Citrus Sinensis ID: 048189

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAKYHE
cHHHHccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccccccccccccccccccEEccEEcccccEEEEEEEEEcccccccccccccccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEcccccEEEEEEEcc
ccHHHHHHHHHccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccEEcHcHHHHcHHHHHHHHHHHHccccccccccccccccEEEccEEcccccEEEEEEEEEccccHHcccHHHcccHHHcccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccEEEEccccEEEEEcccc
elinehldpnrtkselpqpeDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLiggnkgfvneddVQELHYLKAVVKETMrlqptvpllvpretiekcvidgyeipaktLVFVNAwaigrdpeawenpeefyperfvdscidfkgqhfelipfgagrricpglnmgIATVDLALANLLYkfdwemppgmksqdldfdvlpgitMHKKNALSLLAKYHE
elinehldpnrtkselpqpeDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETmrlqptvpllvpreTIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAKYHE
ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAKYHE
********************DIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSL******
ELINEH****************IDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAKYH*
ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAKYHE
ELINEHLDPNRTKS*LPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAKY**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAKYHE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query252 2.2.26 [Sep-21-2011]
O65782499 Cytochrome P450 83B1 OS=A yes no 0.980 0.494 0.547 2e-78
P24465502 Cytochrome P450 71A1 OS=P N/A no 0.988 0.496 0.525 3e-76
O81970499 Cytochrome P450 71A9 OS=G no no 0.980 0.494 0.540 7e-76
Q9LTM0501 Cytochrome P450 71B23 OS= no no 0.972 0.489 0.516 2e-73
Q9LIP3500 Cytochrome P450 71B37 OS= no no 0.912 0.46 0.557 1e-72
Q6XQ14511 2-methylbutanal oxime mon N/A no 0.988 0.487 0.5 3e-72
O48923510 Cytochrome P450 71D10 OS= no no 0.968 0.478 0.493 1e-71
Q9LIP6500 Cytochrome P450 71B34 OS= no no 0.900 0.454 0.565 1e-71
Q9LTM3502 Cytochrome P450 71B20 OS= no no 0.964 0.484 0.510 3e-71
Q9LTM4502 Cytochrome P450 71B19 OS= no no 0.964 0.484 0.506 9e-71
>sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 Back     alignment and function desciption
 Score =  292 bits (747), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 139/254 (54%), Positives = 191/254 (75%), Gaps = 7/254 (2%)

Query: 1   ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSA 60
           EL++E LDPNR K E    E  ID+L+QI KD+ F +  T +++KA+++++ V GTDT+A
Sbjct: 249 ELLDETLDPNRPKQE---TESFIDLLMQIYKDQPFSIKFTHENVKAMILDIVVPGTDTAA 305

Query: 61  ATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTV 120
           A VVWAMTYL+K P AMKK Q E+RS+IG +KG+V+E+D+  L YLKAV+KE++RL+P +
Sbjct: 306 AVVVWAMTYLIKYPEAMKKAQDEVRSVIG-DKGYVSEEDIPNLPYLKAVIKESLRLEPVI 364

Query: 121 PLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAW-ENPEEFYPERFVD--SCIDF 177
           P+L+ RETI    I GY+IPAKT++ VNAWA+ RD  AW +NP EF PERF++    +DF
Sbjct: 365 PILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMNEHKGVDF 424

Query: 178 KGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGIT 237
           KGQ FEL+PFG+GRR+CP +++GIA V++  ANLLYKFDW +P G+K +D+  DV+ G+ 
Sbjct: 425 KGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKGIKPEDIKMDVMTGLA 484

Query: 238 MHKKNALSLLAKYH 251
           MHKK  L L    H
Sbjct: 485 MHKKEHLVLAPTKH 498
Involved in the metabolism of aromatic oximes. Catalyzes the oxime metabolizing step in indole glucosinolate biosynthesis by converting indole-3-acetaldoxime into indole-3-S-alkyl-thiohydroximate. Probably required for glucosinolate activation in response to pathogens. Functions in auxin homeostasis because indole-3-acetaldoxime also serves as a precursor for auxin biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function description
>sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 Back     alignment and function description
>sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 Back     alignment and function description
>sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
225458055 495 PREDICTED: cytochrome P450 83B1 [Vitis v 0.972 0.494 0.730 1e-105
225458059 496 PREDICTED: cytochrome P450 83B1-like [Vi 0.980 0.497 0.721 1e-102
302142620 912 unnamed protein product [Vitis vinifera] 0.972 0.268 0.690 1e-102
225458049 496 PREDICTED: cytochrome P450 83B1 [Vitis v 0.980 0.497 0.689 1e-102
225458053 498 PREDICTED: cytochrome P450 83B1 [Vitis v 0.980 0.495 0.685 1e-101
255538870 497 cytochrome P450, putative [Ricinus commu 0.980 0.496 0.701 1e-99
225458057 494 PREDICTED: cytochrome P450 71A1 [Vitis v 0.980 0.5 0.701 2e-99
224065988 504 cytochrome P450 [Populus trichocarpa] gi 0.980 0.490 0.702 5e-99
357016484209 putative cytochrome P450 [Citrus sinensi 0.805 0.971 0.827 2e-98
255589898267 cytochrome P450, putative [Ricinus commu 0.976 0.921 0.696 9e-98
>gi|225458055|ref|XP_002278300.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 214/249 (85%), Gaps = 4/249 (1%)

Query: 1   ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSA 60
           E+I+EHLDPNR +   P+ EDI D+LL+++K+R F +DLT DHIKAVLMN+F+AGTDTSA
Sbjct: 247 EIIDEHLDPNRPE---PEKEDITDVLLKLQKNRLFTIDLTFDHIKAVLMNIFLAGTDTSA 303

Query: 61  ATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTV 120
           AT+VWAMT LMKNPR M K Q+E+R+LIG  KGFV+EDD+Q+L YLKA+VKETMRL P  
Sbjct: 304 ATLVWAMTMLMKNPRTMTKAQEELRNLIG-KKGFVDEDDLQKLPYLKAIVKETMRLHPAS 362

Query: 121 PLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQ 180
           PLLVPRET+EKCVIDGYEIP KTLV+VNAWAIGRDPE+WENPEEF PERF+ + IDFKGQ
Sbjct: 363 PLLVPRETLEKCVIDGYEIPPKTLVYVNAWAIGRDPESWENPEEFMPERFLGTSIDFKGQ 422

Query: 181 HFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHK 240
            ++LIPFG GRRICPGLN+G A V+L LANLLY FDWEMP GM  +D+D DV PGITMHK
Sbjct: 423 DYQLIPFGGGRRICPGLNLGAAMVELTLANLLYSFDWEMPAGMNKEDIDIDVKPGITMHK 482

Query: 241 KNALSLLAK 249
           KNAL LLA+
Sbjct: 483 KNALCLLAR 491

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225458059|ref|XP_002278372.1| PREDICTED: cytochrome P450 83B1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142620|emb|CBI19823.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458049|ref|XP_002280438.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458053|ref|XP_002280472.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] gi|147832399|emb|CAN64422.1| hypothetical protein VITISV_032274 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255538870|ref|XP_002510500.1| cytochrome P450, putative [Ricinus communis] gi|223551201|gb|EEF52687.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225458057|ref|XP_002278387.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224065988|ref|XP_002301993.1| cytochrome P450 [Populus trichocarpa] gi|222843719|gb|EEE81266.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357016484|gb|AET50435.1| putative cytochrome P450 [Citrus sinensis] Back     alignment and taxonomy information
>gi|255589898|ref|XP_002535120.1| cytochrome P450, putative [Ricinus communis] gi|223523988|gb|EEF27263.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
TAIR|locus:2125264499 CYP83B1 ""cytochrome P450, fam 0.980 0.494 0.547 1.9e-74
TAIR|locus:2093531501 CYP71B23 ""cytochrome P450, fa 0.972 0.489 0.516 4.9e-69
TAIR|locus:2079316500 CYP71B37 ""cytochrome P450, fa 0.908 0.458 0.565 2.7e-68
TAIR|locus:2093516502 CYP71B20 ""cytochrome P450, fa 0.960 0.482 0.520 3.5e-68
TAIR|locus:2079251500 CYP71B34 ""cytochrome P450, fa 0.944 0.476 0.549 7.2e-68
TAIR|locus:2093511502 CYP71B19 ""cytochrome P450, fa 0.960 0.482 0.508 1.5e-67
TAIR|locus:2079306500 CYP71B35 ""cytochrome P450, fa 0.900 0.454 0.543 4e-67
TAIR|locus:2093501502 CYP71B17 ""cytochrome P450, fa 0.956 0.480 0.497 8.2e-67
TAIR|locus:2079311500 CYP71B36 ""cytochrome P450, fa 0.908 0.458 0.536 8.2e-67
TAIR|locus:2119500502 CYP83A1 ""cytochrome P450, fam 0.964 0.484 0.504 1.7e-66
TAIR|locus:2125264 CYP83B1 ""cytochrome P450, family 83, subfamily B, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 751 (269.4 bits), Expect = 1.9e-74, P = 1.9e-74
 Identities = 139/254 (54%), Positives = 191/254 (75%)

Query:     1 ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSA 60
             EL++E LDPNR K E    E  ID+L+QI KD+ F +  T +++KA+++++ V GTDT+A
Sbjct:   249 ELLDETLDPNRPKQET---ESFIDLLMQIYKDQPFSIKFTHENVKAMILDIVVPGTDTAA 305

Query:    61 ATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTV 120
             A VVWAMTYL+K P AMKK Q E+RS+IG +KG+V+E+D+  L YLKAV+KE++RL+P +
Sbjct:   306 AVVVWAMTYLIKYPEAMKKAQDEVRSVIG-DKGYVSEEDIPNLPYLKAVIKESLRLEPVI 364

Query:   121 PLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAW-ENPEEFYPERFVDSC--IDF 177
             P+L+ RETI    I GY+IPAKT++ VNAWA+ RD  AW +NP EF PERF++    +DF
Sbjct:   365 PILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMNEHKGVDF 424

Query:   178 KGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGIT 237
             KGQ FEL+PFG+GRR+CP +++GIA V++  ANLLYKFDW +P G+K +D+  DV+ G+ 
Sbjct:   425 KGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKGIKPEDIKMDVMTGLA 484

Query:   238 MHKKNALSLLAKYH 251
             MHKK  L L    H
Sbjct:   485 MHKKEHLVLAPTKH 498
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA;IMP
GO:0009759 "indole glucosinolate biosynthetic process" evidence=IDA
GO:0000162 "tryptophan biosynthetic process" evidence=IMP
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0048830 "adventitious root development" evidence=TAS
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=RCA;IMP
GO:0052544 "defense response by callose deposition in cell wall" evidence=IMP
GO:0009682 "induced systemic resistance" evidence=IEP
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0006520 "cellular amino acid metabolic process" evidence=RCA
GO:0006546 "glycine catabolic process" evidence=RCA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0006733 "oxidoreduction coenzyme metabolic process" evidence=RCA
GO:0006766 "vitamin metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009072 "aromatic amino acid family metabolic process" evidence=RCA
GO:0009106 "lipoate metabolic process" evidence=RCA
GO:0009108 "coenzyme biosynthetic process" evidence=RCA
GO:0009117 "nucleotide metabolic process" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019748 "secondary metabolic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0044272 "sulfur compound biosynthetic process" evidence=RCA
GO:0009641 "shade avoidance" evidence=IMP
GO:0010114 "response to red light" evidence=IMP
TAIR|locus:2093531 CYP71B23 ""cytochrome P450, family 71, subfamily B, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093516 CYP71B20 ""cytochrome P450, family 71, subfamily B, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093511 CYP71B19 ""cytochrome P450, family 71, subfamily B, polypeptide 19"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079306 CYP71B35 ""cytochrome P450, family 71, subfamily B, polypeptide 35"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093501 CYP71B17 ""cytochrome P450, family 71, subfamily B, polypeptide 17"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079311 CYP71B36 ""cytochrome P450, family 71, subfamily B, polypeptide 36"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119500 CYP83A1 ""cytochrome P450, family 83, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 7e-98
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 5e-86
pfam00067461 pfam00067, p450, Cytochrome P450 4e-76
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 6e-76
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 7e-74
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 3e-73
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-65
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 5e-48
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 4e-42
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 3e-41
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-37
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 4e-36
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 6e-35
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 7e-30
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 1e-29
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 2e-27
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-27
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 2e-23
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-20
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-18
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 5e-18
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 3e-15
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 7e-15
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 2e-14
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 2e-14
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 7e-14
PLN02648480 PLN02648, PLN02648, allene oxide synthase 6e-09
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information 
 Score =  294 bits (754), Expect = 7e-98
 Identities = 138/254 (54%), Positives = 190/254 (74%), Gaps = 7/254 (2%)

Query: 1   ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSA 60
           EL++E LDPNR K E    E  ID+L+QI KD+ F +  T +++KA+++++ V GTDT+A
Sbjct: 249 ELLDETLDPNRPKQE---TESFIDLLMQIYKDQPFSIKFTHENVKAMILDIVVPGTDTAA 305

