Citrus Sinensis ID: 048443


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480------
EKRCLCSELTRLTILLFYLMTSDSPFLDRLQRLSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPKECASDWKIVLTGYTGRIVVGLVFGFNFSTGIVRWFPKKLGMQLKTRKRIRRHRN
ccccccccccEEEcccccccccccHHHHHHHccccccccccccccccccccEEEcccccccccccHHHHccccccccccccccccEEcccccccccccccccEEEccccccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHccccccccEEEEcccccccEEcccHHHHHccccHHHHcccccccccccccccccccccccccccccEEEEEEccccEEEccccccccEEEccccccccccHHHHHccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccccEEEEcccccccccccHHHHcHHHHHcccccccHHHcccccccEEEcccccccccccHHHcccHcHHHHHHHccccccccccHHHccccccccEEEEccccccccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccccHHHccccHHHHHHcccEEEcccccccccccHHHcccccccEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEccccccccEEEEEEcccccccccccccccccccHHHHccccccccccccccccccccccEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
EKRCLCSELTRLTILLFYLmtsdspfldRLQRlsdfsgqippslgnlnqlQWLDLAFNNFLRElpasigslsslerldtfppmkihgnipkwllnpsmknfsylnlsknyfprfdqhptvlpwttlSTKIRHYLISKnnltgeipswicnlsslyvldlsdnnlsGELLQCLGNFSGGLSVLSlqgknffgttpdtfmngsdlrMVDLSHnllqgkipkslaNCAVLEISdlrnnqindtfPIWLGSLLELNILVLIQQlpcfmgklpskyfQCWNAMKFANSSQLRYMENFLSsyfsfdfyryfpqndysitmsnegqmmthdkipDILKGIIlssnrfdgemptsiANLKGLQVLGLasnnlqghipsclgsltnlesldlsknRLTFLEFFNAThnnltgpipqanqfptfgyssfngnsrlcgkplpkecasdWKIVLTGYTGRIVVGLVFGfnfstgivrwfpkklgmqLKTRKRIRRHRN
EKRCLCSELTRLTILLFYLMTSDSPFLDRLQRLSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPKECASDWKIVLTGYTGRIVVGLVFGFNFStgivrwfpkklgmqlktrkrirrhrn
EKRCLCSELTRLTILLFYLMTSDSPFLDRLQRLSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQLRYMENflssyfsfdfyryfPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPKECASDWKIVLTGYTGRIVVGLVFGFNFSTGIVRWFPKKLGMQLKTRKRIRRHRN
***CLCSELTRLTILLFYLMTSDSPFLDRLQRLSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPKECASDWKIVLTGYTGRIVVGLVFGFNFSTGIVRWFPKKLGMQ************
EKRCLCSELTRLTILLFYLMTSDSPFLDRLQRLSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNA*************NFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPK***********GYTGRIVVGLVFGFNFSTGIVRWFPKKLGMQLKT**R******
EKRCLCSELTRLTILLFYLMTSDSPFLDRLQRLSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPKECASDWKIVLTGYTGRIVVGLVFGFNFSTGIVRWFPKKLGMQL***********
**RCLCSELTRLTILLFYLMTSDSPFLDRLQRLSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPKECASDWKIVLTGYTGRIVVGLVFGFNFSTGIVRWFPKKLGMQLKTRK*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EKRCLCSELTRLTILLFYLMTSDSPFLDRLQRLSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPKECASDWKIVLTGYTGRIVVGLVFGFNFSTGIVRWFPKKLGMQLKTRKRIRRHRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query486 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.851 0.488 0.325 1e-56
Q9M0G7 1013 Leucine-rich repeat recep no no 0.833 0.399 0.312 2e-36
Q42371 976 LRR receptor-like serine/ no no 0.860 0.428 0.291 8e-34
C0LGS2 1136 Probable LRR receptor-lik no no 0.823 0.352 0.292 2e-33
Q9SHI3729 Receptor-like protein 2 O no no 0.759 0.506 0.308 4e-33
Q9C7S5 1095 Tyrosine-sulfated glycope no no 0.777 0.345 0.282 5e-32
Q9FII5 1041 Leucine-rich repeat recep no no 0.722 0.337 0.308 1e-31
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.732 0.284 0.319 2e-31
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.890 0.358 0.294 1e-29
Q9FL28 1173 LRR receptor-like serine/ no no 0.711 0.294 0.296 1e-29
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  221 bits (562), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 161/494 (32%), Positives = 230/494 (46%), Gaps = 80/494 (16%)

Query: 38  GQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPK--WLLN 95
           G IP S+  L  L+ LD++ NNF   +P +I  L +L  LD      + G +P   W LN
Sbjct: 365 GPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLD-LSKNNLEGEVPACLWRLN 423

Query: 96  PSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSSLY 155
             +       LS N F  F+        +     I    ++ N+  G IP  IC LSSL 
Sbjct: 424 TMV-------LSHNSFSSFENT------SQEEALIEELDLNSNSFQGPIPYMICKLSSLG 470

Query: 156 VLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQG 215
            LDLS+N  SG +  C+ NFSG +  L+L   NF GT PD F   ++L  +D+SHN L+G
Sbjct: 471 FLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEG 530

Query: 216 KIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVL-----------------IQ 258
           K PKSL NC  LE+ ++ +N+I D FP WL SL  L++L L                  Q
Sbjct: 531 KFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQ 590

Query: 259 QLPC-------FMGKLPSKYFQCWNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQNDYS 311
            L         F G LP  YF  W  M        +YM          +F+RY     + 
Sbjct: 591 SLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMT---------EFWRYADSYYHE 641

Query: 312 ITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSC 371
           + M N+G  M+ ++I    + I  S N+ +G +P S+  LK L+VL L+ N     IP  
Sbjct: 642 MEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRF 701

Query: 372 LGSLTNLESLDLSKNR-----------LTFLEFFNATHNNLTGPIPQANQFPTFGYSSFN 420
           L +LT LE+LD+S+N+           L+FL + N +HN L GP+P+  QF     SSF 
Sbjct: 702 LANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFL 761

Query: 421 GNSRLCG--------------KPLPKECAS------DWKIVLTGYTGRIVVGLVFGFNFS 460
            N  L G                LP++ +       +W      Y   ++ GLV G  ++
Sbjct: 762 DNPGLYGLEDICRDTGALNPTSQLPEDLSEAEENMFNWVAAAIAYGPGVLCGLVIGHFYT 821

Query: 461 TGIVRWFPKKLGMQ 474
           +    WF +K G +
Sbjct: 822 SHNHEWFTEKFGRK 835




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI3|RLP2_ARATH Receptor-like protein 2 OS=Arabidopsis thaliana GN=RLP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
147794486 1924 hypothetical protein VITISV_000631 [Viti 0.874 0.220 0.409 3e-91
147782974 1719 hypothetical protein VITISV_036826 [Viti 0.812 0.229 0.411 5e-89
359490156 886 PREDICTED: receptor-like protein 12-like 0.948 0.520 0.394 5e-89
359485824 973 PREDICTED: receptor-like protein 12-like 0.868 0.433 0.412 3e-88
225447578 1946 PREDICTED: uncharacterized protein LOC10 0.882 0.220 0.406 4e-88
147766212 925 hypothetical protein VITISV_018438 [Viti 0.765 0.402 0.434 6e-86
224140511 894 predicted protein [Populus trichocarpa] 0.853 0.464 0.407 2e-83
224140517 979 predicted protein [Populus trichocarpa] 0.872 0.433 0.400 3e-83
224140509 961 predicted protein [Populus trichocarpa] 0.886 0.448 0.385 2e-81
255548700 932 serine-threonine protein kinase, plant-t 0.878 0.458 0.389 1e-80
>gi|147794486|emb|CAN71611.1| hypothetical protein VITISV_000631 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  342 bits (876), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 206/503 (40%), Positives = 271/503 (53%), Gaps = 78/503 (15%)

Query: 45   GNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYL 104
            G+L +L+ L LA  N L E P  + +   L+ L T    KIHG IPKW+ N   +    +
Sbjct: 1419 GSLPRLRLLGLASCN-LSEFPHFLRNQDELKFL-TLSDNKIHGQIPKWMWNMGKETLWVM 1476

Query: 105  NLSKNYFPRFDQHPTVLPWTTLST-----------------KIRHYLISKNNLTGEIPSW 147
            +LS N    F+Q P VLPW TL                    I  Y +  N L G+ PS 
Sbjct: 1477 DLSNNLLTXFEQAPVVLPWITLRVLELSYNQLQGSLPVPPXSISDYFVHNNRLNGKXPSL 1536

Query: 148  ICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVD 207
            IC+L  L++LDLS+NNLSG + QCL + S  LSVL+L+G NF G+ P TF +   L+M+D
Sbjct: 1537 ICSLHHLHILDLSNNNLSGMIPQCLXDSSDSLSVLNLRGNNFHGSIPQTFTSQCRLKMID 1596

Query: 208  LSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQ--------- 258
             S+N L+G+IP+SL NC   EI +L NNQINDTFP WLGSL EL +L+L           
Sbjct: 1597 FSYNQLEGQIPRSLXNCKEXEILNLGNNQINDTFPFWLGSLPELQLLILRHNRFHGAIES 1656

Query: 259  -----QLPC----------FMGKLPSKYFQCWNAMKFANSSQLRYMENFLSSYFSFDFYR 303
                 + P           F G LP+ YF  W AM   +     YM++ ++ +     YR
Sbjct: 1657 PRANFEFPTLCIIDLSYNXFAGNLPAGYFLTWVAMSRVDEEHFSYMQS-MTGFVLIRTYR 1715

Query: 304  YFPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNN 363
             +   +YS+TM+N+G    + KIP   K I LSSN+F GE+P SI  L+GL +L ++SN+
Sbjct: 1716 LYENYNYSMTMTNKGMERVYPKIPRSFKAIDLSSNKFIGEIPKSIGKLRGLHLLNISSNS 1775

Query: 364  LQGHIPSCLGSLTNLESLDLSKNRL-----------TFLEFFNATHNNLTGPIPQANQFP 412
            L GHIPS LG+L  LE+LDLS+N L           TFLEFFN +HN+L GPIPQ  QF 
Sbjct: 1776 LTGHIPSFLGNLAQLEALDLSQNNLSGEIPQQLKGMTFLEFFNVSHNHLMGPIPQGKQFN 1835

Query: 413  TFGYSSFNGNSRLCGKPLPKECAS-----------------------DWKIVLTGYTGRI 449
            TF   S+ GN  LCG PL KEC +                       +  IVL GY   +
Sbjct: 1836 TFQNDSYEGNPGLCGNPLSKECGNSKSTASSPPTYKHGGDLESGRKVELMIVLMGYGSGL 1895

Query: 450  VVGLVFGFNFSTGIVRWFPKKLG 472
            VVG+  G+  +T    WF K  G
Sbjct: 1896 VVGMAIGYTLTTRKHEWFVKTFG 1918




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147782974|emb|CAN66148.1| hypothetical protein VITISV_036826 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447578|ref|XP_002270154.1| PREDICTED: uncharacterized protein LOC100264911 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766212|emb|CAN63381.1| hypothetical protein VITISV_018438 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140511|ref|XP_002323626.1| predicted protein [Populus trichocarpa] gi|222868256|gb|EEF05387.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140517|ref|XP_002323629.1| predicted protein [Populus trichocarpa] gi|222868259|gb|EEF05390.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140509|ref|XP_002323625.1| predicted protein [Populus trichocarpa] gi|222868255|gb|EEF05386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255548700|ref|XP_002515406.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223545350|gb|EEF46855.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.705 0.482 0.385 2.7e-52
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.679 0.369 0.394 1e-51
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.740 0.414 0.357 1.8e-51
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.695 0.358 0.368 1.2e-49
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.726 0.368 0.369 2.1e-49
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.853 0.422 0.329 3.1e-46
TAIR|locus:2825389784 RLP11 "AT1G71390" [Arabidopsis 0.792 0.491 0.334 6.7e-46
TAIR|locus:2094563595 RLP36 "receptor like protein 3 0.709 0.579 0.341 2.1e-45
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.798 0.478 0.338 2.3e-45
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.656 0.364 0.353 4.1e-45
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 542 (195.9 bits), Expect = 2.7e-52, P = 2.7e-52
 Identities = 142/368 (38%), Positives = 199/368 (54%)

Query:    33 LSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKW 92
             +++F GQIP S+GNL+ L  L L  NNF  ++P+ IG+LS L RLD        G IP W
Sbjct:   226 VNNFLGQIPSSIGNLSNLTSLYLCKNNFSGQIPSFIGNLSQLTRLD-LSSNNFFGEIPGW 284

Query:    93 LLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLS 152
             L   ++ N  Y+NLS N F  F Q P   P  ++     H L S NN TG+IPS+IC L 
Sbjct:   285 LW--TLPNLFYVNLSYNTFIGF-QRPNK-PEPSMG----HLLGSNNNFTGKIPSFICELR 336

Query:   153 SLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNL 212
             SL  LDLSDNN SG + +C+GN    LS L+L+  N  G  P        LR +D+ HN 
Sbjct:   337 SLETLDLSDNNFSGLIPRCMGNLKSNLSHLNLRQNNLSGGLPKHIFE--ILRSLDVGHNQ 394

Query:   213 LQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYF 272
             L GK+P+SL   + LE+ ++ +N+INDTFP WL SL +L +LVL      F G +    F
Sbjct:   395 LVGKLPRSLRFFSTLEVLNVESNRINDTFPFWLTSLPKLQVLVLRSN--AFHGPIHEASF 452

Query:   273 QCWNAMKFANSSQLRYMENXXXXXXXXXXXXXXPQN----DY--------SITMSNEGQM 320
                  +  +++     + +               ++    +Y        S+ + N+G  
Sbjct:   453 LKLRIIDISHNHFNGTLPSDYFVKWSAMSSLGTDEDRSNANYMGSVYYQDSMVLMNKGVE 512

Query:   321 MTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLES 380
                 +I  I   +  S N+F+GE+P SI  LK L VL L++N   GHIPS +G LT LES
Sbjct:   513 SELIRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFTGHIPSSMGKLTALES 572

Query:   381 LDLSKNRL 388
             LD+S+N+L
Sbjct:   573 LDVSQNKL 580


GO:0005886 "plasma membrane" evidence=ISM
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094563 RLP36 "receptor like protein 36" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00029112001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (1311 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  127 bits (321), Expect = 3e-31
 Identities = 120/429 (27%), Positives = 175/429 (40%), Gaps = 76/429 (17%)

Query: 34  SDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLERLDTFPPMKIHGNIPKWL 93
           ++ SG+IP  +G L  L  LDL +NN    +P+S+G+L +L+ L  +   K+ G IP  +
Sbjct: 222 NNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQN-KLSGPIPPSI 280

Query: 94  LNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICNLSS 153
              S++    L+LS N      + P ++     + +I H     NN TG+IP  + +L  
Sbjct: 281 F--SLQKLISLDLSDNSLS--GEIPELVIQLQ-NLEILHLF--SNNFTGKIPVALTSLPR 333

Query: 154 LYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLL 213
           L VL L  N  SGE+ + LG     L+VL L   N  G  P+   +  +L  + L  N L
Sbjct: 334 LQVLQLWSNKFSGEIPKNLGK-HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSL 392

Query: 214 QGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQ 273
           +G+IPKSL  C  L    L++N  +                    +LP    KLP  YF 
Sbjct: 393 EGEIPKSLGACRSLRRVRLQDNSFSG-------------------ELPSEFTKLPLVYFL 433

Query: 274 CWNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGI 333
             +          R  +       S    ++F     S                  L+ +
Sbjct: 434 DISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKR-------------LENL 480

Query: 334 ILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLT---- 389
            LS N+F G +P  + +L  L  L L+ N L G IP  L S   L SLDLS N+L+    
Sbjct: 481 DLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIP 540

Query: 390 --FLEF-----------------------------FNATHNNLTGPIPQANQFPTFGYSS 418
             F E                               N +HN+L G +P    F     S+
Sbjct: 541 ASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASA 600

Query: 419 FNGNSRLCG 427
             GN  LCG
Sbjct: 601 VAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 486
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
KOG4237498 consensus Extracellular matrix protein slit, conta 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PLN03150623 hypothetical protein; Provisional 99.53
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.42
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.38
PLN03150623 hypothetical protein; Provisional 99.31
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.06
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.79
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.56
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.5
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.47
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.12
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.11
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.98
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.97
PRK15386 426 type III secretion protein GogB; Provisional 97.95
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.91
PRK15386426 type III secretion protein GogB; Provisional 97.81
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.59
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.59
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.51
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.46
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.27
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.25
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.92
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.49
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.79
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.4
KOG4341483 consensus F-box protein containing LRR [General fu 95.29
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.15
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.85
KOG4341483 consensus F-box protein containing LRR [General fu 93.06
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.96
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.19
smart0037026 LRR Leucine-rich repeats, outliers. 92.19
KOG4308478 consensus LRR-containing protein [Function unknown 91.59
KOG1947482 consensus Leucine rich repeat proteins, some prote 90.39
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.33
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 90.04
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.01
smart0037026 LRR Leucine-rich repeats, outliers. 90.01
KOG4308478 consensus LRR-containing protein [Function unknown 89.87
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.1
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.71
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 83.25
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.08
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.7e-47  Score=416.27  Aligned_cols=414  Identities=30%  Similarity=0.433  Sum_probs=298.4

Q ss_pred             cccccCcccceeeeehhccCCC------hhhhhhc-cCCcccccCCcCCCCCCCCCEeeCcCCCCCCCCcccccCCCCCC
Q 048443            3 RCLCSELTRLTILLFYLMTSDS------PFLDRLQ-RLSDFSGQIPPSLGNLNQLQWLDLAFNNFLRELPASIGSLSSLE   75 (486)
Q Consensus         3 ~c~c~~l~~l~~~~~~~~~~~~------~~l~~L~-~~n~~~~~~p~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~   75 (486)
                      ++.+.+|++++++++.+....+      +.|+.|+ ++|.+.+.+|..++++++|++|+|++|++.+.+|..|+.+++|+
T Consensus       160 ~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~  239 (968)
T PLN00113        160 IGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLN  239 (968)
T ss_pred             HhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCC
Confidence            4567788888888877554433      3344444 67888888888888888888888888888888888888888888


Q ss_pred             eeccCCCCcccccCCchhccccCCCCcEEEccCCCCCCCCCCCCCCCcccc-cCccCeeecccCcccccCCccccCCCCC
Q 048443           76 RLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTL-STKIRHYLISKNNLTGEIPSWICNLSSL  154 (486)
Q Consensus        76 ~L~L~~~n~i~~~~p~~~~~~~l~~L~~L~Ls~N~l~~~~~l~~l~p~~~~-~~~L~~L~Ls~n~l~~~~~~~~~~l~~L  154 (486)
                      +|+++ +|.+++.+|..+.+  +++|++|++++|.+...      +|..+. +++|++|++++|.+++.+|..+.++++|
T Consensus       240 ~L~L~-~n~l~~~~p~~l~~--l~~L~~L~L~~n~l~~~------~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L  310 (968)
T PLN00113        240 HLDLV-YNNLTGPIPSSLGN--LKNLQYLFLYQNKLSGP------IPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNL  310 (968)
T ss_pred             EEECc-CceeccccChhHhC--CCCCCEEECcCCeeecc------CchhHhhccCcCEEECcCCeeccCCChhHcCCCCC
Confidence            88888 88888888888888  88888888888887643      444444 6667777777777666666666666677


Q ss_pred             CEEECcCCcCcccccchhhhcCCCCcEEEccCccccccCCccccCCCCccEEECcCCccccccCccCcCCCCCCEEEccC
Q 048443          155 YVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQGKIPKSLANCAVLEISDLRN  234 (486)
Q Consensus       155 ~~L~Ls~N~i~~~~~~~l~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~  234 (486)
                      +.|++++|.+.+..|..+..+++ |+.|++++|.+.+.+|..+..+++|+.|++++|.+++.+|.++..+++|+.|++++
T Consensus       311 ~~L~l~~n~~~~~~~~~~~~l~~-L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~  389 (968)
T PLN00113        311 EILHLFSNNFTGKIPVALTSLPR-LQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFS  389 (968)
T ss_pred             cEEECCCCccCCcCChhHhcCCC-CCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcC
Confidence            77777766666666666666665 66666666666666666666666666666666666666666665566666666666


Q ss_pred             CccccCCCccccCCCCCCEEEcCccCCCccccCChhhhhccccccccccccchhcccccc----------ccccccc---
Q 048443          235 NQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQLRYMENFLS----------SYFSFDF---  301 (486)
Q Consensus       235 N~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~ip~~~~~~l~~L~~l~~~~~~~~~~~~~----------~~~~~~~---  301 (486)
                      |.+.+..|.++..+++|+.|++++|.  +.+.+|.. |..++.|+.+++++|........          ..+..+.   
T Consensus       390 n~l~~~~p~~~~~~~~L~~L~L~~n~--l~~~~p~~-~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~  466 (968)
T PLN00113        390 NSLEGEIPKSLGACRSLRRVRLQDNS--FSGELPSE-FTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFG  466 (968)
T ss_pred             CEecccCCHHHhCCCCCCEEECcCCE--eeeECChh-HhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeee
Confidence            66655556555566666666665543  33344433 44555555555554432111100          0000000   


Q ss_pred             ---cccCCCCcceEEeecCCCccccCc---ccCcccEEEcccccccccCccchhccCCCCeeeCCCcccCccCchhccCC
Q 048443          302 ---YRYFPQNDYSITMSNEGQMMTHDK---IPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSL  375 (486)
Q Consensus       302 ---~~~~~~~~~~l~~~~~~~~~~~~~---~~~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l  375 (486)
                         ...-...+..++++++.+....+.   .++.|+.|++++|.+.+.+|..+..+++|++|+|++|.+++.+|..|..+
T Consensus       467 ~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l  546 (968)
T PLN00113        467 GLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEM  546 (968)
T ss_pred             ecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCc
Confidence               001124577888888887655443   36789999999999999999999999999999999999999999999999


Q ss_pred             CCCCEEeCCCCC-----------CCCCCEEeccCCccccCCCCCCCCCCCCCccccCCcCCCCCC
Q 048443          376 TNLESLDLSKNR-----------LTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKP  429 (486)
Q Consensus       376 ~~L~~L~Ls~N~-----------l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~~np~~c~~~  429 (486)
                      ++|+.|||++|+           +++|+.+++++|+++|.+|...++.++...++.|||.+|+.+
T Consensus       547 ~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        547 PVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             ccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999           457999999999999999999999999999999999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-21
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-21
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-07
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 99.0 bits (245), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 126/455 (27%), Positives = 184/455 (40%), Gaps = 71/455 (15%) Query: 36 FSGQIPPSLGNLNQLQWLDLAFNNFLRELPA-SIGSLSSLERLDTFPPMKIHGNIPKWLL 94 F G +PP G+ + L+ L L+ NNF ELP ++ + L+ LD + G +P+ L Sbjct: 303 FYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD-LSFNEFSGELPESLT 361 Query: 95 NPSMKNFSYLNLSKNYF-----PRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWIC 149 N S + L+LS N F P Q+P ++ + N TG+IP + Sbjct: 362 NLSASLLT-LDLSSNNFSGPILPNLCQNP--------KNTLQELYLQNNGFTGKIPPTLS 412 Query: 150 NLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLS 209 N S L L LS N LSG + LG+ S L L L G P M L + L Sbjct: 413 NCSELVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILD 471 Query: 210 HNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPS 269 N L G+IP L+NC L L NN++ P W+G L L IL L F G +P+ Sbjct: 472 FNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN--SFSGNIPA 529 Query: 270 KYFQCWNAMKFA-NSSQLRYMENXXXXXXXXXXXXXXPQNDYSITMSNEGQMMTHDKIPD 328 + C + + N++ + + N+G + Sbjct: 530 ELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGN 589 Query: 329 IL--KGII--------------LSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCL 372 +L +GI ++S + G + N + L ++ N L G+IP + Sbjct: 590 LLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEI 649 Query: 373 GS------------------------LTNLESLDLSKNR-----------LTFLEFFNAT 397 GS L L LDLS N+ LT L + + Sbjct: 650 GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLS 709 Query: 398 HNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPK 432 +NNL+GPIP+ QF TF + F N LCG PLP+ Sbjct: 710 NNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR 744
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-83
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-47
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-47
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-43
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-28
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-20
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-40
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-29
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  273 bits (700), Expect = 1e-83
 Identities = 116/464 (25%), Positives = 176/464 (37%), Gaps = 79/464 (17%)

Query: 36  FSGQIPPSLGNLNQLQWLDLAFNNFLRELPA-SIGSLSSLERLDTFPPMKIHGNIPKWLL 94
           F G +PP  G+ + L+ L L+ NNF  ELP  ++  +  L+ LD     +  G +P+ L 
Sbjct: 306 FYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD-LSFNEFSGELPESLT 364

Query: 95  NPSMKNFSYLNLSKNYF----PRFDQHPTVLPWTTLSTKIRHYLISKNNLTGEIPSWICN 150
           N S  +   L+LS N F                      ++   +  N  TG+IP  + N
Sbjct: 365 NLSA-SLLTLDLSSNNFSGPILPNL-------CQNPKNTLQELYLQNNGFTGKIPPTLSN 416

Query: 151 LSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSH 210
            S L  L LS N LSG +   LG+ S  L  L L      G  P   M    L  + L  
Sbjct: 417 CSELVSLHLSFNYLSGTIPSSLGSLSK-LRDLKLWLNMLEGEIPQELMYVKTLETLILDF 475

Query: 211 NLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVL------------IQ 258
           N L G+IP  L+NC  L    L NN++    P W+G L  L IL L            + 
Sbjct: 476 NDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELG 535

Query: 259 QLPC----------FMGKLPSKYFQCWNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQN 308
                         F G +P+  F+    +     +  RY+    +     + +      
Sbjct: 536 DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVY-IKNDGMKKECHGAGNLL 594

Query: 309 DYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHI 368
           ++    S +   ++            ++S  + G    +  N   +  L ++ N L G+I
Sbjct: 595 EFQGIRSEQLNRLST------RNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYI 648

Query: 369 PSCLGSLTNLESLDLSKNRLT-----------FLEFFNATHNNLTGPIPQA--------- 408
           P  +GS+  L  L+L  N ++            L   + + N L G IPQA         
Sbjct: 649 PKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTE 708

Query: 409 ---------------NQFPTFGYSSFNGNSRLCGKPLPKECASD 437
                           QF TF  + F  N  LCG PLP+   S+
Sbjct: 709 IDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSN 752


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.28
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.27
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.15
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.45
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.33
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.79
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.45
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.95
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7.4e-50  Score=427.89  Aligned_cols=425  Identities=30%  Similarity=0.448  Sum_probs=326.5

Q ss_pred             ccccCcccceeeeehhccC----CChhhhhhc-cCCcccccCCcCCCCC-CCCCEeeCcCCCCCCCCcccccCCCCCCee
Q 048443            4 CLCSELTRLTILLFYLMTS----DSPFLDRLQ-RLSDFSGQIPPSLGNL-NQLQWLDLAFNNFLRELPASIGSLSSLERL   77 (486)
Q Consensus         4 c~c~~l~~l~~~~~~~~~~----~~~~l~~L~-~~n~~~~~~p~~~~~l-~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L   77 (486)
                      ..|.+|++++++.+.+...    ..+.++.|+ ++|.+++.+|..+... ++|++|++++|++.+.+|..|+.+++|++|
T Consensus       244 ~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L  323 (768)
T 3rgz_A          244 STCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESL  323 (768)
T ss_dssp             TTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEE
T ss_pred             hcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEE
Confidence            3455666666665553322    224455555 6677777777777664 788888888888777778888888888888


Q ss_pred             ccCCCCcccccCCch-hccccCCCCcEEEccCCCCC-CCCC-C---C-CC-------------CCcccc---cCccCeee
Q 048443           78 DTFPPMKIHGNIPKW-LLNPSMKNFSYLNLSKNYFP-RFDQ-H---P-TV-------------LPWTTL---STKIRHYL  134 (486)
Q Consensus        78 ~L~~~n~i~~~~p~~-~~~~~l~~L~~L~Ls~N~l~-~~~~-l---~-~l-------------~p~~~~---~~~L~~L~  134 (486)
                      +++ +|.+.+.+|.. +..  +++|++|++++|.++ .+|. +   . .+             +|..+.   +++|++|+
T Consensus       324 ~L~-~n~l~~~ip~~~l~~--l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~  400 (768)
T 3rgz_A          324 ALS-SNNFSGELPMDTLLK--MRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY  400 (768)
T ss_dssp             ECC-SSEEEEECCHHHHTT--CTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEE
T ss_pred             ECC-CCcccCcCCHHHHhc--CCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEE
Confidence            888 78877777765 666  778888888887775 3332 1   0 11             222222   46788888


Q ss_pred             cccCcccccCCccccCCCCCCEEECcCCcCcccccchhhhcCCCCcEEEccCccccccCCccccCCCCccEEECcCCccc
Q 048443          135 ISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQ  214 (486)
Q Consensus       135 Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~i~~~~~~~l~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~N~l~  214 (486)
                      +++|++++.+|..+..+++|++|++++|.+++..|..+..++. |+.|++++|.+.+.+|..+..+++|++|++++|.++
T Consensus       401 L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~-L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~  479 (768)
T 3rgz_A          401 LQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK-LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLT  479 (768)
T ss_dssp             CCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTT-CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCC
T ss_pred             CCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCC-CCEEECCCCcccCcCCHHHcCCCCceEEEecCCccc
Confidence            8888888888888889999999999999998888888988887 999999999999888988999999999999999999


Q ss_pred             cccCccCcCCCCCCEEEccCCccccCCCccccCCCCCCEEEcCccCCCccccCChhhhhccccccccccccchhcccccc
Q 048443          215 GKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQLRYMENFLS  294 (486)
Q Consensus       215 ~~~p~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~ip~~~~~~l~~L~~l~~~~~~~~~~~~~  294 (486)
                      +.+|.++..+++|++|++++|++.+..|.+++.+++|+.|++++|.  +.+.+|.. +..+++|+.+++++|........
T Consensus       480 ~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~--l~~~~p~~-l~~l~~L~~L~Ls~N~l~g~ip~  556 (768)
T 3rgz_A          480 GEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNS--FSGNIPAE-LGDCRSLIWLDLNTNLFNGTIPA  556 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC--CEEECCGG-GGGCTTCCEEECCSSEEESBCCG
T ss_pred             CcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCc--ccCcCCHH-HcCCCCCCEEECCCCccCCcCCh
Confidence            8889999999999999999999998999999999999999999985  66777766 78889999999998854422222


Q ss_pred             cccccccccc--CCCCcc-------------------------------------eEEeecCCCcc---ccCcccCcccE
Q 048443          295 SYFSFDFYRY--FPQNDY-------------------------------------SITMSNEGQMM---THDKIPDILKG  332 (486)
Q Consensus       295 ~~~~~~~~~~--~~~~~~-------------------------------------~l~~~~~~~~~---~~~~~~~~L~~  332 (486)
                      ..........  +.....                                     .+++..+....   .....++.|+.
T Consensus       557 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~  636 (768)
T 3rgz_A          557 AMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMF  636 (768)
T ss_dssp             GGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCE
T ss_pred             HHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccE
Confidence            1111000000  000000                                     00000011111   11223578999


Q ss_pred             EEcccccccccCccchhccCCCCeeeCCCcccCccCchhccCCCCCCEEeCCCCC-----------CCCCCEEeccCCcc
Q 048443          333 IILSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNR-----------LTFLEFFNATHNNL  401 (486)
Q Consensus       333 L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~-----------l~~L~~L~ls~N~l  401 (486)
                      ||+++|++++.+|..++.+++|+.|+|++|+++|.+|..|+++++|++|||++|+           +++|++||+++|++
T Consensus       637 LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l  716 (768)
T 3rgz_A          637 LDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNL  716 (768)
T ss_dssp             EECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEE
T ss_pred             EECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcc
Confidence            9999999999999999999999999999999999999999999999999999999           66899999999999


Q ss_pred             ccCCCCCCCCCCCCCccccCCcCCCCCCCCCCCCC
Q 048443          402 TGPIPQANQFPTFGYSSFNGNSRLCGKPLPKECAS  436 (486)
Q Consensus       402 ~~~~p~~~~~~~~~~~~~~~np~~c~~~~~~~C~~  436 (486)
                      +|.+|.+.+|.++...+|.|||.+||.|.. .|..
T Consensus       717 ~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~  750 (768)
T 3rgz_A          717 SGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDP  750 (768)
T ss_dssp             EEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCS
T ss_pred             cccCCCchhhccCCHHHhcCCchhcCCCCc-CCCC
Confidence            999999999999999999999999999987 8976



>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 486
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 83.6 bits (205), Expect = 2e-18
 Identities = 59/278 (21%), Positives = 93/278 (33%), Gaps = 23/278 (8%)

Query: 157 LDLSDNNLSG--ELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDLRMVDLSHNLLQ 214
           LDLS  NL     +   L N      +      N  G  P      + L  + ++H  + 
Sbjct: 55  LDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS 114

Query: 215 GKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQC 274
           G IP  L+    L   D   N ++ T P  + SL  L  +          G +P  Y   
Sbjct: 115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN--RISGAIPDSYGSF 172

Query: 275 WNAMKFANSSQLRYMENFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGII 334
                    S+ R       ++ + +        +     ++       +     L    
Sbjct: 173 SKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNS 232

Query: 335 LSSNRFDGEMPTSIANLKGLQVLGLASNNLQGHIPSCLGSLTNLESLDLSKNRLTFLEFF 394
           L+ +     +  ++        L L +N + G +P  L  L  L SL++S          
Sbjct: 233 LAFDLGKVGLSKNL------NGLDLRNNRIYGTLPQGLTQLKFLHSLNVS---------- 276

Query: 395 NATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPK 432
               NNL G IPQ      F  S++  N  LCG PLP 
Sbjct: 277 ---FNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLPA 311


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.57
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.5
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.78
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.62
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.24
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.62
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=5e-31  Score=249.91  Aligned_cols=259  Identities=31%  Similarity=0.498  Sum_probs=137.4

Q ss_pred             CCCEeeCcCCCCCC--CCcccccCCCCCCeeccCCCCcccccCCchhccccCCCCcEEEccCCCCCCCCCCCCCCCcccc
Q 048443           49 QLQWLDLAFNNFLR--ELPASIGSLSSLERLDTFPPMKIHGNIPKWLLNPSMKNFSYLNLSKNYFPRFDQHPTVLPWTTL  126 (486)
Q Consensus        49 ~L~~L~Ls~n~~~~--~~~~~~~~l~~L~~L~L~~~n~i~~~~p~~~~~~~l~~L~~L~Ls~N~l~~~~~l~~l~p~~~~  126 (486)
                      +++.|+|++|.+.+  .+|..++++++|++|+|++.|++.|.+|.++.+  +++|++|+|++|++..             
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~--L~~L~~L~Ls~N~l~~-------------  115 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAK--LTQLHYLYITHTNVSG-------------  115 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGG--CTTCSEEEEEEECCEE-------------
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCcccccccccccccccccccccccc--ccccchhhhccccccc-------------
Confidence            46666666666655  355666666666666665125666666666666  5666666665555544             


Q ss_pred             cCccCeeecccCcccccCCccccCCCCCCEEECcCCcCcccccchhhhcCCCCcEEEccCccccccCCccccCCCCc-cE
Q 048443          127 STKIRHYLISKNNLTGEIPSWICNLSSLYVLDLSDNNLSGELLQCLGNFSGGLSVLSLQGKNFFGTTPDTFMNGSDL-RM  205 (486)
Q Consensus       127 ~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~i~~~~~~~l~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L-~~  205 (486)
                                      ..+..+..+.+|+.+++++|.+.+.+|..+..++. ++.+++++|.+.+.+|..+..+..+ +.
T Consensus       116 ----------------~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~-L~~l~l~~n~l~~~ip~~~~~l~~l~~~  178 (313)
T d1ogqa_         116 ----------------AIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPN-LVGITFDGNRISGAIPDSYGSFSKLFTS  178 (313)
T ss_dssp             ----------------ECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTT-CCEEECCSSCCEEECCGGGGCCCTTCCE
T ss_pred             ----------------cccccccchhhhcccccccccccccCchhhccCcc-cceeeccccccccccccccccccccccc
Confidence                            44444444444444444444444444444444444 4455555555444444444444433 45


Q ss_pred             EECcCCccccccCccCcCCCCCCEEEccCCccccCCCccccCCCCCCEEEcCccCCCccccCChhhhhcccccccccccc
Q 048443          206 VDLSHNLLQGKIPKSLANCAVLEISDLRNNQINDTFPIWLGSLLELNILVLIQQLPCFMGKLPSKYFQCWNAMKFANSSQ  285 (486)
Q Consensus       206 L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~ip~~~~~~l~~L~~l~~~~  285 (486)
                      +++++|++++..|..+..+..+ .++++.+...+..|..+..+++                                   
T Consensus       179 l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~-----------------------------------  222 (313)
T d1ogqa_         179 MTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKN-----------------------------------  222 (313)
T ss_dssp             EECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSC-----------------------------------
T ss_pred             cccccccccccccccccccccc-cccccccccccccccccccccc-----------------------------------
Confidence            5555555555555544444332 4555555554444433332222                                   


Q ss_pred             chhccccccccccccccccCCCCcceEEeecCCCccccCcccCcccEEEcccccccccCccchhccCCCCeeeCCCcccC
Q 048443          286 LRYMENFLSSYFSFDFYRYFPQNDYSITMSNEGQMMTHDKIPDILKGIILSSNRFDGEMPTSIANLKGLQVLGLASNNLQ  365 (486)
Q Consensus       286 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~  365 (486)
                                                                  ++.+++++|.+.+.+| .+..+++|++|+|++|+++
T Consensus       223 --------------------------------------------l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~  257 (313)
T d1ogqa_         223 --------------------------------------------TQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIY  257 (313)
T ss_dssp             --------------------------------------------CSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCE
T ss_pred             --------------------------------------------cccccccccccccccc-ccccccccccccCccCeec
Confidence                                                        3333344444443222 3445555666666666666


Q ss_pred             ccCchhccCCCCCCEEeCCCCCCCCCCEEeccCCccccCCCCCCCCCCCCCccccCCcCCCCCCCCCCC
Q 048443          366 GHIPSCLGSLTNLESLDLSKNRLTFLEFFNATHNNLTGPIPQANQFPTFGYSSFNGNSRLCGKPLPKEC  434 (486)
Q Consensus       366 ~~~~~~~~~l~~L~~L~Ls~N~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~~np~~c~~~~~~~C  434 (486)
                      |.+|+.|+++++|++|||+             +|+|+|.+|....+..++.+++.||+.+||.|++ .|
T Consensus       258 g~iP~~l~~L~~L~~L~Ls-------------~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         258 GTLPQGLTQLKFLHSLNVS-------------FNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             ECCCGGGGGCTTCCEEECC-------------SSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             ccCChHHhCCCCCCEEECc-------------CCcccccCCCcccCCCCCHHHhCCCccccCCCCC-CC
Confidence            5566656555555444444             3345555665555556666667777777877764 56



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure