+ L LS Q+L+DC T N GC+GGLMD AF+YII GL E DYPY
Sbjct: 169 AVEGINQITTGNLSSLSEQELIDCDTTFNSGCNGGLMDYAFQYIISTGGLHKEDDYPYLM 228
Query: 190 EQGTCDKQKEKAVAATISKYEDLPQGDEQALLQAVSKQPVSVCVEASGRAFHFYKSG 246
E+G C +QKE TIS YED+P+ D+++L++A++ QPVSV +EASGR F FYK G
Sbjct: 229 EEGICQEQKEDVERVTISGYEDVPENDDESLVKALAHQPVSVAIEASGRDFQFYKGG 285
|
|
| TAIR|locus:2038588 AT2G27420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082881 AT3G49340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152445 SAG12 "senescence-associated gene 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2029924 AT1G29090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030427 XCP2 "xylem cysteine peptidase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2055440 AT2G34080 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157712 CEP1 "cysteine endopeptidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2825832 RD21A "responsive to dehydration 21A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167821 RD21B "esponsive to dehydration 21B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_IV000139 | hypothetical protein (305 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 6e-77 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 9e-64 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 1e-47 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 6e-46 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 3e-42 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 1e-38 | |
| smart00848 | 57 | smart00848, Inhibitor_I29, Cathepsin propeptide in | 3e-23 | |
| pfam08246 | 58 | pfam08246, Inhibitor_I29, Cathepsin propeptide inh | 7e-21 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 2e-15 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 6e-15 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 1e-10 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 2e-07 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 1e-04 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 3e-04 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 0.001 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
Score = 231 bits (591), Expect = 6e-77
Identities = 83/149 (55%), Positives = 102/149 (68%), Gaps = 1/149 (0%)
Query: 99 VPTSIDWREKGAVTHIKDQGQTGSSWAFSAVAAVEGITQITSRKLIELSGQQLVDCSTDN 158
+P S DWREKGAVT +KDQGQ GS WAFSAV A+EG I + KL+ LS QQLVDC T N
Sbjct: 1 LPESFDWREKGAVTPVKDQGQCGSCWAFSAVGALEGRYCIKTGKLVSLSEQQLVDCDTGN 60
Query: 159 HGCSGGLMDKAFEYIIENKGLASEADYPYRREQGTCDKQKEKAVAATISKYEDLPQGDEQ 218
+GC+GGL D AFEYI +N G+ +E+DYPY GTC +K + A I Y D+P DE+
Sbjct: 61 NGCNGGLPDNAFEYIKKNGGIVTESDYPYTAHDGTCKFKKSNSKYAKIKGYGDVPYNDEE 120
Query: 219 ALLQAVSK-QPVSVCVEASGRAFHFYKSG 246
AL A++K PVSV ++A F YKSG
Sbjct: 121 ALQAALAKNGPVSVAIDAYEDDFQLYKSG 149
|
Length = 213 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| KOG1542 | 372 | consensus Cysteine proteinase Cathepsin F [Posttra | 100.0 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| KOG1543 | 325 | consensus Cysteine proteinase Cathepsin L [Posttra | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.97 | |
| KOG1544 | 470 | consensus Predicted cysteine proteinase TIN-ag [Ge | 99.97 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.97 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 99.95 | |
| PF08246 | 58 | Inhibitor_I29: Cathepsin propeptide inhibitor doma | 99.75 | |
| smart00848 | 57 | Inhibitor_I29 Cathepsin propeptide inhibitor domai | 99.61 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.32 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 98.16 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 98.01 | |
| PF08127 | 41 | Propeptide_C1: Peptidase family C1 propeptide; Int | 97.43 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 94.9 | |
| KOG4128 | 457 | consensus Bleomycin hydrolases and aminopeptidases | 92.13 |
| >KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-64 Score=426.32 Aligned_cols=235 Identities=37% Similarity=0.672 Sum_probs=208.9
Q ss_pred HHHHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHHHhhCCCCceEEecccCCCCCHHHHHHHhcCCCCCCCCCCcC
Q 048025 5 SIVAKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKEGNRTYKLGTNEFSDLTNEEFRASYTGYNTPVPSLSRQ 84 (246)
Q Consensus 5 ~~~~~f~~f~~~~~k~Y~~~~e~~~r~~~F~~n~~~I~~~N~~~~~~~~~g~n~fsD~t~~E~~~~~~~~~~~~~~~~~~ 84 (246)
.+.+.|..|+.+|+|.|.+.+|...|+.+|++|+..+++++.+...|...|+|+|||||+|||++++++...........
T Consensus 66 ~~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~~~~~ 145 (372)
T KOG1542|consen 66 GLEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSKLPGD 145 (372)
T ss_pred chHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHHHHHhhccccccccCccc
Confidence 45789999999999999999999999999999999999999876558999999999999999999988766531111111
Q ss_pred CCCCCCcccCCCCCCCCceecccCCCcccccCcCCCcchHHHHHHHHHHHHHHHhcCCCccCChHHHhhcCCCCCCCCCC
Q 048025 85 SSLPSNFKYQNVTDVPTSIDWREKGAVTHIKDQGQTGSSWAFSAVAAVEGITQITSRKLIELSGQQLVDCSTDNHGCSGG 164 (246)
Q Consensus 85 ~~~~~~~~~~~~~~lP~~~Dwr~~g~v~~v~~Qg~CGsCwAfa~~~~le~~~~i~~~~~~~lS~q~l~dC~~~~~gC~GG 164 (246)
....+......||.+||||++|.||||||||+||||||||+++++|+++.|++|++++||||+|+||+..++||+||
T Consensus 146 ---~~~~~~~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~~d~gC~GG 222 (372)
T KOG1542|consen 146 ---AAEAPIEPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDSCDNGCNGG 222 (372)
T ss_pred ---cccCcCCCCCCCCcccchhccCCccccccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhhhcccCcCCcCCCC
Confidence 11111233458999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cchHHHHHHHHhcCCCCCcCCCCCCCCc-cccccccCCceEEEeeeEECCcChHHHHHHHHh-cCCeEEEEEcCcccccc
Q 048025 165 LMDKAFEYIIENKGLASEADYPYRREQG-TCDKQKEKAVAATISKYEDLPQGDEQALLQAVS-KQPVSVCVEASGRAFHF 242 (246)
Q Consensus 165 ~~~~a~~y~~~~~Gi~~e~~yPy~~~~~-~C~~~~~~~~~~~i~~~~~~~~~~~~~i~~~l~-~GPv~v~i~v~~~~f~~ 242 (246)
.+..||+|+++.+||..|.+|||++..+ .|... .....+.|++|..++ .||++|...|. +|||+|+|++. .+|.
T Consensus 223 l~~nA~~~~~~~gGL~~E~dYPY~g~~~~~C~~~-~~~~~v~I~~f~~l~-~nE~~ia~wLv~~GPi~vgiNa~--~mQ~ 298 (372)
T KOG1542|consen 223 LMDNAFKYIKKAGGLEKEKDYPYTGKKGNQCHFD-KSKIVVSIKDFSMLS-NNEDQIAAWLVTFGPLSVGINAK--PMQF 298 (372)
T ss_pred ChhHHHHHHHHhCCccccccCCccccCCCccccc-hhhceEEEeccEecC-CCHHHHHHHHHhcCCeEEEEchH--HHHH
Confidence 9999999988888999999999999887 99998 577889999999999 49999999987 99999999976 7999
Q ss_pred cCCC
Q 048025 243 YKSG 246 (246)
Q Consensus 243 Y~sG 246 (246)
|++|
T Consensus 299 YrgG 302 (372)
T KOG1542|consen 299 YRGG 302 (372)
T ss_pred hccc
Confidence 9998
|
|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >KOG1544 consensus Predicted cysteine proteinase TIN-ag [General function prediction only] | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF08127 Propeptide_C1: Peptidase family C1 propeptide; InterPro: IPR012599 This domain is found at the N-terminal of cathepsin B and cathepsin B-like peptidases that belong to MEROPS peptidase subfamily C1A | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4128 consensus Bleomycin hydrolases and aminopeptidases of cysteine protease family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 246 | ||||
| 1pci_A | 322 | Procaricain Length = 322 | 3e-52 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 4e-48 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 1e-46 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 1e-44 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 2e-44 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 2e-43 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 2e-42 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 3e-42 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 3e-42 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 8e-39 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-38 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-38 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 3e-38 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 2e-37 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 5e-37 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 6e-37 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 7e-37 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 7e-37 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 1e-36 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 1e-36 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 2e-36 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 2e-36 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 2e-36 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 2e-36 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 2e-36 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 3e-36 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 6e-36 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 1e-35 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 1e-35 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 2e-35 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 2e-35 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 3e-35 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 3e-35 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 6e-35 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 2e-34 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 1e-33 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 1e-33 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 2e-33 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 3e-33 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 7e-33 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 8e-33 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 8e-33 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 1e-32 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 2e-32 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 3e-32 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 3e-32 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 3e-32 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 4e-32 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 4e-32 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 4e-32 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 4e-32 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 4e-32 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 6e-32 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 2e-31 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 2e-31 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 1e-30 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 1e-30 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 2e-29 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 5e-29 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 8e-29 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 8e-29 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 1e-27 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 1e-27 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 3e-27 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 6e-27 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 1e-26 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 2e-26 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 2e-26 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 4e-26 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 1e-25 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 1e-25 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 3e-25 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 3e-25 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 1e-22 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 2e-22 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 3e-21 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 9e-17 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 2e-15 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 3e-15 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 5e-13 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 6e-13 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 1e-12 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 5e-10 | ||
| 1k3b_B | 164 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 1e-09 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 3e-07 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 4e-07 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 4e-07 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 1e-06 | ||
| 3f75_P | 106 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 1e-06 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 6e-06 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 7e-06 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 7e-06 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 7e-06 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 1e-05 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 1e-05 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 1e-05 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 1e-05 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 2e-05 |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
|
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|3F75|P Chain P, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 106 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 1e-134 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 1e-130 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 1e-127 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 1e-125 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 1e-123 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 1e-120 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 1e-117 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 1e-116 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 2e-93 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 7e-93 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 9e-93 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 9e-93 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 1e-92 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 1e-92 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 4e-92 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 6e-92 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 1e-91 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 2e-91 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 3e-91 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 4e-89 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 7e-88 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 4e-86 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 1e-84 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 3e-84 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 6e-83 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 6e-83 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 1e-82 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 9e-82 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 2e-81 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 4e-81 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 1e-79 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 3e-66 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 1e-63 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 5e-59 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 5e-59 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 3e-50 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 3e-48 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 1e-43 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 2e-39 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 1e-32 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 6e-23 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 2e-06 |
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
Score = 380 bits (978), Expect = e-134
Identities = 103/245 (42%), Positives = 144/245 (58%), Gaps = 5/245 (2%)
Query: 2 HEPSIVAKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKEGNRTYKLGTNEFSD 61
++ WM H + Y++ EK R IFK NL YI + NK+ N +Y LG NEF+D
Sbjct: 14 STERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKK-NNSYWLGLNEFAD 72
Query: 62 LTNEEFRASYTGYNTPVPSLSRQSSLPSNFKYQNVTDVPTSIDWREKGAVTHIKDQGQTG 121
L+N+EF Y G + + S F +++ ++P ++DWR+KGAVT ++ QG G
Sbjct: 73 LSNDEFNEKYVGSLIDA---TIEQSYDEEFINEDIVNLPENVDWRKKGAVTPVRHQGSCG 129
Query: 122 SSWAFSAVAAVEGITQITSRKLIELSGQQLVDCSTDNHGCSGGLMDKAFEYIIENKGLAS 181
S WAFSAVA VEGI +I + KL+ELS Q+LVDC +HGC GG A EY+ +N G+
Sbjct: 130 SCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKN-GIHL 188
Query: 182 EADYPYRREQGTCDKQKEKAVAATISKYEDLPQGDEQALLQAVSKQPVSVCVEASGRAFH 241
+ YPY+ +QGTC ++ S + +E LL A++KQPVSV VE+ GR F
Sbjct: 189 RSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQ 248
Query: 242 FYKSG 246
YK G
Sbjct: 249 LYKGG 253
|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Length = 80 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.92 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.9 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.86 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 99.81 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 99.76 |
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-64 Score=445.98 Aligned_cols=242 Identities=36% Similarity=0.656 Sum_probs=211.2
Q ss_pred CCchHHHHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHHHhhCCCCceEEecccCCCCCHHHHHHHhcCCCCCCCC
Q 048025 1 MHEPSIVAKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKEGNRTYKLGTNEFSDLTNEEFRASYTGYNTPVPS 80 (246)
Q Consensus 1 ~~~~~~~~~f~~f~~~~~k~Y~~~~e~~~r~~~F~~n~~~I~~~N~~~~~~~~~g~n~fsD~t~~E~~~~~~~~~~~~~~ 80 (246)
.|++.+.++|++|+.+|+|.|.+.+|+..|+.+|++|++.|++||++. .+|++|+|+|+|||.+||++++++.......
T Consensus 57 ~s~~~~~~lf~~f~~~~~K~Y~~~~E~~~R~~iF~~Nl~~I~~~N~~~-~sy~~g~N~FaDlT~eEf~~~~~~~~~~~~~ 135 (363)
T 3tnx_A 57 TSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKN-NSYWLGLNVFADMSNDEFKEKYTGSIAGNYT 135 (363)
T ss_dssp SCHHHHHHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHHHHHTTSC-CSEEECSCTTTTSCHHHHHHHHSCSSCSCCC
T ss_pred cCHHHHHHHHHHHHHHcCCcCCCHHHHHHHHHHHHHHHHHHHHHHcCC-CCeEEeccccccCCHHHHHHHhccccccccc
Confidence 368899999999999999999999999999999999999999999975 7999999999999999999998876543321
Q ss_pred CCcCCCCCCCcccCCCCCCCCceecccCCCcccccCcCCCcchHHHHHHHHHHHHHHHhcCCCccCChHHHhhcCCCCCC
Q 048025 81 LSRQSSLPSNFKYQNVTDVPTSIDWREKGAVTHIKDQGQTGSSWAFSAVAAVEGITQITSRKLIELSGQQLVDCSTDNHG 160 (246)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~v~~v~~Qg~CGsCwAfa~~~~le~~~~i~~~~~~~lS~q~l~dC~~~~~g 160 (246)
.... ...........+||++||||+.|.|+||||||.||||||||++++||++++|++++.+.||+|+|+||+..+.|
T Consensus 136 ~~~~--~~~~~~~~~~~~lP~s~DWR~~g~VtpVkdQG~CGSCWAFsa~~alE~~~~i~tg~~~~LSeQ~LvdC~~~~~G 213 (363)
T 3tnx_A 136 TTEL--SYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRRSYG 213 (363)
T ss_dssp CSSS--SSSCCCCCSCCCCCSCEEGGGGTCCCCCCBCCSSBCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCTTSCT
T ss_pred cccc--ccccccCcccCCCCcceecccCCCCCCCccCCcCCchhhhhhcccHHHHHHHHcCCCCCcCHHHHhcccCCCCC
Confidence 1010 01111122335799999999999999999999999999999999999999999999999999999999988899
Q ss_pred CCCCcchHHHHHHHHhcCCCCCcCCCCCCCCccccccccCCceEEEeeeEECCcChHHHHHHHHhcCCeEEEEEcCcccc
Q 048025 161 CSGGLMDKAFEYIIENKGLASEADYPYRREQGTCDKQKEKAVAATISKYEDLPQGDEQALLQAVSKQPVSVCVEASGRAF 240 (246)
Q Consensus 161 C~GG~~~~a~~y~~~~~Gi~~e~~yPy~~~~~~C~~~~~~~~~~~i~~~~~~~~~~~~~i~~~l~~GPv~v~i~v~~~~f 240 (246)
|+||++..||+|+.++ ||++|++|||.+.++.|...........+.++..+...++..|+.+|++|||+|+|.+..++|
T Consensus 214 C~GG~~~~a~~yi~~~-Gi~~e~~yPY~~~~~~c~~~~~~~~~~~~~~~~~~~~~~e~~l~~~v~~gPvsvai~a~~~~F 292 (363)
T 3tnx_A 214 CNGGYPWSALQLVAQY-GIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDF 292 (363)
T ss_dssp TBCCCHHHHHHHHHHT-CBCBTTTSCCCSSCCCCCGGGGCSCSBCCCEEEEECSSCHHHHHHHHTTSCEEEEECCCSHHH
T ss_pred CCCCChHHHHhHHHhc-CccccccCCCcCcCCCcccCCCCCceeeccceEEcchhhHHHHHHHHHcCCcEEEEEecchhh
Confidence 9999999999999987 999999999999888887654455667788898888889999999999999999998765799
Q ss_pred cccCCC
Q 048025 241 HFYKSG 246 (246)
Q Consensus 241 ~~Y~sG 246 (246)
++|+||
T Consensus 293 ~~Y~sG 298 (363)
T 3tnx_A 293 QLYRGG 298 (363)
T ss_dssp HTEEEE
T ss_pred hCCCCC
Confidence 999987
|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 246 | ||||
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 7e-44 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 3e-36 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 1e-35 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 4e-35 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 1e-34 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 8e-34 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 1e-33 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 1e-33 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 4e-33 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 1e-32 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 6e-32 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 7e-32 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 7e-31 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 1e-30 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 2e-30 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 5e-30 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 6e-25 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 8e-25 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 5e-22 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 2e-21 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Score = 148 bits (373), Expect = 7e-44
Identities = 95/250 (38%), Positives = 137/250 (54%), Gaps = 15/250 (6%)
Query: 3 EPSIVAKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKE---GNRTYKLGTNEF 59
+ S+ A+ +W A H R Y E+ R ++++N++ I N+E G ++ + N F
Sbjct: 5 DHSLEAQWTKWKAMHNRLYGMN-EEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAF 63
Query: 60 SDLTNEEFRASYTGYNTPVPSLSRQSSLPSNFKYQNVTDVPTSIDWREKGAVTHIKDQGQ 119
D+T+EEFR G+ P F+ + P S+DWREKG VT +K+QGQ
Sbjct: 64 GDMTSEEFRQVMNGFQNRKPRKG------KVFQEPLFYEAPRSVDWREKGYVTPVKNQGQ 117
Query: 120 TGSSWAFSAVAAVEGITQITSRKLIELSGQQLVDCSTD--NHGCSGGLMDKAFEYIIENK 177
GS WAFSA A+EG + +LI LS Q LVDCS N GC+GGLMD AF+Y+ +N
Sbjct: 118 CGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNG 177
Query: 178 GLASEADYPYRREQGTCDKQKEKAVAATISKYEDLPQGDEQALLQAVSKQ-PVSVCVEAS 236
GL SE YPY + +C + +VA E+AL++AV+ P+SV ++A
Sbjct: 178 GLDSEESYPYEATEESCKYNPKYSVA--NDAGFVDIPKQEKALMKAVATVGPISVAIDAG 235
Query: 237 GRAFHFYKSG 246
+F FYK G
Sbjct: 236 HESFLFYKEG 245
|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 99.98 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 99.97 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 98.26 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 98.16 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.7e-57 Score=395.68 Aligned_cols=236 Identities=41% Similarity=0.732 Sum_probs=202.7
Q ss_pred CchHHHHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHHHhhC---CCCceEEecccCCCCCHHHHHHHhcCCCCCC
Q 048025 2 HEPSIVAKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKE---GNRTYKLGTNEFSDLTNEEFRASYTGYNTPV 78 (246)
Q Consensus 2 ~~~~~~~~f~~f~~~~~k~Y~~~~e~~~r~~~F~~n~~~I~~~N~~---~~~~~~~g~n~fsD~t~~E~~~~~~~~~~~~ 78 (246)
.+..++++|++|+++|+|.|++ +|+..|+.||.+|++.|++||++ ++.+|++|+|+|+|||.+||.+++++.....
T Consensus 4 ~~~~l~~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~ 82 (316)
T d1cs8a_ 4 FDHSLEAQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRK 82 (316)
T ss_dssp CCGGGHHHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCC
T ss_pred ccHHHHHHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhccccccc
Confidence 4678999999999999999976 57899999999999999999986 4579999999999999999999987655433
Q ss_pred CCCCcCCCCCCCcccCCCCCCCCceecccCCCcccccCcCCCcchHHHHHHHHHHHHHHHhcCCCccCChHHHhhcCCC-
Q 048025 79 PSLSRQSSLPSNFKYQNVTDVPTSIDWREKGAVTHIKDQGQTGSSWAFSAVAAVEGITQITSRKLIELSGQQLVDCSTD- 157 (246)
Q Consensus 79 ~~~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~v~~v~~Qg~CGsCwAfa~~~~le~~~~i~~~~~~~lS~q~l~dC~~~- 157 (246)
... ..........+||++||||+.|+|+||+|||.||||||||+++++|++++|+++..+.||+|+|+||+..
T Consensus 83 ~~~------~~~~~~~~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~~~~ 156 (316)
T d1cs8a_ 83 PRK------GKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQ 156 (316)
T ss_dssp CSC------CEECCCCTTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGGG
T ss_pred ccc------CccccCcccccCCCceECCcCCcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhccccc
Confidence 211 1112223345899999999999999999999999999999999999999999999999999999999864
Q ss_pred -CCCCCCCcchHHHHHHHHhcCCCCCcCCCCCCCCccccccccCCceEEEeeeEECCcChHHHHHHHHh-cCCeEEEEEc
Q 048025 158 -NHGCSGGLMDKAFEYIIENKGLASEADYPYRREQGTCDKQKEKAVAATISKYEDLPQGDEQALLQAVS-KQPVSVCVEA 235 (246)
Q Consensus 158 -~~gC~GG~~~~a~~y~~~~~Gi~~e~~yPy~~~~~~C~~~~~~~~~~~i~~~~~~~~~~~~~i~~~l~-~GPv~v~i~v 235 (246)
+.||.||++..|++|+..++++.+|.+|||.+....|... .......+..+.... .+++.|+++|. +|||+|+|.+
T Consensus 157 ~~~~c~gg~~~~a~~y~~~~g~~~~e~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~-~~~~~l~~~l~~~gpv~v~i~~ 234 (316)
T d1cs8a_ 157 GNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYN-PKYSVANDAGFVDIP-KQEKALMKAVATVGPISVAIDA 234 (316)
T ss_dssp TCCGGGCBCHHHHHHHHHHHTCEEBTTTSCCCSSCCCCCCC-GGGEEECCCCEEECC-SCHHHHHHHHHHHCCEEEEECC
T ss_pred cCCCCCCCchHHHHHHHHhcCcccccccccccccccccccc-ccccccccccccccc-CcHHHHHHHHHHhCCeEEEEEe
Confidence 7899999999999999999668899999999988888766 444566667777666 58899999998 8999999999
Q ss_pred CcccccccCCC
Q 048025 236 SGRAFHFYKSG 246 (246)
Q Consensus 236 ~~~~f~~Y~sG 246 (246)
...+|++|++|
T Consensus 235 ~~~~f~~y~~G 245 (316)
T d1cs8a_ 235 GHESFLFYKEG 245 (316)
T ss_dssp CSHHHHTEEEE
T ss_pred ccchhccccCC
Confidence 75789999887
|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|