Query: 61  ATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTV 120
           A VVWAMTYL+K P AMKK Q E+R++IG +KG+V+E+D+  L YLKAV+KE++RL+P +
Sbjct: 306 AVVVWAMTYLIKYPEAMKKAQDEVRNVIG-DKGYVSEEDIPNLPYLKAVIKESLRLEPVI 364

Query: 121 PLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAW-ENPEEFYPERFVDS--CIDF 177
           P+L+ RETI    I GY+IPAKT++ VNAWA+ RD  AW +NP EF PERF+     +DF
Sbjct: 365 PILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMKEHKGVDF 424

Query: 178 KGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGIT 237
           KGQ FEL+PFG+GRR+CP +++GIA V++  ANLLYKFDW +P G+K +D+  DV+ G+ 
Sbjct: 425 KGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKGIKPEDIKMDVMTGLA 484

Query: 238 MHKKNALSLLAKYH 251
           MHKK  L L    H
Sbjct: 485 MHKKEHLVLAPTKH 498

Length = 499
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 252
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 100.0
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=5.5e-53  Score=374.03  Aligned_cols=238  Identities=50%  Similarity=0.871  Sum_probs=209.0

Q ss_pred             ccccccCcccCCCCCCCcchHHHHHHHhhhhcCCCCCCCHHHHHHHHHHHHHhcchhhHHHHHHHHHHHhhChHHHHHHH
Q 048189            2 LINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQ   81 (252)
Q Consensus         2 ~i~e~~~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~   81 (252)
                      +|+||++++ . .  +.++|++|.||+..++++... +++++|.+.+.++++||+|||++++.|++.+|++||++|+|++
T Consensus       250 ~i~eh~~~~-~-~--~~~~D~vD~lL~~~~~~~~~~-~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~q  324 (489)
T KOG0156|consen  250 IIDEHREKI-G-D--EEGRDFVDALLKLMKEEKAEG-LTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQ  324 (489)
T ss_pred             HHHHHHhhh-c-c--CCCCcHHHHHHHhhcccccCC-CCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHH
Confidence            577888876 2 2  133899999998866543333 9999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCCCChhhhccchhHHHHHHhhhcCCCCCCCCCcccccccccccCeeeCCCCEEEecchhhccCCCCCCC
Q 048189           82 QEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWEN  161 (252)
Q Consensus        82 ~Ei~~~~~~~~~~~~~~~~~~~~~l~a~i~E~lRl~p~~~~~~~r~~~~d~~i~g~~ip~g~~v~~~~~~~~~d~~~~~~  161 (252)
                      +||+++++. +..++.+++.++|||+|+|+|++|++|+.|..++|.+++|+.++||.||+||.|+++.|++|+||++|+|
T Consensus       325 eEId~vvG~-~r~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~d  403 (489)
T KOG0156|consen  325 EEIDEVVGK-GRLVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWED  403 (489)
T ss_pred             HHHHHHhCC-CCCCChhhhccCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCC
Confidence            999999997 4449999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCcccccccCCCCCCCcchHHHHHHHHHHHHHHHhhceeecCCCCCCCCCCcccCCceecccc
Q 048189          162 PEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKK  241 (252)
Q Consensus       162 p~~F~p~Rfl~~~~~~~~~~~~~~~fg~G~~~C~G~~~A~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (252)
                      |++|+||||++.+ +.+.....++|||.|+|.|||..+|++++.++++.++++|+|+.+++    .++++.. +.+...+
T Consensus       404 P~eF~PERFl~~~-d~~~~~~~~iPFG~GRR~CpG~~La~~~l~l~la~llq~F~w~~~~~----~~d~~e~-~~~~~~~  477 (489)
T KOG0156|consen  404 PEEFKPERFLDSN-DGKGLDFKLIPFGSGRRICPGEGLARAELFLFLANLLQRFDWKLPGG----KVDMEEA-GLTLKKK  477 (489)
T ss_pred             ccccChhhhcCCc-cccCCceEecCCCCCcCCCCcHHHHHHHHHHHHHHHHheeeeecCCC----CCCCccc-ccceecC
Confidence            9999999999985 33345678999999999999999999999999999999999999876    3456555 3555555


Q ss_pred             CceeeEeecc
Q 048189          242 NALSLLAKYH  251 (252)
Q Consensus       242 ~~~~v~~~~r  251 (252)
                      .++.+...+|
T Consensus       478 ~pl~~~~~~r  487 (489)
T KOG0156|consen  478 KPLKAVPVPR  487 (489)
T ss_pred             CcceeeeecC
Confidence            5777776665

>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 1e-29
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 5e-29
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 6e-25
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 2e-24
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 1e-23
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-23
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 1e-22
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 9e-22
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 1e-21
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-21
3pm0_A507 Structural Characterization Of The Complex Between 1e-21
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-21
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 3e-21
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-21
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 4e-21
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 4e-21
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 6e-21
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 6e-21
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 6e-21
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 7e-21
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 7e-21
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 1e-20
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-20
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-20
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 4e-20
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 5e-20
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 7e-20
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-19
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-19
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 3e-19
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 3e-19
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 3e-19
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 1e-18
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 2e-18
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 3e-17
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 3e-17
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 3e-17
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 3e-17
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 3e-17
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 4e-17
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 4e-17
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 3e-16
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 3e-16
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 2e-15
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 4e-15
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 3e-14
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-14
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 6e-14
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 6e-14
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 6e-14
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 6e-14
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 6e-14
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 6e-14
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 7e-14
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 7e-14
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 7e-14
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 7e-14
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 7e-14
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 7e-14
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-13
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-13
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-13
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 1e-13
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 1e-13
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 1e-13
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-13
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 2e-13
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-13
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 2e-13
1fah_A471 Structure Of Cytochrome P450 Length = 471 2e-13
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 2e-13
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 2e-13
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-13
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 2e-13
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 3e-13
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 3e-13
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 3e-13
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 3e-13
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-13
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 5e-13
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 6e-13
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 6e-13
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 7e-13
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 9e-13
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 1e-12
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-12
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 1e-11
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 1e-10
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 1e-10
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 2e-10
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 2e-10
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 2e-10
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 3e-09
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 4e-09
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 4e-09
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 4e-09
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 4e-09
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 4e-09
3b98_A475 Crystal Structure Of Zebrafish Prostacyclin Synthas 9e-09
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 6e-07
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 6e-07
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 6e-07
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 6e-07
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 6e-07
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 7e-07
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 1e-06
3abb_A408 Crystal Structure Of Cyp105d6 Length = 408 5e-06
1pkf_A419 Crystal Structure Of Epothilone D-Bound Cytochrome 7e-06
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 8e-06
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 9e-06
1q5d_A419 Epothilone B-Bound Cytochrome P450epok Length = 419 9e-06
1odo_A408 1.85 A Structure Of Cyp154a1 From Streptomyces Coel 1e-05
2rcm_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 2e-05
2rch_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 2e-05
1z8q_A404 Ferrous Dioxygen Complex Of The A245t Cytochrome P4 4e-05
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 5e-05
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 5e-05
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 7e-05
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 1e-04
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 4e-04
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 5e-04
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 5e-04
2bvj_A436 Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp1 5e-04
2whw_A436 Selective Oxidation Of Carbolide C-H Bonds By Engin 5e-04
2vz7_A436 Crystal Structure Of The Yc-17-Bound Pikc D50n Muta 5e-04
2iag_A482 Crystal Structure Of Human Prostacyclin Synthase Le 6e-04
1gwi_A411 The 1.92 A Structure Of Streptomyces Coelicolor A3( 6e-04
3b6h_A498 Crystal Structure Of Human Prostacyclin Synthase In 6e-04
3dam_A473 Crystal Structure Of Allene Oxide Synthase Length = 8e-04
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure 
Iteration: 1

