Citrus Sinensis ID: 048263

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MRKCSHCGHNGHNSRTCHAKGCFKLFGVNILDQIQDLPSMKKSVKKSYSVGNLQSLGGEFNGHVDEGREFDGDVDEGYLSDGPIHTKHERKRGKPWTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYFLRQASSDKKNRRTSLFDMPLKESGSTSSQAMNGFPNLCSDLVVPVPATTGLAYYHHGIPYMVRINLI
ccccccccccccccccccccccEEEEEEEEEcccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccEEEEEEEEEcccccccccccHHcccccccccHcccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHccccccccccccEEcccHHHHHHHHHHHHHHHcccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccc
mrkcshcghnghnsrtchakgcfKLFGVNIldqiqdlpsmkksvkksysvgnlqslggefnghvdegrefdgdvdegylsdgpihtkherkrgkpwteAEHRVFLEGLkllgkgdwkgisknfvttrtptqvASHAQKYFLRQAssdkknrrtslfdmplkesgstssqamngfpnlcsdlvvpvpattglayyhhgiPYMVRINLI
mrkcshcghnghnsrtchAKGCFKLFGVNILDQIQDLPSMKKSVKKSYSVGNLQSLGGEFNGHVDEGREFDGDVDEGYlsdgpihtkherkrgkpwteaEHRVFLEGlkllgkgdWKGISKNFVTTRTPTQVASHAQKYFlrqassdkknrrtSLFDMPLKESGSTSSQAMNGFPNLCSDLVVPVPATTGlayyhhgipYMVRINLI
MRKCSHCGHNGHNSRTCHAKGCFKLFGVNILDQIQDLPsmkksvkksysvGNLQSLGGEFNGHVDEGREFDGDVDEGYLSDGPIHTKHERKRGKPWTEAEHRVFleglkllgkgdwkgISKNFVTTRTPTQVASHAQKYFLRQASSDKKNRRTSLFDMPLKESGSTSSQAMNGFPNLCSDLVVPVPATTGLAYYHHGIPYMVRINLI
**************RTCHAKGCFKLFGVNILDQIQDL**********************************************************WTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYF*********************************FPNLCSDLVVPVPATTGLAYYHHGIPYMVRIN**
*RKCSHCGHNGHNSRTCHAKGCFKLFGVNI**********************************************************************HRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKY****************************************************************IN*I
************NSRTCHAKGCFKLFGVNILDQIQDLPSMKKSVKKSYSVGNLQSLGGEFNGHVDEGREFDGDVDEGYLSDGPIHTKHERKRGKPWTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYFLRQASSDKKNRRTSLFDMPL*********AMNGFPNLCSDLVVPVPATTGLAYYHHGIPYMVRINLI
**************RTCHAKGCFKLFGVNILDQ**********************************************************RGKPWTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYFLRQAS**************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKCSHCGHNGHNSRTCHAKGCFKLFGVNILDQIQDLPSMKKSVKKSYSVGNLQSLGGEFNGHVDEGREFDGDVDEGYLSDGPIHTKHERKRGKPWTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYFLRQASSDKKNRRTSLFDMPLKESGSTSSQAMNGFPNLCSDLVVPVPATTGLAYYHHGIPYMVRINLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query207 2.2.26 [Sep-21-2011]
Q8S9H7307 Transcription factor DIVA N/A no 0.352 0.237 0.657 8e-23
Q2V9B0297 Transcription factor MYB1 N/A no 0.425 0.296 0.584 9e-21
Q869R9 734 Myb-like protein J OS=Dic yes no 0.362 0.102 0.5 6e-12
Q54HX6 977 Myb-like protein I OS=Dic no no 0.256 0.054 0.518 2e-08
Q6R0H0 287 Transcription factor ASG4 no no 0.217 0.156 0.574 1e-06
Q54IF9 423 Myb-like protein G OS=Dic no no 0.241 0.118 0.480 1e-06
P92973 608 Protein CCA1 OS=Arabidops no no 0.256 0.087 0.431 2e-05
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.265 0.085 0.416 2e-05
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.217 0.036 0.391 0.0003
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function desciption
 Score =  107 bits (266), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 48/73 (65%), Positives = 58/73 (79%)

Query: 86  TKHERKRGKPWTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYFLRQAS 145
           ++ ERK+G PWTE EH++FL GLK  GKGDW+ IS+NFV TRTPTQVASHAQKYF+RQ S
Sbjct: 124 SEQERKKGVPWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKYFIRQLS 183

Query: 146 SDKKNRRTSLFDM 158
             K  RR S+ D+
Sbjct: 184 GGKDKRRASIHDI 196
Involved in the dorsovental asymmetry of flowers. Promotes ventral identity.
Antirrhinum majus (taxid: 4151)
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function description
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
255539909 333 conserved hypothetical protein [Ricinus 0.908 0.564 0.485 8e-50
225454987205 PREDICTED: transcription factor MYB1R1-l 0.753 0.760 0.550 1e-46
147815382202 hypothetical protein VITISV_005733 [Viti 0.879 0.900 0.509 3e-45
297793719 321 myb family transcription factor [Arabido 0.753 0.485 0.569 1e-42
116792204 331 unknown [Picea sitchensis] 0.792 0.495 0.534 3e-42
15240300 317 myb-like transcription factor family pro 0.753 0.492 0.563 9e-42
297744979185 unnamed protein product [Vitis vinifera] 0.695 0.778 0.524 1e-41
224053685 344 predicted protein [Populus trichocarpa] 0.758 0.456 0.55 4e-41
410717232 331 myb-related protein [Pinus sylvestris] g 0.777 0.486 0.538 8e-41
410717296 331 myb-related protein [Pinus sylvestris] 0.777 0.486 0.538 9e-41
>gi|255539909|ref|XP_002511019.1| conserved hypothetical protein [Ricinus communis] gi|223550134|gb|EEF51621.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 149/249 (59%), Gaps = 61/249 (24%)

Query: 2   RKCSHCGHNGHNSRTCHAKG--CFKLFGVNILDQIQDLPSMKKSVKKSYSVGNLQSLGGE 59
           RKCSHCGHNGHNSRTC  KG  C KLFGV I+++       +K +++S S+GNL SL   
Sbjct: 8   RKCSHCGHNGHNSRTCSGKGGGCLKLFGVKIIEK------QEKPIQRSVSLGNLDSL--- 58

Query: 60  FNGHVDEGREFDGDVDE-GYLSDGPIHTK-----HERKRGKPWTEAEHRVFLEGLKLLGK 113
                D G     D  + GY+SDG I +K     H+RK+GKPWTE EHR+FLEGL  LGK
Sbjct: 59  ----PDTGDADHHDHADDGYMSDGYIDSKRCKAAHKRKKGKPWTEEEHRIFLEGLDKLGK 114

Query: 114 GDWKGISKNFVTTRTPTQVASHAQKYFLRQASSDKKNRRTSLFDMPLKESGSTS------ 167
           GDW+GISKNFVTTRTPTQVASHAQKYFLRQ+++DKK RR+SLFDM L+ES   S      
Sbjct: 115 GDWRGISKNFVTTRTPTQVASHAQKYFLRQSAADKKKRRSSLFDMTLRESVLASQPQELS 174

Query: 168 -------------------------------SQAMNGFPNLCSDLVVPV--PATTGLAYY 194
                                          +Q +N FP+L  D  VP+  P+   +A  
Sbjct: 175 IFPASTSSQATTSSALPLKKTTEVQSNVITRAQVINKFPHLFLDNPVPMANPSVVPIAVS 234

Query: 195 HH-GIPYMV 202
            + GIPYM+
Sbjct: 235 SYAGIPYML 243

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225454987|ref|XP_002278155.1| PREDICTED: transcription factor MYB1R1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147815382|emb|CAN76720.1| hypothetical protein VITISV_005733 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297793719|ref|XP_002864744.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata] gi|297310579|gb|EFH41003.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|116792204|gb|ABK26274.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|15240300|ref|NP_200970.1| myb-like transcription factor family protein [Arabidopsis thaliana] gi|9758477|dbj|BAB09006.1| unnamed protein product [Arabidopsis thaliana] gi|332010115|gb|AED97498.1| myb-like transcription factor family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297744979|emb|CBI38571.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224053685|ref|XP_002297928.1| predicted protein [Populus trichocarpa] gi|222845186|gb|EEE82733.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|410717232|gb|AFV78992.1| myb-related protein [Pinus sylvestris] gi|410717364|gb|AFV79058.1| myb-related protein [Pinus sylvestris] Back     alignment and taxonomy information
>gi|410717296|gb|AFV79024.1| myb-related protein [Pinus sylvestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
TAIR|locus:2151621317 AT5G61620 [Arabidopsis thalian 0.816 0.533 0.473 6.7e-33
TAIR|locus:2094942 387 AT3G16350 [Arabidopsis thalian 0.478 0.255 0.518 6.3e-30
TAIR|locus:2171519 365 AT5G47390 [Arabidopsis thalian 0.753 0.427 0.432 2.4e-28
TAIR|locus:2020653261 AT1G70000 [Arabidopsis thalian 0.826 0.655 0.382 4.6e-25
TAIR|locus:2165106233 AT5G56840 [Arabidopsis thalian 0.797 0.708 0.406 1.2e-24
TAIR|locus:2175478215 AT5G04760 [Arabidopsis thalian 0.396 0.381 0.524 2.5e-17
TAIR|locus:2042872298 AT2G38090 [Arabidopsis thalian 0.347 0.241 0.555 4.1e-17
TAIR|locus:2027181265 AT1G74840 [Arabidopsis thalian 0.637 0.498 0.394 6.7e-17
UNIPROTKB|Q8S9H7307 DIVARICATA "Transcription fact 0.444 0.299 0.468 2.9e-16
TAIR|locus:2154508288 AT5G58900 [Arabidopsis thalian 0.338 0.243 0.557 6e-16
TAIR|locus:2151621 AT5G61620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 6.7e-33, P = 6.7e-33
 Identities = 89/188 (47%), Positives = 103/188 (54%)

Query:     2 RKCSHCGHNGHNSRTCHA---KGCFKLFGVNIL-DQIQDLPXXXXXXXXXXXXGNLQSL- 56
             + CSHCGHNGHN+RTC     K   KLFGVNI  D I+  P            GNL +L 
Sbjct:    10 KTCSHCGHNGHNARTCLNGVNKASVKLFGVNISSDPIR--PPEVTALRKSLSLGNLDALL 67

Query:    57 -GGEFNGHVDEGREFDGDVDEGYLSDGPIHTK-----HERKRGKPWTEAEHRVFXXXXXX 110
                E NG  D     D   D GY SDG IH+K     HE+K+GKPWTE EHR F      
Sbjct:    68 ANDESNGSGDPIAAVD---DTGYHSDGQIHSKKGKTAHEKKKGKPWTEEEHRNFLIGLNK 124

Query:   111 XXXXXXXXISKNFVTTRTPTQVASHAQKYFLRQASSDKKNRRTSLFDMPL---KESGSTS 167
                     I+K+FV+TRTPTQVASHAQKYF+R   +DK+ RR SLFD+ L   KE    S
Sbjct:   125 LGKGDWRGIAKSFVSTRTPTQVASHAQKYFIRLNVNDKRKRRASLFDISLEDQKEKERNS 184

Query:   168 SQAMNGFP 175
               A    P
Sbjct:   185 QDASTKTP 192
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2094942 AT3G16350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171519 AT5G47390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020653 AT1G70000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165106 AT5G56840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175478 AT5G04760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027181 AT1G74840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 6e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 6e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 8e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-08
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 8e-04
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 68.6 bits (168), Expect = 6e-16
 Identities = 25/57 (43%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 91  KRGKPWTEAEHRVFLEGLKLLGKGDW---KGISKNFVTTR-TPTQVASHAQKYFLRQ 143
           K    WTE  H  FL+ ++ LG  DW   K I +  V    T  QVASH QKY L+Q
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.73
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.6
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.35
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.33
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.15
PLN03212 249 Transcription repressor MYB5; Provisional 99.06
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 99.02
PLN03091 459 hypothetical protein; Provisional 98.95
PLN03212249 Transcription repressor MYB5; Provisional 98.84
KOG0048 238 consensus Transcription factor, Myb superfamily [T 98.73
PLN03091 459 hypothetical protein; Provisional 98.62
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.55
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 98.52
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.39
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.25
KOG1279 506 consensus Chromatin remodeling factor subunit and 98.17
KOG4329445 consensus DNA-binding protein [General function pr 98.06
KOG0724335 consensus Zuotin and related molecular chaperones 98.05
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.61
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.01
PLN03162 526 golden-2 like transcription factor; Provisional 97.01
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.55
COG5147 512 REB1 Myb superfamily proteins, including transcrip 96.22
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 96.04
KOG0051 607 consensus RNA polymerase I termination factor, Myb 95.96
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 95.54
KOG4468 782 consensus Polycomb-group transcriptional regulator 95.45
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 95.43
KOG4167 907 consensus Predicted DNA-binding protein, contains 95.38
KOG0051607 consensus RNA polymerase I termination factor, Myb 95.14
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.05
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 94.93
KOG3841 455 consensus TEF-1 and related transcription factor, 94.93
PF1528840 zf-CCHC_6: Zinc knuckle 94.74
COG5147 512 REB1 Myb superfamily proteins, including transcrip 93.93
PLN031421033 Probable chromatin-remodeling complex ATPase chain 93.89
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.25
smart0042668 TEA TEA domain. 93.06
PF1439249 zf-CCHC_4: Zinc knuckle 93.04
KOG0724 335 consensus Zuotin and related molecular chaperones 93.02
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 92.02
KOG4282 345 consensus Transcription factor GT-2 and related pr 91.79
KOG1194 534 consensus Predicted DNA-binding protein, contains 91.35
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 91.06
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 89.6
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 88.92
PLN031421033 Probable chromatin-remodeling complex ATPase chain 88.91
PRK13923170 putative spore coat protein regulator protein YlbO 88.19
PF06461145 DUF1086: Domain of Unknown Function (DUF1086); Int 86.79
smart0034326 ZnF_C2HC zinc finger. 86.68
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.73  E-value=6e-18  Score=119.48  Aligned_cols=53  Identities=47%  Similarity=0.649  Sum_probs=47.7

Q ss_pred             cCCCCCCHHHHHHHHHHHHHhCCCCH---HHHHhhhcCCC-CHHHHHHHHHHHHHHh
Q 048263           91 KRGKPWTEAEHRVFLEGLKLLGKGDW---KGISKNFVTTR-TPTQVASHAQKYFLRQ  143 (207)
Q Consensus        91 k~~~~WTeEEh~~FL~gLkkyGkGdW---k~IAk~~V~TR-T~~QVrsHaQKYf~rl  143 (207)
                      |.+..||+|||++||+||+.||.|+|   +.|++.++.++ |+.||++|+||||+++
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k~   57 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ   57 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHccC
Confidence            45789999999999999999999999   99997455578 9999999999999864

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF06461 DUF1086: Domain of Unknown Function (DUF1086); InterPro: IPR009462 This entry represents several eukaryotic domains of unknown function, which are present in chromodomain helicase DNA binding proteins Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 1e-23
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 2e-19
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 3e-15
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-14
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-11
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 6e-10
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 6e-10
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-09
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 4e-08
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 6e-08
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 3e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-05
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 2e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 4e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 6e-05
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 2e-04
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 2e-04
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 3e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 88.7 bits (220), Expect = 1e-23
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 2/69 (2%)

Query: 86  TKHERKRGKPWTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYFLRQAS 145
           +         WT  E  +F +GL   G+  W  ISK  + +RT  QV S+A++YF  +  
Sbjct: 2   SSGSSGYSVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKVK 59

Query: 146 SDKKNRRTS 154
                   +
Sbjct: 60  CGLDKETPN 68
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.74
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.65
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.65
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.64
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.61
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.6
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.58
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.55
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.53
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.53
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.52
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.51
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.48
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.43
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.07
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.36
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.35
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.35
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.34
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.33
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.32
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.32
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.3
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.29
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.28
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.27
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.26
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.24
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.24
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.23
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.23
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.22
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.22
2crg_A70 Metastasis associated protein MTA3; transcription 99.21
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.19
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.16
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.15
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.12
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.08
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.04
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.01
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.97
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.96
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.82
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.78
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.11
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.63
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.61
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.59
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 97.58
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.5
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.02
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.93
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.93
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.81
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 96.35
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.29
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.57
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.88
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 94.54
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 93.96
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 92.87
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 90.97
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 90.09
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 86.61
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 85.91
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 85.73
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 85.57
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 84.74
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 83.25
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 83.1
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 82.69
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 82.1
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 80.95
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.74  E-value=8.5e-18  Score=120.45  Aligned_cols=66  Identities=29%  Similarity=0.476  Sum_probs=60.1

Q ss_pred             ccCCCCCCHHHHHHHHHHHHHhCCCCHHHHHhhhcCCCCHHHHHHHHHHHHHHhccccccccCCCccc
Q 048263           90 RKRGKPWTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYFLRQASSDKKNRRTSLFD  157 (207)
Q Consensus        90 rk~~~~WTeEEh~~FL~gLkkyGkGdWk~IAk~~V~TRT~~QVrsHaQKYf~rl~~~~k~krrsSl~d  157 (207)
                      ..++++||+|||++|++++++||. +|..||+ +|++||..||++||++||.+..+.+..+++++|++
T Consensus         6 ~~~~~~WT~eEd~~l~~~~~~~G~-~W~~Ia~-~~~~Rt~~q~k~r~~~~l~~~~~~g~~~~~~si~s   71 (72)
T 2cu7_A            6 SGYSVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKT   71 (72)
T ss_dssp             SSCCCCCCHHHHHHHHHHHHHTCS-CHHHHHH-HHSSSCHHHHHHHHHHHHHHHSCSCTTCCCSCCCC
T ss_pred             CcCCCCCCHHHHHHHHHHHHHHCc-CHHHHHH-HcCCCCHHHHHHHHHHHHHHHHhcCCCCCcccccc
Confidence            345789999999999999999999 9999997 99999999999999999999988777778888765
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 1e-16
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 1e-13
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-08
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-07
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 2e-07
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 8e-07
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 5e-05
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-04
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.003
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 68.8 bits (168), Expect = 1e-16
 Identities = 18/58 (31%), Positives = 23/58 (39%), Gaps = 3/58 (5%)

Query: 89  ERKRGKPWTEAEHRVFLEGLKLLGKGDW--KGISKN-FVTTRTPTQVASHAQKYFLRQ 143
           ++K    WT   H  FL  +  LG      K I     V   T   VASH QK+ +  
Sbjct: 3   QKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.71
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.62
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.59
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.59
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.58
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.51
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.46
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.46
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.45
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.44
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.44
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.44
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.38
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.25
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.2
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.87
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.63
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.94
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.67
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.53
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.28
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 93.75
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 91.69
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 87.74
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 87.54
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Transcriptional adaptor 2-like, TADA2L, isoform b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.71  E-value=5.2e-18  Score=112.33  Aligned_cols=45  Identities=31%  Similarity=0.632  Sum_probs=43.6

Q ss_pred             CCCHHHHHHHHHHHHHhCCCCHHHHHhhhcCCCCHHHHHHHHHHHH
Q 048263           95 PWTEAEHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYF  140 (207)
Q Consensus        95 ~WTeEEh~~FL~gLkkyGkGdWk~IAk~~V~TRT~~QVrsHaQKYf  140 (207)
                      .||+|||.+|+++|++||.++|..||+ +|++||+.||+.||++||
T Consensus         3 ~Wt~eEd~~L~~~v~~~G~~nW~~Ia~-~~~~Rt~~Qcr~r~~~~f   47 (47)
T d1x41a1           3 SWTAQEEMALLEAVMDCGFGNWQDVAN-QMCTKTKEECEKHYMKYF   47 (47)
T ss_dssp             SSCHHHHHHHHHHHHHTCTTCHHHHHH-HHTTSCHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHCCccHHHHHH-HcCCCCHHHHHHHHHHhC
Confidence            599999999999999999999999996 999999999999999997
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure