Citrus Sinensis ID: 048100
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 161 | ||||||
| 224127093 | 281 | predicted protein [Populus trichocarpa] | 0.919 | 0.526 | 0.496 | 2e-28 | |
| 224157601 | 254 | predicted protein [Populus trichocarpa] | 0.931 | 0.590 | 0.484 | 3e-28 | |
| 224145572 | 395 | predicted protein [Populus trichocarpa] | 0.937 | 0.382 | 0.465 | 3e-27 | |
| 224127104 | 405 | predicted protein [Populus trichocarpa] | 0.931 | 0.370 | 0.465 | 3e-27 | |
| 224127098 | 399 | predicted protein [Populus trichocarpa] | 0.931 | 0.375 | 0.465 | 4e-27 | |
| 224127081 | 227 | predicted protein [Populus trichocarpa] | 0.931 | 0.660 | 0.465 | 4e-27 | |
| 224127089 | 217 | predicted protein [Populus trichocarpa] | 0.931 | 0.691 | 0.459 | 5e-27 | |
| 224127079 | 394 | predicted protein [Populus trichocarpa] | 0.931 | 0.380 | 0.446 | 7e-26 | |
| 224127106 | 575 | predicted protein [Populus trichocarpa] | 0.937 | 0.262 | 0.446 | 8e-26 | |
| 224127096 | 219 | predicted protein [Populus trichocarpa] | 0.925 | 0.680 | 0.468 | 2e-25 |
| >gi|224127093|ref|XP_002329392.1| predicted protein [Populus trichocarpa] gi|222870442|gb|EEF07573.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 130 bits (327), Expect = 2e-28, Method: Compositional matrix adjust.
Identities = 80/161 (49%), Positives = 100/161 (62%), Gaps = 13/161 (8%)
Query: 1 MNSDLYEAAAKGVIEPFN--QLAIDRQLGSLVIHKKNSVLHVNIIASYTQNKEGESVSTK 58
M+ L++AA G I PF Q +D+ L+ +N++LHV Y N+ E T
Sbjct: 5 MDPVLFKAAEAGDIGPFENYQTCLDQ----LLTPDENTILHV-----YLGNQSREPEFTD 55
Query: 59 FVELVLETCPSLLLQVNAKGDSPLHVAARYGHAAVVGALIEFAEKQPGQELESGVKSTTR 118
FV+ +LE CP LLLQ N KG+ PLH+AARYGH+ VVG LIE AE P + ESGV S +
Sbjct: 56 FVDKILEMCPPLLLQANKKGEIPLHLAARYGHSNVVGVLIERAEALP-TDPESGV-SEAK 113
Query: 119 YMLGMKNDEEDTALHEAVQSGSLDVVEILLGADPAFPYSAN 159
ML M NDE+DTALHEA ++ VVEIL DP F YSAN
Sbjct: 114 KMLRMTNDEQDTALHEAARNMRSHVVEILTEEDPEFSYSAN 154
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224157601|ref|XP_002337868.1| predicted protein [Populus trichocarpa] gi|222869936|gb|EEF07067.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224145572|ref|XP_002325691.1| predicted protein [Populus trichocarpa] gi|222862566|gb|EEF00073.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224127104|ref|XP_002329397.1| predicted protein [Populus trichocarpa] gi|222870447|gb|EEF07578.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224127098|ref|XP_002329394.1| predicted protein [Populus trichocarpa] gi|222870444|gb|EEF07575.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224127081|ref|XP_002329387.1| predicted protein [Populus trichocarpa] gi|222870437|gb|EEF07568.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224127089|ref|XP_002329390.1| predicted protein [Populus trichocarpa] gi|222870440|gb|EEF07571.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224127079|ref|XP_002329386.1| predicted protein [Populus trichocarpa] gi|224127100|ref|XP_002329395.1| predicted protein [Populus trichocarpa] gi|222870436|gb|EEF07567.1| predicted protein [Populus trichocarpa] gi|222870445|gb|EEF07576.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224127106|ref|XP_002329398.1| predicted protein [Populus trichocarpa] gi|222870448|gb|EEF07579.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224127096|ref|XP_002329393.1| predicted protein [Populus trichocarpa] gi|222870443|gb|EEF07574.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 161 | ||||||
| TAIR|locus:2170081 | 535 | AT5G50140 "AT5G50140" [Arabido | 0.577 | 0.173 | 0.315 | 1.3e-07 | |
| TAIR|locus:2129685 | 694 | AT4G14390 "AT4G14390" [Arabido | 0.596 | 0.138 | 0.313 | 1.9e-07 | |
| TAIR|locus:2128771 | 641 | AT4G03450 "AT4G03450" [Arabido | 0.602 | 0.151 | 0.323 | 5.9e-07 | |
| TAIR|locus:2128781 | 677 | AT4G03460 "AT4G03460" [Arabido | 0.608 | 0.144 | 0.310 | 1e-06 | |
| TAIR|locus:2138391 | 572 | AT4G05040 "AT4G05040" [Arabido | 0.844 | 0.237 | 0.268 | 1.1e-06 | |
| TAIR|locus:2129690 | 670 | ACD6 "AT4G14400" [Arabidopsis | 0.596 | 0.143 | 0.303 | 1.7e-06 | |
| TAIR|locus:2009046 | 573 | AT1G34050 "AT1G34050" [Arabido | 0.298 | 0.083 | 0.44 | 1.2e-05 | |
| POMBASE|SPBP16F5.05c | 146 | SPBP16F5.05c "ribosome biogene | 0.496 | 0.547 | 0.278 | 5.3e-05 | |
| TAIR|locus:2020833 | 616 | AT1G03670 "AT1G03670" [Arabido | 0.689 | 0.180 | 0.290 | 0.00013 | |
| TAIR|locus:2128791 | 683 | AT4G03470 [Arabidopsis thalian | 0.571 | 0.134 | 0.329 | 0.0002 |
| TAIR|locus:2170081 AT5G50140 "AT5G50140" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 130 (50.8 bits), Expect = 1.3e-07, P = 1.3e-07
Identities = 30/95 (31%), Positives = 54/95 (56%)
Query: 58 KFVELVLETCPSLLLQVNAKGDSPLHVAARYGHAAVVGALIEFAEKQPGQELESGVKSTT 117
+ V+ ++E PSL+ N K D+PLH+AAR GH +++ ++E + + + LE V +
Sbjct: 41 ELVKKIVEIHPSLVSSTNTKSDTPLHLAARLGHTSILLLMLE-STAESIESLEETVPNDL 99
Query: 118 RYMLGMKNDEEDTALHEAVQSGSLDVVEILLGADP 152
+ + M N + T LH AV +GS++ + + P
Sbjct: 100 K-LAEMVNKDGFTPLHCAVMNGSVETLTAFINKAP 133
|
|
| TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128771 AT4G03450 "AT4G03450" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2138391 AT4G05040 "AT4G05040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129690 ACD6 "AT4G14400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009046 AT1G34050 "AT1G34050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBP16F5.05c SPBP16F5.05c "ribosome biogenesis protein Nop8 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128791 AT4G03470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.01200022 | hypothetical protein (281 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| fgenesh4_pg.C_LG_I003169 | • | 0.449 | |||||||||
| eugene3.00051263 | • | 0.409 | |||||||||
| gw1.57.246.1 | • | 0.406 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 161 | |||
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-09 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-09 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 7e-09 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-08 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 1e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 5e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 0.001 |
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
Score = 51.5 bits (124), Expect = 2e-09
Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 22/99 (22%)
Query: 56 STKFVELVLETCPSLLLQVNAKGDSPLHVAARYGHAAVVGALIEFAEKQPGQELESGVKS 115
+ + V+L+LE + L D+ LH+AAR G+ +V L+E G
Sbjct: 9 NLELVKLLLEKGADVNLGDT---DTALHLAARNGNLEIVKLLLEH-----------GADV 54
Query: 116 TTRYMLGMKNDEEDTALHEAVQSGSLDVVEILL--GADP 152
+ G TALH A ++G+L++V++LL GAD
Sbjct: 55 NAKDKDGN------TALHLAARNGNLEIVKLLLEHGADI 87
|
Length = 91 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.96 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.95 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.95 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.94 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.93 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.93 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.93 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.92 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.92 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.92 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.92 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.92 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.91 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.91 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.91 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.91 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.91 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.9 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.9 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.9 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.9 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.9 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.9 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.9 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.89 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.88 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.88 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.88 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.88 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.87 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.87 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.87 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.87 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.87 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.87 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.86 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.85 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.85 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.85 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.85 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.85 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.84 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.83 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.83 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.82 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.82 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.81 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.81 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.8 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.8 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.79 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.79 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.79 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.78 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.77 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.77 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.76 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.74 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.73 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.72 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.72 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.71 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.71 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.7 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.69 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.69 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.68 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.67 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.67 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.67 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.66 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.64 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.62 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.61 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.61 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.61 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.57 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.56 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.54 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.49 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.49 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.49 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.49 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.47 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.44 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.4 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.36 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.25 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 99.2 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 99.14 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 99.13 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 99.05 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 99.02 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 99.02 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.96 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.95 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.9 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.89 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.84 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.82 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.76 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.71 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.68 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.67 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.54 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 98.5 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.49 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 98.23 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 98.21 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.02 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.93 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.89 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 97.86 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.85 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 97.52 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 97.33 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 97.21 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 96.27 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 95.44 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 95.3 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 93.65 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 84.11 |
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.96 E-value=9.6e-30 Score=163.08 Aligned_cols=146 Identities=19% Similarity=0.159 Sum_probs=123.6
Q ss_pred hHHHHHHHcCChHHHHHHHh-hhCccccccCCCCcHHHHHHHHhhhcccccccccHHHHHHHHHh-CccchhccCCCCCc
Q 048100 3 SDLYEAAAKGVIEPFNQLAI-DRQLGSLVIHKKNSVLHVNIIASYTQNKEGESVSTKFVELVLET-CPSLLLQVNAKGDS 80 (161)
Q Consensus 3 ~~l~~A~~~g~~~~v~~ll~-~~~~~~~~~~~g~t~l~~a~~a~~~~~~~~~~~~~~~v~~Ll~~-~~~~~~~~~~~~~t 80 (161)
|||||||..|+.+++++|+. .+..++.+|..|+||||+|+ ..| ..++|+.|+.+ +++ ++..+..|.|
T Consensus 40 t~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~---s~g-------~~evVk~Ll~r~~ad-vna~tn~G~T 108 (226)
T KOG4412|consen 40 TPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAA---SNG-------NDEVVKELLNRSGAD-VNATTNGGQT 108 (226)
T ss_pred ceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhh---hcC-------cHHHHHHHhcCCCCC-cceecCCCcc
Confidence 78999999999999999994 45667888999999999954 444 37899999998 666 6888999999
Q ss_pred HHHHHHHhCCHHHHHHHHHhhhcCCch----------hhhcCchhHHHHHh------hccCCCCCcHhHHHHHcCCHHHH
Q 048100 81 PLHVAARYGHAAVVGALIEFAEKQPGQ----------ELESGVKSTTRYML------GMKNDEEDTALHEAVQSGSLDVV 144 (161)
Q Consensus 81 ~l~~a~~~~~~~~~~~Ll~~g~~~~~~----------~~~~~~~~~~~~l~------~~~~~~g~t~l~~a~~~~~~~~~ 144 (161)
|||||+..|..+++++|++.|+.+..+ ++.-|...++++|+ +.+|..|+||||.|...|+.+.+
T Consensus 109 ~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n~qDk~G~TpL~~al~e~~~d~a 188 (226)
T KOG4412|consen 109 CLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLNTQDKYGFTPLHHALAEGHPDVA 188 (226)
T ss_pred eehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHHHHhcCCCCCcccccCccHHHHHHhccCchHH
Confidence 999999999999999999999876555 35555566788875 67899999999999888999999
Q ss_pred HHHHhCCCCCCCCcC
Q 048100 145 EILLGADPAFPYSAN 159 (161)
Q Consensus 145 ~~Ll~~~~~~~~~~~ 159 (161)
.+|+++|+++...++
T Consensus 189 ~lLV~~gAd~~~edk 203 (226)
T KOG4412|consen 189 VLLVRAGADTDREDK 203 (226)
T ss_pred HHHHHhccceeeccc
Confidence 999999988876654
|
|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 161 | ||||
| 3f6q_A | 179 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 2e-05 | ||
| 2kbx_A | 171 | Solution Structure Of Ilk-Pinch Complex Length = 17 | 2e-05 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 7e-04 |
| >pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 | Back alignment and structure |
|
| >pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 161 | |||
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-13 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 7e-11 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-09 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 7e-08 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-05 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 6e-13 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 5e-10 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-08 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 6e-04 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 3e-12 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 5e-06 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 7e-12 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 6e-11 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 4e-09 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-08 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 7e-12 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 6e-09 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-08 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-08 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-11 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 5e-10 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-05 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 8e-04 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-11 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-10 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-08 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-04 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-11 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-10 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-06 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-11 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-09 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 3e-11 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-08 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 3e-08 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-07 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-07 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 5e-11 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 1e-09 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 2e-09 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 5e-11 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-10 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-10 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-09 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 6e-11 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 4e-10 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-08 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 7e-11 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 7e-11 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 8e-10 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 8e-09 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-10 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-09 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-09 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 6e-09 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 3e-08 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-10 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-10 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-08 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 5e-08 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 6e-06 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-10 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-10 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 5e-10 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 6e-10 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 7e-10 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 8e-10 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-09 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-08 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-10 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-09 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-07 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-10 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 6e-10 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-08 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 3e-05 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-10 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-10 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-08 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-07 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-10 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 7e-09 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 3e-07 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-05 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 4e-04 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-10 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-08 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-07 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-04 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-10 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 8e-10 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 4e-08 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-06 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-05 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-10 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 7e-10 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 4e-10 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-09 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-08 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-07 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 4e-05 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 4e-10 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 8e-09 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-07 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 3e-06 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 4e-10 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 6e-09 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 8e-08 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-07 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 5e-10 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-08 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 4e-08 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 6e-08 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-07 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 4e-05 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 5e-10 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 8e-09 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-08 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 6e-10 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 6e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-08 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-07 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-04 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 9e-10 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 7e-08 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-07 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-07 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-09 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 5e-09 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 6e-09 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 6e-09 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 6e-08 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-07 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-09 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 7e-09 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 8e-09 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 6e-06 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-09 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-09 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-09 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-08 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 1e-09 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-09 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-09 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 7e-09 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-07 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-09 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 6e-08 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 7e-08 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-09 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-08 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-07 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 5e-06 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-09 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 5e-09 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-07 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-07 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 5e-04 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-09 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 9e-09 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 7e-08 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 4e-07 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 3e-09 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 8e-09 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 5e-08 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-07 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 8e-09 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-08 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-08 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 5e-08 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-07 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 6e-05 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-08 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 9e-06 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-05 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 7e-05 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-08 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 7e-08 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-08 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-07 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-06 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 3e-05 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-08 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 6e-05 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 5e-08 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 5e-07 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-04 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 4e-04 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-07 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 3e-07 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-06 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 4e-04 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 4e-06 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 7e-06 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 3e-05 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 7e-04 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 8e-04 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 6e-05 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 1e-04 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 1e-04 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
Score = 64.1 bits (157), Expect = 3e-13
Identities = 33/122 (27%), Positives = 43/122 (35%), Gaps = 36/122 (29%)
Query: 38 LHVNIIASYTQNKEGESVSTKFVELVLETCPSLLLQ---VNAK---GDSPLHVAARYGHA 91
LH +A T E E LL + G++PLH+A G
Sbjct: 49 LH---LAVITNQPE-------IAEA-------LLGAGCDPELRDFRGNTPLHLACEQGCL 91
Query: 92 AVVGALIEFAEKQPGQELESGVKSTTRYMLGMKNDEEDTALHEAVQSGSLDVVEILL--G 149
A VG L + S +L N T LH A G L +VE+L+ G
Sbjct: 92 ASVGVLTQ-----------SCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLG 140
Query: 150 AD 151
AD
Sbjct: 141 AD 142
|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 100.0 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.96 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.96 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.96 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.96 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.96 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.96 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.96 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.96 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.96 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.96 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.96 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.96 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.96 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.95 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.95 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.95 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.95 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.95 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.95 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.95 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.95 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.95 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.95 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.95 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.95 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.95 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.95 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.95 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.95 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.95 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.94 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.94 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.94 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.94 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.94 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.94 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.94 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.94 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.94 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.94 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.94 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.94 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.94 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.94 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.94 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.94 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.94 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.94 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.94 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.94 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.94 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.94 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.94 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.94 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.94 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.94 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.94 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.93 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.93 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.93 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.93 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.93 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.93 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.93 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.93 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.93 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.93 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.93 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.93 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.93 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.93 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.93 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.93 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.93 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.93 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.93 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.93 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.92 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.92 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.92 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.92 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.91 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.91 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.91 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.91 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.91 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.91 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.91 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.9 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.88 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.88 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.88 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.88 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.87 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.87 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.87 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.86 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.86 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.86 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.86 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.84 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.84 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.84 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.84 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.84 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.83 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.83 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.82 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.8 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.76 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.76 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.75 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.74 |
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
Probab=100.00 E-value=6.5e-32 Score=177.67 Aligned_cols=144 Identities=22% Similarity=0.276 Sum_probs=121.9
Q ss_pred ChHHHHHHHcCChHHHHHHHhhhCccccccCCCCcHHHHHHHHhhhcccccccccHHHHHHHHHhCccchhccCCCCCcH
Q 048100 2 NSDLYEAAAKGVIEPFNQLAIDRQLGSLVIHKKNSVLHVNIIASYTQNKEGESVSTKFVELVLETCPSLLLQVNAKGDSP 81 (161)
Q Consensus 2 ~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~g~t~l~~a~~a~~~~~~~~~~~~~~~v~~Ll~~~~~~~~~~~~~~~t~ 81 (161)
.++|+.|++.|+++.|+.|++.+.+++.+|..|.||||+| +..+ ..+++++|++.|++ ++..+..|+||
T Consensus 5 g~~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a---~~~~-------~~~~~~~ll~~gad-~~~~d~~g~Tp 73 (169)
T 4gpm_A 5 GKRLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHHA---AENG-------HKEVVKLLISKGAD-VNAKDSDGRTP 73 (169)
T ss_dssp HHHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHH---HHTT-------CHHHHHHHHHTTCC-TTCCCTTSCCH
T ss_pred HHHHHHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHH---HHcC-------CHHHHHHHHhcccc-hhhhccCCCCH
Confidence 4689999999999999999999999999999999999994 4444 48899999999988 57789999999
Q ss_pred HHHHHHhCCHHHHHHHHHhhhcCCch----------hhhcCchhHHHHHh------hccCCCCCcHhHHHHHcCCHHHHH
Q 048100 82 LHVAARYGHAAVVGALIEFAEKQPGQ----------ELESGVKSTTRYML------GMKNDEEDTALHEAVQSGSLDVVE 145 (161)
Q Consensus 82 l~~a~~~~~~~~~~~Ll~~g~~~~~~----------~~~~~~~~~~~~l~------~~~~~~g~t~l~~a~~~~~~~~~~ 145 (161)
||+|++.|+.+++++|+++|++++.. +...|+.+++++|+ +.+|..|+||||+|+..|+.++++
T Consensus 74 Lh~A~~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~iv~ 153 (169)
T 4gpm_A 74 LHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNEEVVK 153 (169)
T ss_dssp HHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHH
T ss_pred HHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCCHHHHH
Confidence 99999999999999999999987655 45667777888886 568889999999999999999999
Q ss_pred HHHhCCCCCCC
Q 048100 146 ILLGADPAFPY 156 (161)
Q Consensus 146 ~Ll~~~~~~~~ 156 (161)
+|+++|+++..
T Consensus 154 ~Ll~~GA~ie~ 164 (169)
T 4gpm_A 154 LLEKQGGWLEH 164 (169)
T ss_dssp HHHTC------
T ss_pred HHHHCCCCcCC
Confidence 99999998864
|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 161 | ||||
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-09 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-06 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 7e-05 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 7e-05 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 0.001 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 9e-05 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 6e-04 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-09 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-08 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-07 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-07 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 7e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 0.001 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 0.002 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 7e-07 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-04 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 0.002 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 3e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 3e-05 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.001 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.001 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 4e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 4e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 7e-04 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 8e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-04 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 0.001 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 1e-05 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.002 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.004 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 1e-05 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-05 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 6e-04 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 5e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 7e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 1e-04 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 3e-04 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 7e-05 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 0.002 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 0.004 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 8e-05 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 5e-04 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.001 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.001 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 9e-05 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-04 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 1e-04 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 5e-04 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 3e-04 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 0.002 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 5e-04 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 0.004 | |
| d1myoa_ | 118 | d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) | 0.002 |
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: RNase L, 2-5a-dependent ribonuclease species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.7 bits (125), Expect = 2e-09
Identities = 26/129 (20%), Positives = 41/129 (31%), Gaps = 21/129 (16%)
Query: 29 LVIHKKNSVLHVNIIASYTQNKEGESVSTKFVELVLETCPSLLLQVNAK---GDSPLHVA 85
L+ V + + S VE + VN + G +PL +A
Sbjct: 167 LLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILA 226
Query: 86 ARYGHAAVVGALIEFAEKQPGQELESGVKSTTRYMLGMKNDEEDTALHEAVQSGSLDVVE 145
H +V L+E Q E+ + + TAL AV+ + E
Sbjct: 227 VEKKHLGLVQRLLE----QEHIEIN------------DTDSDGKTALLLAVELKLKKIAE 270
Query: 146 ILL--GADP 152
+L GA
Sbjct: 271 LLCKRGAST 279
|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.95 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.95 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.95 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.95 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.94 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.94 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.94 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.94 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.93 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.93 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.92 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.92 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.92 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.91 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.9 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.9 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.9 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.89 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.89 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.88 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.87 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.87 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.87 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.86 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.85 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.81 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.8 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.79 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.79 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.73 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.7 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.64 |
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Cell cycle inhibitor p16ink4A species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=3.3e-28 Score=151.06 Aligned_cols=120 Identities=22% Similarity=0.155 Sum_probs=107.6
Q ss_pred ChHHHHHHHcCChHHHHHHHhhhCccccccCCCCcHHHHHHHHhhhcccccccccHHHHHHHHHhCccchhccCCCCC-c
Q 048100 2 NSDLYEAAAKGVIEPFNQLAIDRQLGSLVIHKKNSVLHVNIIASYTQNKEGESVSTKFVELVLETCPSLLLQVNAKGD-S 80 (161)
Q Consensus 2 ~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~g~t~l~~a~~a~~~~~~~~~~~~~~~v~~Ll~~~~~~~~~~~~~~~-t 80 (161)
.++||.|++.|+++.|++|++.+.+++.++..|.||+|+ +. .| +.+++++|+++|+++ +..+..+. |
T Consensus 4 ~~~L~~Aa~~G~~~~v~~Ll~~gad~n~~~~~g~t~l~~---a~-~g-------~~~~v~~Ll~~ga~~-~~~~~~~~~~ 71 (125)
T d1bi7b_ 4 ADWLATAAARGRVEEVRALLEAGANPNAPNSYGRRPIQV---MM-MG-------SARVAELLLLHGAEP-NCADPATLTR 71 (125)
T ss_dssp TTHHHHHHHHTCHHHHHHHHTTTCCTTCCCSSSCCTTTS---SC-TT-------CHHHHHHHHTTTCCC-CCCCTTTCCC
T ss_pred hhHHHHHHHCCCHHHHHHHHHcCCccccccccccccccc---cc-cc-------ccccccccccccccc-cccccccccc
Confidence 468999999999999999999999999999999999998 32 34 489999999999884 55666655 7
Q ss_pred HHHHHHHhCCHHHHHHHHHhhhcCCchhhhcCchhHHHHHhhccCCCCCcHhHHHHHcCCHHHHHHHHhC
Q 048100 81 PLHVAARYGHAAVVGALIEFAEKQPGQELESGVKSTTRYMLGMKNDEEDTALHEAVQSGSLDVVEILLGA 150 (161)
Q Consensus 81 ~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~~~~~~l~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~ 150 (161)
|||+|++.|+.+++++|+++|++ ++.+|..|+||||+|++.|+.+++++|+.+
T Consensus 72 ~L~~A~~~g~~~~v~~Ll~~ga~-----------------~~~~d~~G~T~l~~A~~~g~~~~v~~Llsa 124 (125)
T d1bi7b_ 72 PVHDAAREGFLDTLVVLHRAGAR-----------------LDVRDAWGRLPVDLAEELGHRDVARYLRAA 124 (125)
T ss_dssp HHHHHHHHTCHHHHHHHHHHTCC-----------------SSCCCTTCCCHHHHHHHHTCHHHHHHHSSC
T ss_pred ccccccccccccccccccccccc-----------------cccccCCCCCHHHHHHHcCCHHHHHHHHhc
Confidence 99999999999999999999988 788999999999999999999999999853
|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|