 Score =  126 bits (316), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 120/225 (53%), Gaps = 11/225 (4%)
Query: 20  EDIIDILLQIRK----DRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPR 75
            DI D L++  +    D    V L+ + I  +++++F AG DT    + W++ YL+ NPR
Sbjct: 252 RDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPR 311
Query: 76  AMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVID 135
             +K+Q+E+ ++IG ++      D   L Y++A + ET R    VP  +P  T     + 
Sbjct: 312 VQRKIQEELDTVIGRSRR-PRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLK 370
Query: 136 GYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFV--DSCIDFKGQHFELIPFGAGRRI 193
           G+ IP    VFVN W I  D + W NP EF PERF+  D  ID K    ++I FG G+R 
Sbjct: 371 GFYIPKGRCVFVNQWQINHDQKLWVNPSEFLPERFLTPDGAID-KVLSEKVIIFGMGKRK 429
Query: 194 CPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITM 238
           C G  +    V L LA LL + ++ +P G+K   +D   + G+TM
Sbjct: 430 CIGETIARWEVFLFLAILLQRVEFSVPLGVK---VDMTPIYGLTM 471
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3B98|A Chain A, Crystal Structure Of Zebrafish Prostacyclin Synthase (Cytochrome P450 8a1) Length = 475 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|3ABB|A Chain A, Crystal Structure Of Cyp105d6 Length = 408 Back     alignment and structure
>pdb|1PKF|A Chain A, Crystal Structure Of Epothilone D-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|1Q5D|A Chain A, Epothilone B-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|1ODO|A Chain A, 1.85 A Structure Of Cyp154a1 From Streptomyces Coelicolor A3(2) Length = 408 Back     alignment and structure
>pdb|2RCM|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 74a) At 1.73 A Resolution Length = 495 Back     alignment and structure
>pdb|2RCH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase (Aos, Cytochrome P450 74a, Cyp74a) Complexed With 13(S)-Hod At 1.85 A Resolution Length = 495 Back     alignment and structure
>pdb|1Z8Q|A Chain A, Ferrous Dioxygen Complex Of The A245t Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|2BVJ|A Chain A, Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp107l1) Length = 436 Back     alignment and structure
>pdb|2WHW|A Chain A, Selective Oxidation Of Carbolide C-H Bonds By Engineered Macrolide P450 Monooxygenase Length = 436 Back     alignment and structure
>pdb|2VZ7|A Chain A, Crystal Structure Of The Yc-17-Bound Pikc D50n Mutant Length = 436 Back     alignment and structure
>pdb|2IAG|A Chain A, Crystal Structure Of Human Prostacyclin Synthase Length = 482 Back     alignment and structure
>pdb|1GWI|A Chain A, The 1.92 A Structure Of Streptomyces Coelicolor A3(2) Cyp154c1: A New Monooxygenase That Functionalizes Macrolide Ring Systems Length = 411 Back     alignment and structure
>pdb|3B6H|A Chain A, Crystal Structure Of Human Prostacyclin Synthase In Complex With Inhibitor Minoxidil Length = 498 Back     alignment and structure
>pdb|3DAM|A Chain A, Crystal Structure Of Allene Oxide Synthase Length = 473 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-100
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 9e-97
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-90
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-89
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 3e-68
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-67
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-66
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-65
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-62
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-61
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-61
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-61
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-59
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 3e-59
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 7e-59
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 7e-59
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-58
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 3e-58
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-57
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-57
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 9e-57
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-56
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 9e-52
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-49
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 5e-49
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-42
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-41
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 8e-41
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 3e-40
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 9e-14
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 2e-12
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 1e-11
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 3e-11
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 4e-11
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 5e-11
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 6e-11
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 6e-11
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 7e-11
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 8e-11
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 9e-11
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 1e-10
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 1e-10
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 2e-10
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 2e-10
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 2e-10
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 2e-10
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 2e-10
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 3e-10
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 3e-10
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 4e-10
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 5e-10
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 5e-10
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 7e-10
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 1e-09
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 2e-09
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 3e-09
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 3e-09
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 4e-09
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 5e-09
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 2e-08
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-08
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 2e-08
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 2e-08
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 3e-08
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 3e-08
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 4e-08
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 2e-07
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 3e-07
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 8e-07
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 1e-05
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 2e-05
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 4e-05
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 4e-05
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 1e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  299 bits (767), Expect = e-100
 Identities = 60/246 (24%), Positives = 104/246 (42%), Gaps = 15/246 (6%)

Query: 1   ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSA 60
                       + +     D   IL ++  D      ++ + IKA +  +   G DT++
Sbjct: 239 IYTQNFYW--ELRQKGSVHHDYRGILYRLLGDS----KMSFEDIKANVTEMLAGGVDTTS 292

Query: 61  ATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTV 120
            T+ W +  + +N +    ++ E+ +             +Q +  LKA +KET+RL P  
Sbjct: 293 MTLQWHLYEMARNLKVQDMLRAEVLAARH-QAQGDMATMLQLVPLLKASIKETLRLHPIS 351

Query: 121 PLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQ 180
             L  R  +   V+  Y IPAKTLV V  +A+GR+P  + +PE F P R++    D    
Sbjct: 352 VTL-QRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSK--DKNIT 408

Query: 181 HFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHK 240
           +F  + FG G R C G  +    + + L N+L  F  E+         D      + +  
Sbjct: 409 YFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLS-----DVGTTFNLILMP 463

Query: 241 KNALSL 246
           +  +S 
Sbjct: 464 EKPISF 469
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=8.1e-52  Score=368.18  Aligned_cols=230  Identities=26%  Similarity=0.450  Sum_probs=198.0

Q ss_pred             CcchHHHHHHHhhhh--cCCCCCCCHHHHHHHHHHHHHhcchhhHHHHHHHHHHHhhChHHHHHHHHHHHHHhcCCCCCC
Q 048189           18 QPEDIIDILLQIRKD--RGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFV   95 (252)
Q Consensus        18 ~~~d~l~~ll~~~~~--~~~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~~~~~~~   95 (252)
                      ..+|+++.++.....  .+....++++++..+++.+++||+|||+.+++|++++|+.||++|++|++|++.+++. +..+
T Consensus       245 ~~~d~~~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~-~~~~  323 (479)
T 3tbg_A          245 PPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQ-VRRP  323 (479)
T ss_dssp             CCCSHHHHHHHHHHHTTTCTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCS-SSCC
T ss_pred             ccchhhhhhhhhhhhcccCCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhh-cccc
Confidence            456788777755332  2334569999999999999999999999999999999999999999999999999876 6778


Q ss_pred             ChhhhccchhHHHHHHhhhcCCCCCCCCCcccccccccccCeeeCCCCEEEecchhhccCCCCCCCCCCCCCCCCCCCCC
Q 048189           96 NEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCI  175 (252)
Q Consensus        96 ~~~~~~~~~~l~a~i~E~lRl~p~~~~~~~r~~~~d~~i~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~p~Rfl~~~~  175 (252)
                      +.+++.++||++|||+|++|++|+++...+|.+.+|++++||.||+|+.|+++.+++|+||++|+||++|+||||++.++
T Consensus       324 ~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~  403 (479)
T 3tbg_A          324 EMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQG  403 (479)
T ss_dssp             CHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTC
T ss_pred             chhhhccccccccceeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCc
Confidence            99999999999999999999999999888778889999999999999999999999999999999999999999998765


Q ss_pred             CCCCCcccccccCCCCCCCcchHHHHHHHHHHHHHHHhhceeecCCCCCCCCCCcccCCceeccccCceeeEeeccC
Q 048189          176 DFKGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAKYHE  252 (252)
Q Consensus       176 ~~~~~~~~~~~fg~G~~~C~G~~~A~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~r~  252 (252)
                      ... .+..|+|||+|+|.|+|++||.+|+++++|.||++|+|+++++.+  .+......+++..|+ +++|++++|.
T Consensus       404 ~~~-~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~--~~~~~~~~~~~~~P~-~~~v~~~pRs  476 (479)
T 3tbg_A          404 HFV-KPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQP--RPSHHGVFAFLVSPS-PYELCAVPRH  476 (479)
T ss_dssp             CBC-CCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTSC--CCCSCEEESSSEEEC-CCCBEEEEC-
T ss_pred             ccC-CCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCCC--CccccccceeeecCC-CeEEEEEECC
Confidence            433 356799999999999999999999999999999999999987753  223333334555554 6788888773
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 252
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-43
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-42
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 6e-40
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-31
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 3e-28
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-22
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 4e-22
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 6e-20
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 5e-19
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-16
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 1e-15
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 6e-15
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 6e-14
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 7e-14
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 2e-13
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 2e-13
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 3e-12
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 5e-12
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 4e-11
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 5e-11
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 7e-11
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  150 bits (380), Expect = 2e-43
 Identities = 58/242 (23%), Positives = 103/242 (42%), Gaps = 5/242 (2%)

Query: 1   ELINEHLDPNRTKSELPQPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSA 60
           + + +H          P+    + +L   +       +    ++   ++++F AGT+T++
Sbjct: 220 QSVEKH--RATLDPSNPRDFIDVYLLRMEKDKSDPSSEFHHQNLILTVLSLFFAGTETTS 277

Query: 61  ATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTV 120
            T+ +    ++K P   ++VQ+EI  +IG +      DD  ++ Y  AV+ E  RL   +
Sbjct: 278 TTLRYGFLLMLKYPHVTERVQKEIEQVIGSH-RPPALDDRAKMPYTDAVIHEIQRLGDLI 336

Query: 121 PLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQ 180
           P  VP    +     GY IP  T VF    +   DP  +E P  F P  F+D+    K +
Sbjct: 337 PFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGALK-R 395

Query: 181 HFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHK 240
           +   +PF  G+RIC G  +    + L    +L  F    P   +  DL      G+    
Sbjct: 396 NEGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPEDIDLTPRE-SGVGNVP 454

Query: 241 KN 242
            +
Sbjct: 455 PS 456
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.97
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=4.2e-50  Score=352.11  Aligned_cols=228  Identities=24%  Similarity=0.442  Sum_probs=198.2

Q ss_pred             CcchHHHHHHHhhhhcCCCCCCCHHHHHHHHHHHHHhcchhhHHHHHHHHHHHhhChHHHHHHHHHHHHHhcCCCCCCCh
Q 048189           18 QPEDIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNE   97 (252)
Q Consensus        18 ~~~d~l~~ll~~~~~~~~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~~~~~~~~~   97 (252)
                      .++|+++.+++...+.+ ...+++++++.+++.+++||++||+.+++|++++|+.||++|++|++|++.+++. +..++.
T Consensus       217 ~~~dll~~ll~~~~~~~-~~~ls~~ei~~~~~~ll~ag~~tt~~~l~~~l~~L~~~p~~~~~lr~Ei~~~~~~-~~~~~~  294 (445)
T d2ciba1         217 SDRDMLDVLIAVKAETG-TPRFSADEITGMFISMMFAGHHTSSGTASWTLIELMRHRDAYAAVIDELDELYGD-GRSVSF  294 (445)
T ss_dssp             -CCCHHHHHHHCBCTTS-SBSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHGGG-CCCHHH
T ss_pred             cccchhhhhhccccccc-cccCCcchhhhhhhhhhhhccccchhhcccccccccccccccccccccccccccc-cccchh
Confidence            46799999998754432 3469999999999999999999999999999999999999999999999999875 667889


Q ss_pred             hhhccchhHHHHHHhhhcCCCCCCCCCcccccccccccCeeeCCCCEEEecchhhccCCCCCCCCCCCCCCCCCCCCCCC
Q 048189           98 DDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDF  177 (252)
Q Consensus        98 ~~~~~~~~l~a~i~E~lRl~p~~~~~~~r~~~~d~~i~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~p~Rfl~~~~~~  177 (252)
                      +++.++|||+++++|++|++|+++. ..|.+++|+.+.|+.||+|+.|+++.+.+|+|+++|+||++|+||||+++..+.
T Consensus       295 ~~l~~lp~L~a~i~E~lRl~p~~~~-~~~~~~~~~~~~~~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~PeRf~~~~~~~  373 (445)
T d2ciba1         295 HALRQIPQLENVLKETLRLHPPLII-LMRVAKGEFEVQGHRIHEGDLVAASPAISNRIPEDFPDPHDFVPARYEQPRQED  373 (445)
T ss_dssp             HTTSCCHHHHHHHHHHHHHSCSCCC-EEEEECSCEEETTEEECTTCEEEECHHHHTTCTTTSSSTTSCCGGGGSTTTCHH
T ss_pred             hhcccchhhccccccccccccccce-eccccccccccceeeccccccccccccccccCcccCCChhhCCcccccCccccc
Confidence            9999999999999999999999987 568899999999999999999999999999999999999999999999865544


Q ss_pred             CCCcccccccCCCCCCCcchHHHHHHHHHHHHHHHhhceeecCCCCCCCCCCcccCCceeccccCceeeEeecc
Q 048189          178 KGQHFELIPFGAGRRICPGLNMGIATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAKYH  251 (252)
Q Consensus       178 ~~~~~~~~~fg~G~~~C~G~~~A~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~r  251 (252)
                      ...++.|+|||+|+|.|||++||..|++++++.|+++|+|+++++.  +..... ...++..++.++.|++++|
T Consensus       374 ~~~~~~~~pFG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~--~~~~~~-~~~~~~~~~~~~~v~~~~R  444 (445)
T d2ciba1         374 LLNRWTWIPFGAGRHRCVGAAFAIMQIKAIFSVLLREYEFEMAQPP--ESYRND-HSKMVVQLAQPAAVRYRRR  444 (445)
T ss_dssp             HHCTTTCCTTCCGGGCCTTHHHHHHHHHHHHHHHHHHEEEEESSCG--GGCCEE-CSSSSCEECSCCEEEEEEC
T ss_pred             cCCCCcccCCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEECCCC--Cccccc-cceEEEccCCCEEEEEEeC
Confidence            4456679999999999999999999999999999999999987643  221221 2234445566899999998
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure