Citrus Sinensis ID: 048356

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MGSNGTVTELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQVVGYVMYAWPTSLSASITKLA
cccccEEEEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccEEEEEEccEEEEEEEEEEcccccccccccc
cccccEEEEEccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccEEEEEcccEEEEEEEEEccccHHHHHHHcc
MGSNGTVTELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQVVGYVMYAWPTSLSASITKLA
mgsngtvtelqrnstnwtvVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQVVGYVMYAWPTSLSASITKLA
MGSNGTVTELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQVVGYVMYAWPTSLSASITKLA
**************TNWTVVVDEIVKMEKKIFPKH*************KNSGLLYIHIHGQVVGYVMYAWPTSL********
****GTV**LQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQVVGYVMYAWPTSLSASITKLA
**********QRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQVVGYVMYAWPTSLSASITKLA
**SNGTVTELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQVVGYVMYAWPTSLSASITKLA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSNGTVTELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQVVGYVMYAWPTSLSASITKLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
255553793156 ribosomal-protein-alanine acetyltransfer 1.0 0.525 0.743 5e-28
224124540153 predicted protein [Populus trichocarpa] 0.987 0.529 0.731 5e-28
449444352154 PREDICTED: uncharacterized N-acetyltrans 0.975 0.519 0.662 2e-27
147856839158 hypothetical protein VITISV_004799 [Viti 0.975 0.506 0.740 2e-27
225446926158 PREDICTED: uncharacterized N-acetyltrans 0.975 0.506 0.740 2e-27
449525682154 PREDICTED: uncharacterized N-acetyltrans 0.975 0.519 0.662 5e-27
15218861158 Acyl-CoA N-acyltransferases -like protei 0.951 0.493 0.679 8e-25
297848582158 hypothetical protein ARALYDRAFT_311459 [ 0.951 0.493 0.692 8e-25
358345131154 N-acetyltransferase, putative [Medicago 0.939 0.5 0.65 3e-22
356542932154 PREDICTED: putative ribosomal-protein-al 0.902 0.480 0.662 6e-22
>gi|255553793|ref|XP_002517937.1| ribosomal-protein-alanine acetyltransferase, putative [Ricinus communis] gi|223542919|gb|EEF44455.1| ribosomal-protein-alanine acetyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%)

Query: 1  MGSNGTVTELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHG 60
          M S  TVTELQRNSTN   +V EIVKME+KIFPKHESLA  FDEELKKKNSGLLY+ ++ 
Sbjct: 1  MESGITVTELQRNSTNGANIVREIVKMERKIFPKHESLAGFFDEELKKKNSGLLYVELNS 60

Query: 61 QVVGYVMYAWPTSLSASITKLA 82
          +V+GYVMY+WP+SL ASITKLA
Sbjct: 61 EVIGYVMYSWPSSLCASITKLA 82

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224124540|ref|XP_002319357.1| predicted protein [Populus trichocarpa] gi|222857733|gb|EEE95280.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449444352|ref|XP_004139939.1| PREDICTED: uncharacterized N-acetyltransferase STK_02580-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147856839|emb|CAN83475.1| hypothetical protein VITISV_004799 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225446926|ref|XP_002267085.1| PREDICTED: uncharacterized N-acetyltransferase ST0258 [Vitis vinifera] gi|297739114|emb|CBI28765.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449525682|ref|XP_004169845.1| PREDICTED: uncharacterized N-acetyltransferase STK_02580-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15218861|ref|NP_171861.1| Acyl-CoA N-acyltransferases -like protein [Arabidopsis thaliana] gi|26452515|dbj|BAC43342.1| unknown protein [Arabidopsis thaliana] gi|28827284|gb|AAO50486.1| unknown protein [Arabidopsis thaliana] gi|332189472|gb|AEE27593.1| Acyl-CoA N-acyltransferases -like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297848582|ref|XP_002892172.1| hypothetical protein ARALYDRAFT_311459 [Arabidopsis lyrata subsp. lyrata] gi|297338014|gb|EFH68431.1| hypothetical protein ARALYDRAFT_311459 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|358345131|ref|XP_003636636.1| N-acetyltransferase, putative [Medicago truncatula] gi|355502571|gb|AES83774.1| N-acetyltransferase, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|356542932|ref|XP_003539918.1| PREDICTED: putative ribosomal-protein-alanine acetyltransferase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
TAIR|locus:2020718158 AT1G03650 [Arabidopsis thalian 0.951 0.493 0.679 5.9e-25
TAIR|locus:2020718 AT1G03650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 284 (105.0 bits), Expect = 5.9e-25, P = 5.9e-25
 Identities = 53/78 (67%), Positives = 64/78 (82%)

Query:     5 GTVTELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQVVG 64
             G V EL R ST+W  VV++IVK+EKK FPKHESLA++FD EL+KKN+GLLY+   G  VG
Sbjct:     4 GVVVELIRGSTSWAKVVEDIVKLEKKTFPKHESLAQTFDAELRKKNAGLLYVDAEGDTVG 63

Query:    65 YVMYAWPTSLSASITKLA 82
             Y MY+WP+SLSASITKLA
Sbjct:    64 YAMYSWPSSLSASITKLA 81


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.315   0.129   0.372    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       82        82   0.00091  102 3  11 23  0.45    29
                                                     29  0.43    30


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  523 (56 KB)
  Total size of DFA:  102 KB (2071 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  10.38u 0.24s 10.62t   Elapsed:  00:00:01
  Total cpu time:  10.38u 0.24s 10.62t   Elapsed:  00:00:01
  Start:  Fri May 10 23:36:13 2013   End:  Fri May 10 23:36:14 2013
GO:0005737 "cytoplasm" evidence=ISM
GO:0008080 "N-acetyltransferase activity" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=ISS

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XIII.3331.1
hypothetical protein (153 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XIV.733.1
hypothetical protein (395 aa)
•       0.473
estExt_fgenesh4_pg.C_LG_V1144
SubName- Full=Putative uncharacterized protein; (188 aa)
•       0.461

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
KOG3139165 consensus N-acetyltransferase [General function pr 97.82
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 97.46
COG0456177 RimI Acetyltransferases [General function predicti 97.3
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 97.1
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransf 96.68
PHA00673154 acetyltransferase domain containing protein 96.55
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 96.55
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 96.47
KOG3235 193 consensus Subunit of the major N alpha-acetyltrans 96.21
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 96.21
PRK07757152 acetyltransferase; Provisional 96.08
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 95.64
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 95.41
PLN02825515 amino-acid N-acetyltransferase 95.27
PRK07922169 N-acetylglutamate synthase; Validated 95.23
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 94.85
PRK01346 411 hypothetical protein; Provisional 94.8
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 94.37
PRK13688156 hypothetical protein; Provisional 93.8
PRK05279441 N-acetylglutamate synthase; Validated 93.59
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 93.38
PRK10140162 putative acetyltransferase YhhY; Provisional 92.89
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 92.79
COG3153171 Predicted acetyltransferase [General function pred 92.58
PTZ00330147 acetyltransferase; Provisional 92.44
PRK03624140 putative acetyltransferase; Provisional 92.18
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 90.27
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 89.45
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 87.0
PRK09831147 putative acyltransferase; Provisional 86.94
PF09924299 DUF2156: Uncharacterized conserved protein (DUF215 85.8
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 85.25
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 85.24
PRK10514145 putative acetyltransferase; Provisional 85.17
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 85.07
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 84.98
PRK10314153 putative acyltransferase; Provisional 84.85
PF13530 218 SCP2_2: Sterol carrier protein domain; PDB: 3SXN_C 83.95
PHA01807153 hypothetical protein 80.51
KOG3138 187 consensus Predicted N-acetyltransferase [General f 80.05
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information 
Probab=97.82  E-value=8.2e-05  Score=54.20  Aligned_cols=73  Identities=11%  Similarity=0.085  Sum_probs=55.9

Q ss_pred             EEecCCCCcchHhHHHHHHHhhhcCCCCcccchhHHHHhhccCceEEEEEECCeE--EEEEEEeccCCce---eeeeccC
Q 048356            8 TELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSGLLYIHIHGQV--VGYVMYAWPTSLS---ASITKLA   82 (82)
Q Consensus         8 ~~l~~~~~~a~~~l~~I~~IErk~FP~nes~~~~f~~EL~k~n~~fl~a~~~gkV--vGYvm~~~~t~~~---~~i~klA   82 (82)
                      ..+++....+...+..|+++..+.|+++  |+..-..-+..+...|-++..|+++  ||+++|.|++..+   +.|.+||
T Consensus        14 ~~i~~~~~~~~~~l~~im~Li~k~lsep--yS~~tyrYf~~~wp~~~~~a~d~~~~~VGai~ck~~~~r~~~rgyi~mLa   91 (165)
T KOG3139|consen   14 EVIRPSLYPAEEYLADIMRLIDKDLSEP--YSIYTYRYFVPNWPCFCFLALDEKGDTVGAIVCKLDTHRNTLRGYIAMLA   91 (165)
T ss_pred             eeeeeecchHHHHHHHHHHHHhhhcCch--hHHHHHHhcccCCceEEEEEEcCCCceEEEEEEeccccCCcceEEEEEEE
Confidence            4455565566778889999999999987  7655444445555557777777776  9999999999888   8888876

>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PF09924 DUF2156: Uncharacterized conserved protein (DUF2156); InterPro: IPR024320 This domain of unknown function is found in uncharacterised proteins and in Lysylphosphatidylglycerol synthetase, which catalyses the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol [] Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>PF13530 SCP2_2: Sterol carrier protein domain; PDB: 3SXN_C 3N7Z_A 3RYO_B 3R1K_A 3UY5_A 2HV2_F 2I00_D 2OZG_A Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
3ey5_A 181 Acetyltransferase-like, GNAT family; structural ge 2e-04
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 5e-04
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 Back     alignment and structure
 Score = 36.9 bits (85), Expect = 2e-04
 Identities = 11/76 (14%), Positives = 22/76 (28%), Gaps = 3/76 (3%)

Query: 9  ELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEELKKKNSG--LLYIHIHGQVVGYV 66
            Q  +T+       + ++  + FP  E        E   +        I      +G++
Sbjct: 6  RFQPITTSDVQHYKFMEELLVESFPPEEYRELEHLREYTDRIGNFHNNIIFDDDLPIGFI 65

Query: 67 MYAWPTSLSASITKLA 82
           Y W       +   A
Sbjct: 66 TY-WDFDEFYYVEHFA 80
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 97.95
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 97.93
3efa_A147 Putative acetyltransferase; structural genom 2, pr 97.88
2ree_A 224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 97.87
3ey5_A 181 Acetyltransferase-like, GNAT family; structural ge 97.85
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 97.82
2g0b_A 198 FEEM; N-acyl transferase, environmental DNA, prote 97.8
1y7r_A133 Hypothetical protein SA2161; structural genomics, 97.75
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 97.75
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 97.75
1xeb_A150 Hypothetical protein PA0115; midwest center for st 97.67
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 97.63
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 97.43
3mgd_A157 Predicted acetyltransferase; structural genomics, 97.37
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 97.33
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 97.31
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 97.28
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 97.18
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 97.18
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 97.13
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 97.13
1n71_A 180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 97.07
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 97.07
1tiq_A180 Protease synthase and sporulation negative regulat 97.0
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 96.99
4fd4_A 217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 96.95
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 96.93
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 96.84
3kkw_A182 Putative uncharacterized protein; acetyltransferas 96.84
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 96.84
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 96.79
2aj6_A159 Hypothetical protein MW0638; structural genomics, 96.79
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 96.78
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 96.78
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 96.71
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 96.62
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 96.61
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 96.57
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 96.53
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 96.51
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 96.47
1z4r_A168 General control of amino acid synthesis protein 5- 96.45
1wwz_A159 Hypothetical protein PH1933; structural genomics, 96.45
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 96.42
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 96.41
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 96.4
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 96.38
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 96.33
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 96.31
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 96.29
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 96.21
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 96.16
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 96.15
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 96.11
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 96.05
1vkc_A158 Putative acetyl transferase; structural genomics, 96.04
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 96.03
2i6c_A160 Putative acetyltransferase; GNAT family, structura 96.02
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 95.97
1m4i_A 181 Aminoglycoside 2'-N-acetyltransferase; COA binding 95.8
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 95.77
3owc_A188 Probable acetyltransferase; structural genomics, P 95.73
2eui_A153 Probable acetyltransferase; dimer, structural geno 95.67
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 95.66
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 95.58
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 95.42
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 95.4
1u6m_A 199 Acetyltransferase, GNAT family; structural genomic 95.36
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 95.33
2fe7_A166 Probable N-acetyltransferase; structural genomics, 95.3
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 95.27
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 95.27
3te4_A 215 GH12636P, dopamine N acetyltransferase, isoform A; 95.23
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 95.21
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 95.18
3c26_A 266 Putative acetyltransferase TA0821; NP_394282.1, A 95.12
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 95.11
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 95.06
2q04_A 211 Acetoin utilization protein; ZP_00540088.1, struct 95.03
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 95.03
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 95.03
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 95.0
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 94.81
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 94.81
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 94.77
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 94.72
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 94.6
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 94.6
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 94.6
2qec_A 204 Histone acetyltransferase HPA2 and related acetylt 94.58
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 94.49
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 94.46
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 94.45
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 94.15
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 94.12
4fd5_A 222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 94.11
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 94.07
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 93.93
2gan_A190 182AA long hypothetical protein; alpha-beta protei 93.85
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 93.85
3frm_A254 Uncharacterized conserved protein; APC61048, staph 93.79
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 93.75
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 93.69
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 93.67
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 93.62
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 93.56
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 93.29
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 93.23
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 93.09
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 93.05
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 92.99
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 92.89
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 92.75
3qb8_A 197 A654L protein; GNAT N-acetyltransferase, acetyltra 92.71
1nsl_A184 Probable acetyltransferase; structural genomics, h 92.46
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 91.82
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 91.79
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 91.71
2fl4_A149 Spermine/spermidine acetyltransferase; structural 91.6
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 91.09
2qml_A198 BH2621 protein; structural genomics, joint center 91.08
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 91.02
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 91.02
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 90.99
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 90.95
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 90.1
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 89.92
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 89.77
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 89.74
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 89.01
4fd7_A 238 Putative arylalkylamine N-acetyltransferase 7; GNA 88.5
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 88.43
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 88.28
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 87.92
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 87.79
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 87.64
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 87.55
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 87.4
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 87.25
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 87.18
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 86.76
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 85.78
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 85.57
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 81.41
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
Probab=97.95  E-value=2.3e-05  Score=50.16  Aligned_cols=50  Identities=22%  Similarity=0.351  Sum_probs=40.4

Q ss_pred             hHhHHHHHHHhhhcCCCCcccchhHHHHhh-ccCceEEEEEECCeEEEEEEEe
Q 048356           18 TVVVDEIVKMEKKIFPKHESLARSFDEELK-KKNSGLLYIHIHGQVVGYVMYA   69 (82)
Q Consensus        18 ~~~l~~I~~IErk~FP~nes~~~~f~~EL~-k~n~~fl~a~~~gkVvGYvm~~   69 (82)
                      .+|+++|.+|.+..|++.  |+..++.+.. ..+..+++++.+|++|||+.+.
T Consensus        20 ~~D~~~i~~l~~~~~~~~--~~~~~~~~~~~~~~~~~~va~~~~~ivG~~~~~   70 (168)
T 2x7b_A           20 MDDIDQIIKINRLTLPEN--YPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPR   70 (168)
T ss_dssp             GGGHHHHHHHHHHHCSCC--CCHHHHHHHHHHHGGGCEEEEETTEEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHCCCC--ccHHHHHHHHhcCCceEEEEEECCeEEEEEEEE
Confidence            668999999999999865  8877666654 3356688888899999999876
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d1n71a_ 180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 98.2
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 97.79
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 97.48
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 97.4
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 97.29
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 97.21
d1tiqa_173 Protease synthase and sporulation negative regulat 97.19
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 97.04
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 97.03
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 96.91
d2hv2a2 285 Hypothetical protein EF1021 {Enterococcus faecalis 96.87
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena varia 96.7
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 96.61
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 96.39
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 96.37
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 96.19
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 96.18
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 96.13
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 95.95
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 95.82
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 95.77
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 95.7
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 95.65
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 95.24
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 94.67
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 94.32
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 93.86
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 93.66
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 93.65
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 93.15
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 92.89
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 92.78
d1m4ia_ 181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 91.77
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 91.65
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 91.38
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 90.67
d2i00a2 291 Putative acetyltransferase EF2353 {Enterococcus fa 90.58
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 89.33
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 88.81
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 86.72
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 86.46
d2i00a2291 Putative acetyltransferase EF2353 {Enterococcus fa 86.44
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 86.32
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 85.67
d2hv2a2285 Hypothetical protein EF1021 {Enterococcus faecalis 84.0
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 83.93
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 83.5
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 83.08
d1ro5a_ 197 Autoinducer synthesis protein LasI {Pseudomonas ae 81.56
d1u6ma_ 189 Putative acetyltransferase EF0945 {Enterococcus fa 80.87
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 80.87
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Aminoglycoside 6'-N-acetyltransferase
species: Enterococcus faecium [TaxId: 1352]

Probab=98.20  E-value=5.4e-06  Score=54.43  Aligned_cols=72  Identities=17%  Similarity=0.234  Sum_probs=56.2

Q ss_pred             ceEEecCCCCcchHhHHHHHHHhhhcCCCCcccchhHHHHh---hccCceEEEEEECCeEEEEEEEecc-CCceeeeecc
Q 048356            6 TVTELQRNSTNWTVVVDEIVKMEKKIFPKHESLARSFDEEL---KKKNSGLLYIHIHGQVVGYVMYAWP-TSLSASITKL   81 (82)
Q Consensus         6 ~~~~l~~~~~~a~~~l~~I~~IErk~FP~nes~~~~f~~EL---~k~n~~fl~a~~~gkVvGYvm~~~~-t~~~~~i~kl   81 (82)
                      .|.|+++.+   +.+.++|.+|.+.+||+.  |.+...+++   ..++..++++..+|+++||+.+... .+..++|.+|
T Consensus         2 iI~e~~~~~---p~~~~~l~~l~~~~~p~~--~~~~~~~~~~~~~~~~~~~~va~~~~~iig~~~~~~~~~~~~~~I~~i   76 (180)
T d1n71a_           2 IISEFDRNN---PVLKDQLSDLLRLTWPEE--YGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPL   76 (180)
T ss_dssp             EEEECCTTC---HHHHHHHHHHHHHHCTTT--SSSTHHHHHHHHTCTTSEEEEEEETTEEEEEEEEEEEETTTEEEEEEE
T ss_pred             eEEEccccC---hHHHHHHHHHHHHhCCcc--cCcchHHHHHHHhCCCCEEEEEEECCeEEEEEEEEEecCCCEEEEEEE
Confidence            478999988   888999999999999954  776655555   3457789999999999999876543 3566788776


Q ss_pred             C
Q 048356           82 A   82 (82)
Q Consensus        82 A   82 (82)
                      |
T Consensus        77 ~   77 (180)
T d1n71a_          77 V   77 (180)
T ss_dssp             E
T ss_pred             E
Confidence            4
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure