Citrus Sinensis ID: 048441

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MKAQKIAQIEVLDLEEEDEIFIKSTSQKGKRKRSAISVGQHIDDQRGPIKASQIFINLDDYFDDDDDLHVLNLLPHNTPLGKRKKPFSNHSVAENGQPSDSHKNDPSFVCEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLEPEYCRNILPQQVMFCAKCKVPWHTDMKCEDFQNLNENENDDIKLKKLAVEMKWKRCPNCGYYVEKFRGCNIIICRCGTSFHYYSRADLSELYPYRPASRQKGFRLKSRDPVRTLEYFDFLDLPEGKPP
cHHHHHHHHccccccccccccccccccccccccccEEccccccccccccccccEEEcccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHcccccccccccEEEEccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHEEEcccccccccEEEEcccccccccccEEHHHHHHHcccccccccEccccHHHcccccccEEEEccccccccccHHHHHHHcccccccccccccccccccEccEEcccccHHHcccHcccccHHHHHHHHHHHHHHHHcccEEEEccccccccEEEcHHcccccccccEEEEcccccccccccHHHHHHHccccccHHHHHHHHHcccccccccccEEEEEcccccEEEEEcccEEEHHHcHHHcccccccccccccccccccccHHcHEEEEEHccccccccc
MKAQKIAQIevldleeedEIFIKSTSqkgkrkrsaisvgqhiddqrgpikasqifinlddyfdddddlhvlnllphntplgkrkkpfsnhsvaengqpsdshkndpsfVCEICveskspnesfrikgcshsycTDCIIKYVASKLQEsittigcpvtgcqgvlepeycrnilpQQVMFCAkckvpwhtdmkcedfqnlnenenddIKLKKLAVEMkwkrcpncgyyvekfrgcniiicrcgtsfhyysradlselypyrpasrqkgfrlksrdpvrtleyfdfldlpegkpp
mkaqkiaqievldleeedeifikstsqkgkrkrsaisvgqhiddqrgpiKASQIFINLDDYFDDDDDLHVLNLLPHNTPLGKRKKPFSNHSVAengqpsdshkndPSFVCEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLEPEYCRNILPQQVMFCAKCKVPWHTDMKCEDFqnlnenenddiKLKKLAVEMKWKRCPNCGYYVEKFRGCNIIICRCGTSFHYYSRADLSELypyrpasrqkgfrlksrdpvrtleyfdfldlpegkpp
MKAQKIAQievldleeedeiFIKSTSQKGKRKRSAISVGQHIDDQRGPIKASQIFINlddyfdddddlhvlnllPHNTPLGKRKKPFSNHSVAENGQPSDSHKNDPSFVCEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLEPEYCRNILPQQVMFCAKCKVPWHTDMKCEDFQNLNENENDDIKLKKLAVEMKWKRCPNCGYYVEKFRGCNIIICRCGTSFHYYSRADLSELYPYRPASRQKGFRLKSRDPVRTLEYFDFLDLPEGKPP
************************************************IKASQIFINLDDYFDDDDDLHVLNLLP********************************FVCEICVESK**NESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLEPEYCRNILPQQVMFCAKCKVPWHTDMKCEDFQNLNENENDDIKLKKLAVEMKWKRCPNCGYYVEKFRGCNIIICRCGTSFHYYSRADLSELYPYRP******F******PVRTLEYFDFLD*******
*****************************************************IFINLDDYFDDDDDLHV***************************************CEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLEPEYCRNILPQQVMFCAKCKVPWHTDMKCEDFQNLNE**NDDIKLKKLAVEMKWKRCPNCGYYVEKFRGCNIIICRCGTSFHYYSRADLSELYPYRPASRQKGFRLK*RDPVRTLEYFDFLDLP*****
MKAQKIAQIEVLDLEEEDEIFIK**************VGQHIDDQRGPIKASQIFINLDDYFDDDDDLHVLNLLPHNTPLGKRKKPFSN***************DPSFVCEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLEPEYCRNILPQQVMFCAKCKVPWHTDMKCEDFQNLNENENDDIKLKKLAVEMKWKRCPNCGYYVEKFRGCNIIICRCGTSFHYYSRADLSELYPYRPASRQKGFRLKSRDPVRTLEYFDFLDLPEGKPP
*******QIEVLDLEEEDEIFIKSTSQKGKRKRSAISVGQHIDDQRGPIKASQIFINLDDYFDDDDDLHVLNLLPHNTPLGKRKKPFSNHSV*************PSFVCEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLEPEYCRNILPQQVMFCAKCKVPWHTDMKCEDFQNLNENENDDIKLKKLAVEMKWKRCPNCGYYVEKFRGCNIIICRCGTSFHYYSRADLSELYPYRPAS*QKGFRLKSRDPVRTLEYFDFLDLPE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAQKIAQIEVLDLEEEDEIFIKSTSQKGKRKRSAISVGQHIDDQRGPIKASQIFINLDDYFDDDDDLHVLNLLPHNTPLGKRKKPFSNHSVAENGQPSDSHKNDPSFVCEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLEPEYCRNILPQQVMFCAKCKVPWHTDMKCEDFQNLNENENDDIKLKKLAVEMKWKRCPNCGYYVEKFRGCNIIICRCGTSFHYYSRADLSELYPYRPASRQKGFRLKSRDPVRTLEYFDFLDLPEGKPP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query292 2.2.26 [Sep-21-2011]
Q5RFV4293 Probable E3 ubiquitin-pro yes no 0.342 0.341 0.294 2e-05
P0CE101787 Putative uncharacterized no no 0.208 0.034 0.380 6e-05
Q2VJ60 838 E3 ubiquitin-protein liga yes no 0.469 0.163 0.272 7e-05
P50636 840 E3 ubiquitin-protein liga yes no 0.506 0.176 0.261 8e-05
A4IIY1292 Probable E3 ubiquitin-pro no no 0.534 0.534 0.212 8e-05
Q9NV58 838 E3 ubiquitin-protein liga yes no 0.469 0.163 0.272 0.0001
Q6DH94293 Probable E3 ubiquitin-pro no no 0.335 0.334 0.309 0.0001
Q9Z1K5 555 E3 ubiquitin-protein liga no no 0.438 0.230 0.227 0.0002
A2VEA3 555 E3 ubiquitin-protein liga no no 0.438 0.230 0.227 0.0002
Q9Y4X5 557 E3 ubiquitin-protein liga no no 0.438 0.229 0.227 0.0002
>sp|Q5RFV4|R1441_DANRE Probable E3 ubiquitin-protein ligase RNF144A-A OS=Danio rerio GN=rnf144aa PE=3 SV=1 Back     alignment and function desciption
 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 12/112 (10%)

Query: 154 CPVTGCQGVLEPEYCRNILPQQVM-------FCAKCKVPWHTDMKCED---FQNLNENEN 203
           CP + CQ V + +    +LPQ V        FC+ CK  WH D  C++     +    E+
Sbjct: 111 CPSSTCQAVCQLKESDTVLPQLVRCSVCTLEFCSACKASWHPDQDCQENVPITSFLPGES 170

Query: 204 DDIKLKKLAVEMKWKRCPNCGYYVEKFRGCNIIICR-CGTSFHYYSRADLSE 254
                K    +   KRCP C  Y+E+  GC  ++C+ C  +F +Y    L +
Sbjct: 171 SSF-FKADDDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDD 221
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes ube2l3 and ube2l6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Danio rerio (taxid: 7955)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|P0CE10|Y4102_ARATH Putative uncharacterized protein At4g01020, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=4 SV=1 Back     alignment and function description
>sp|Q2VJ60|RN19A_PIG E3 ubiquitin-protein ligase RNF19A OS=Sus scrofa GN=RNF19A PE=2 SV=1 Back     alignment and function description
>sp|P50636|RN19A_MOUSE E3 ubiquitin-protein ligase RNF19A OS=Mus musculus GN=Rnf19a PE=1 SV=2 Back     alignment and function description
>sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 Back     alignment and function description
>sp|Q9NV58|RN19A_HUMAN E3 ubiquitin-protein ligase RNF19A OS=Homo sapiens GN=RNF19A PE=1 SV=3 Back     alignment and function description
>sp|Q6DH94|R1442_DANRE Probable E3 ubiquitin-protein ligase RNF144A-B OS=Danio rerio GN=rnf144ab PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1K5|ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus GN=Arih1 PE=2 SV=3 Back     alignment and function description
>sp|A2VEA3|ARI1_BOVIN E3 ubiquitin-protein ligase ARIH1 OS=Bos taurus GN=ARIH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4X5|ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens GN=ARIH1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
297738503329 unnamed protein product [Vitis vinifera] 0.900 0.799 0.396 1e-47
225444595358 PREDICTED: probable E3 ubiquitin-protein 0.869 0.709 0.401 1e-47
224142755307 predicted protein [Populus trichocarpa] 0.756 0.719 0.407 3e-47
255550303 400 zinc finger protein, putative [Ricinus c 0.801 0.585 0.375 8e-45
356558463 685 PREDICTED: uncharacterized protein LOC10 0.767 0.327 0.368 2e-44
297820104322 zinc finger family protein [Arabidopsis 0.767 0.695 0.380 4e-42
356530471333 PREDICTED: putative uncharacterized prot 0.75 0.657 0.387 9e-42
15231861320 RING/U-box domain-containing protein [Ar 0.797 0.728 0.357 5e-37
226532596349 ubiquitin-protein ligase/ zinc ion bindi 0.589 0.492 0.343 1e-32
224035271349 unknown [Zea mays] 0.589 0.492 0.343 1e-32
>gi|297738503|emb|CBI27748.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  196 bits (498), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 131/330 (39%), Positives = 177/330 (53%), Gaps = 67/330 (20%)

Query: 1   MKAQKIAQ--IEVLDLEEED-----EIFIKSTSQKGKRKRSAISVGQHIDDQRG--PIKA 51
           M+A K+ +  +E++D+EEED      +F+   S +G  + +AISV Q+  D+     IKA
Sbjct: 1   MEAMKLERPVVEIVDMEEEDAEEQVSLFLTPISCRGGTRNTAISVEQYSADKELYLSIKA 60

Query: 52  SQI-----FINLDDYFDDDDDLHVLNLLPHNTPLG-KRKKPFSNHSVAENGQPSDSHKND 105
           S +      I+LD+  DDDDDL +L + P  TP     +KPF+  SV E GQPS+S  + 
Sbjct: 61  SLLQPQTPLIHLDND-DDDDDLQILGINPPTTPHAFSTRKPFTFPSVTETGQPSNSKPDP 119

Query: 106 P-SFVCEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLE 164
           P +FVCEIC++ K  N SF IKGC HSYC+DC+ KYVASKLQ++++ I CP   C GVLE
Sbjct: 120 PPTFVCEICIDPKPLNHSFSIKGCPHSYCSDCMTKYVASKLQDNVSRISCPAPNCTGVLE 179

Query: 165 PEYCRNILPQQV------------------------------------------------ 176
           P+ CR ILP  V                                                
Sbjct: 180 PQQCRPILPSHVFDRWGNALCEALILGSQKFYCPYKDCSALLIRDEGEVIKESECPNCRR 239

Query: 177 MFCAKCKVPWHTDMKCEDFQNLNENE--NDDIKLKKLAVEMKWKRCPNCGYYVEKFRGCN 234
           +FCA+C+VPWH+ + C +FQ LN++E   +DI +  LA    WKRCP C +YVEK  GC 
Sbjct: 240 LFCAQCEVPWHSGIDCGEFQKLNKDERGREDILMMNLAKTNNWKRCPKCKFYVEKSFGCM 299

Query: 235 IIICRCGTSFHYYSRADLSELYPYRPASRQ 264
            I CRCG +F Y   A  S +    P  R 
Sbjct: 300 YIRCRCGFAFCYNCGAPSSTISHICPHCRH 329

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225444595|ref|XP_002277363.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142755|ref|XP_002324718.1| predicted protein [Populus trichocarpa] gi|222866152|gb|EEF03283.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255550303|ref|XP_002516202.1| zinc finger protein, putative [Ricinus communis] gi|223544688|gb|EEF46204.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356558463|ref|XP_003547526.1| PREDICTED: uncharacterized protein LOC100803898 [Glycine max] Back     alignment and taxonomy information
>gi|297820104|ref|XP_002877935.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297323773|gb|EFH54194.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356530471|ref|XP_003533804.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|15231861|ref|NP_190937.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|6729520|emb|CAB67676.1| putative protein [Arabidopsis thaliana] gi|21536688|gb|AAM61020.1| unknown [Arabidopsis thaliana] gi|332645607|gb|AEE79128.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|226532596|ref|NP_001147119.1| ubiquitin-protein ligase/ zinc ion binding protein [Zea mays] gi|195607422|gb|ACG25541.1| ubiquitin-protein ligase/ zinc ion binding protein [Zea mays] Back     alignment and taxonomy information
>gi|224035271|gb|ACN36711.1| unknown [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
TAIR|locus:2091030303 AT3G14250 [Arabidopsis thalian 0.239 0.231 0.413 2.2e-30
TAIR|locus:2084116320 AT3G53690 [Arabidopsis thalian 0.472 0.431 0.432 5.2e-28
TAIR|locus:2133935532 AT4G19670 [Arabidopsis thalian 0.260 0.142 0.448 5.2e-22
TAIR|locus:2057401398 AT2G26130 [Arabidopsis thalian 0.267 0.195 0.395 6.7e-22
TAIR|locus:2085622222 AT3G45470 [Arabidopsis thalian 0.239 0.315 0.422 7.6e-22
TAIR|locus:2101074346 AT3G43750 [Arabidopsis thalian 0.212 0.179 0.476 1e-21
TAIR|locus:2085672408 AT3G45580 [Arabidopsis thalian 0.236 0.169 0.471 1.5e-21
TAIR|locus:1006230127384 AT2G26135 [Arabidopsis thalian 0.253 0.192 0.413 1.1e-20
TAIR|locus:2040065373 AT2G25360 [Arabidopsis thalian 0.239 0.187 0.408 4.5e-18
TAIR|locus:2040025603 AT2G25370 [Arabidopsis thalian 0.239 0.116 0.436 3e-16
TAIR|locus:2091030 AT3G14250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 2.2e-30, Sum P(2) = 2.2e-30
 Identities = 31/75 (41%), Positives = 45/75 (60%)

Query:   177 MFCAKCKVPWHTDMKCEDFQNLNE-----NENDDIKLKKLAVEMKWKRCPNCGYYVEKFR 231
             +FC +CKV WH  + C++FQ         ++ DD  L ++A   +W+RCP+C +YV+K  
Sbjct:   213 LFCVQCKVTWHAGIGCDEFQRFGNTKKKSSDEDDALLIQMAKNKQWRRCPSCKFYVDKVE 272

Query:   232 GCNIIICRCGTSFHY 246
             GC  I CRCG  F Y
Sbjct:   273 GCQHIKCRCGYQFCY 287
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2084116 AT3G53690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133935 AT4G19670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057401 AT2G26130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085622 AT3G45470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101074 AT3G43750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085672 AT3G45580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230127 AT2G26135 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040065 AT2G25360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040025 AT2G25370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016368001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (329 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 292
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 99.96
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 99.95
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 99.89
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 99.71
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.04
smart0064764 IBR In Between Ring fingers. the domains occurs be 98.51
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.48
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.35
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.34
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.28
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 98.22
PF1463444 zf-RING_5: zinc-RING finger domain 98.17
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.17
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.13
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.06
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.87
PHA02929238 N1R/p28-like protein; Provisional 97.84
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.77
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.75
PHA02926242 zinc finger-like protein; Provisional 97.55
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.55
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.53
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.41
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.36
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.34
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.09
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.03
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.96
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.94
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 96.9
smart0064764 IBR In Between Ring fingers. the domains occurs be 96.82
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 96.75
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 96.75
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.69
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.46
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.1
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.04
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.68
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.32
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.0
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.99
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 94.96
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 94.87
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 94.54
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 94.47
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 94.31
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.11
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 93.7
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 93.53
KOG2660 331 consensus Locus-specific chromosome binding protei 93.26
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.01
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 92.97
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 92.46
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.28
PF1324023 zinc_ribbon_2: zinc-ribbon domain 91.92
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 91.58
PF1324826 zf-ribbon_3: zinc-ribbon domain 91.54
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 91.25
smart0066152 RPOL9 RNA polymerase subunit 9. 91.17
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 90.74
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 89.87
KOG4445368 consensus Uncharacterized conserved protein, conta 89.7
KOG0825 1134 consensus PHD Zn-finger protein [General function 89.53
KOG3039303 consensus Uncharacterized conserved protein [Funct 89.44
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 89.4
PHA0062659 hypothetical protein 89.32
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 88.92
PF1371937 zinc_ribbon_5: zinc-ribbon domain 88.74
COG0777 294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 88.7
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 88.62
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 88.32
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 88.13
COG5152259 Uncharacterized conserved protein, contains RING a 88.05
PRK05654 292 acetyl-CoA carboxylase subunit beta; Validated 88.0
PRK0043250 30S ribosomal protein S27ae; Validated 86.94
CHL00174 296 accD acetyl-CoA carboxylase beta subunit; Reviewed 86.31
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 86.24
PF1371736 zinc_ribbon_4: zinc-ribbon domain 85.95
PHA03096284 p28-like protein; Provisional 85.79
TIGR00515 285 accD acetyl-CoA carboxylase, carboxyl transferase, 85.74
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 85.58
KOG0297 391 consensus TNF receptor-associated factor [Signal t 85.46
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 85.27
KOG4739233 consensus Uncharacterized protein involved in syna 85.17
PRK14559 645 putative protein serine/threonine phosphatase; Pro 85.02
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 84.57
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 84.42
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 83.96
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 83.65
PF1495244 zf-tcix: Putative treble-clef, zinc-finger, Zn-bin 82.56
COG5175 480 MOT2 Transcriptional repressor [Transcription] 82.29
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 82.22
KOG1001674 consensus Helicase-like transcription factor HLTF/ 82.19
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 81.54
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 81.18
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 80.89
PF04641260 Rtf2: Rtf2 RING-finger 80.15
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 80.13
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.96  E-value=3.2e-30  Score=241.44  Aligned_cols=151  Identities=36%  Similarity=0.858  Sum_probs=130.1

Q ss_pred             CCCccccccc-ccCCCCCceeecCCCCccchhhHHHHHHHHHhcCccccCCCCCCCCCCCCHHHHHhhCCCCc-------
Q 048441          105 DPSFVCEICV-ESKSPNESFRIKGCSHSYCTDCIIKYVASKLQESITTIGCPVTGCQGVLEPEYCRNILPQQV-------  176 (292)
Q Consensus       105 ~~~~~C~IC~-~~~~~~~~~~~~~CgH~fC~~Cl~~~i~~~i~~~~~~i~CP~~~C~~~l~~~~i~~~l~~~~-------  176 (292)
                      ....+|.||+ +.....+++.+..|+|.||.+|+++||+.+ ......+.||..+|...++.+.+..+|++++       
T Consensus       144 ~~~~~C~iC~~e~~~~~~~f~~~~C~H~fC~~C~k~~iev~-~~~~~~~~C~~~~C~~~l~~~~c~~llt~kl~e~~e~~  222 (384)
T KOG1812|consen  144 LPKEECGICFVEDPEAEDMFSVLKCGHRFCKDCVKQHIEVK-LLSGTVIRCPHDGCESRLTLESCRKLLTPKLREMWEQR  222 (384)
T ss_pred             cccccCccCccccccHhhhHHHhcccchhhhHHhHHHhhhh-hccCCCccCCCCCCCccCCHHHHhhhcCHHHHHHHHHH
Confidence            4579999999 444444677778999999999999999999 4445889999999999999998888887521       


Q ss_pred             --------------------------------------------eeccCCCCCccCCCCchhHHHhcccchhHHHHHHHH
Q 048441          177 --------------------------------------------MFCAKCKVPWHTDMKCEDFQNLNENENDDIKLKKLA  212 (292)
Q Consensus       177 --------------------------------------------~~C~~C~~~~H~~~~C~~~~~~~~~~~~~~~~~~~~  212 (292)
                                                                  .||..|+.+||.+++|++|+++......+..+.+++
T Consensus       223 ~~e~~i~~~~~~ycp~~~C~~l~~~~el~~~~~~~~~~C~~C~~~fCv~C~~~wh~~~sC~eykk~~~~~~~d~~~~~~l  302 (384)
T KOG1812|consen  223 LKEEVIPSLDRVYCPYPRCSSLMSKTELSSEVKSKRRPCVKCHELFCVKCKVPWHANLSCEEYKKLNPEEYVDDITLKYL  302 (384)
T ss_pred             HHHHhhhhhhcccCCCCCchHhhhhhhhccchhhcccccccCCCceeecCCCcCCCCCCHHHHHHhCCcccccHHHHHHH
Confidence                                                        899999999999999999999998765555666666


Q ss_pred             HhCCeeecCCCCeeEEecCCcCeEEeccCcceeeccccCccCCCC
Q 048441          213 VEMKWKRCPNCGYYVEKFRGCNIIICRCGTSFHYYSRADLSELYP  257 (292)
Q Consensus       213 ~~~~~k~CP~C~~~iek~~GCnhm~C~C~~~FC~~C~~~~~~~~~  257 (292)
                      . +.|+.||+|+..|++++|||||+|+||++|||.|+.+|..+..
T Consensus       303 a-~~wr~CpkC~~~ie~~~GCnhm~CrC~~~fcy~C~~~~~~~~~  346 (384)
T KOG1812|consen  303 A-KRWRQCPKCKFMIELSEGCNHMTCRCGHQFCYMCGGDWKTHNG  346 (384)
T ss_pred             H-HhcCcCcccceeeeecCCcceEEeeccccchhhcCcchhhCCc
Confidence            6 7899999999999999999999999999999999999976553

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14952 zf-tcix: Putative treble-clef, zinc-finger, Zn-binding Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 1e-13
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
 Score = 64.5 bits (157), Expect = 1e-13
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 3/77 (3%)

Query: 104 NDPSFVCEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQES-ITTIGCPVTGC--Q 160
           +  S  C++C+      +   I  C   +CT C+ +YV   ++E   T I CP   C  Q
Sbjct: 2   SSGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQ 61

Query: 161 GVLEPEYCRNILPQQVM 177
           G L+      ++  ++M
Sbjct: 62  GHLQENEIECMVAAEIM 78
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 99.58
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.46
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.94
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.68
2ect_A78 Ring finger protein 126; metal binding protein, st 98.61
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.59
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.59
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.55
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.54
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.5
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.5
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.49
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.49
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.49
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.47
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.47
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.45
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.45
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.43
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.43
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.43
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.42
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.41
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.36
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.35
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.34
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.31
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.3
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.24
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.19
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.18
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.18
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.15
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.12
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.1
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.09
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.06
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.05
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.01
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.99
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.99
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.99
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.95
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.94
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.93
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.92
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.84
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.82
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.81
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.81
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.76
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.75
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.73
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.68
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.6
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 97.59
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.56
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.53
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.36
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.31
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 97.31
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.29
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.28
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.16
2ea5_A68 Cell growth regulator with ring finger domain prot 97.07
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.02
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 97.01
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 96.8
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 96.54
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.22
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 96.03
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 96.02
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 95.78
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.81
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 94.22
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 94.14
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 92.69
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 89.14
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 87.25
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 86.93
2ysj_A63 Tripartite motif-containing protein 31; ring-type 86.73
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 85.19
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 84.97
2ysl_A73 Tripartite motif-containing protein 31; ring-type 84.87
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 84.29
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 83.1
3nw0_A238 Non-structural maintenance of chromosomes element 82.97
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 82.65
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 82.56
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 81.75
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 81.75
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 81.71
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 81.17
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 80.98
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 80.81
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 80.44
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 80.4
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 80.4
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 80.22
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 80.07
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.58  E-value=1.1e-16  Score=109.96  Aligned_cols=42  Identities=29%  Similarity=0.631  Sum_probs=39.0

Q ss_pred             CCeeecCCCCeeEEecCCcCeEEe-c--cCcceeeccccCccCCC
Q 048441          215 MKWKRCPNCGYYVEKFRGCNIIIC-R--CGTSFHYYSRADLSELY  256 (292)
Q Consensus       215 ~~~k~CP~C~~~iek~~GCnhm~C-~--C~~~FC~~C~~~~~~~~  256 (292)
                      .++|+||+|+++|||++|||||+| +  |+++|||+|+++|..+.
T Consensus         4 ~~~k~CP~C~~~Iek~~GCnhmtC~~~~C~~~FCw~C~~~~~~~~   48 (60)
T 1wd2_A            4 ANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHG   48 (60)
T ss_dssp             CCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGGG
T ss_pred             ccceECcCCCCeeEeCCCCCcEEECCCCcCCEEeeCcCCCcccCC
Confidence            468999999999999999999999 4  99999999999998754
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 292
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 6e-09
d2ct7a173 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H 4e-05
d1wd2a_60 g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Ho 1e-04
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 50.5 bits (120), Expect = 6e-09
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 3/77 (3%)

Query: 104 NDPSFVCEICVESKSPNESFRIKGCSHSYCTDCIIKYVASKLQES-ITTIGCPVTGC--Q 160
           +  S  C++C+      +   I  C   +CT C+ +YV   ++E   T I CP   C  Q
Sbjct: 2   SSGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQ 61

Query: 161 GVLEPEYCRNILPQQVM 177
           G L+      ++  ++M
Sbjct: 62  GHLQENEIECMVAAEIM 78
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 99.59
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 99.35
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.1
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.61
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.5
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.5
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.38
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.32
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.26
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.23
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.17
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.11
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.97
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.93
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.88
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.88
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.61
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.33
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 96.45
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 95.91
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 87.45
d2f9yb1 263 Acetyl-coenzyme A carboxylase carboxyl transferase 86.77
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 86.1
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 85.5
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 85.5
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 85.2
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 84.03
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 82.66
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 81.54
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 81.36
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Ariadne-1 protein homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.59  E-value=3.7e-17  Score=110.53  Aligned_cols=41  Identities=32%  Similarity=0.714  Sum_probs=38.3

Q ss_pred             CCeeecCCCCeeEEecCCcCeEEec---cCcceeeccccCccCC
Q 048441          215 MKWKRCPNCGYYVEKFRGCNIIICR---CGTSFHYYSRADLSEL  255 (292)
Q Consensus       215 ~~~k~CP~C~~~iek~~GCnhm~C~---C~~~FC~~C~~~~~~~  255 (292)
                      .++|+||+|+++|||++|||||+|+   |+++|||+|+++|..+
T Consensus         4 ~ntK~CP~C~~~ieK~~GCnhM~C~~~~C~~~fCw~C~~~~~~~   47 (60)
T d1wd2a_           4 ANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPH   47 (60)
T ss_dssp             CCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGG
T ss_pred             hcCcCCCCCCCeEEECCCCCCeEeCCCCCCCeEECCCCCccccC
Confidence            4689999999999999999999995   9999999999999864
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure