Citrus Sinensis ID: 048456

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MLNRTRSFSSSSGISMENLASLRRSASDSLALMSSTNVIKIGVGDNFSFEGDVETRKGDDDNNNNNHLNYSSDKKPSSANNEVRALTPIDSSSKIEPQKSVASNDHGKGPKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVLGKMNREMKEMMEALENETAAKEAEFQALMEEKEALGLAYRLLGEGK
ccccccccccccccccccccHHHHccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cccccccccccccccEccccccccccccccHHccccccccccccccccccccHHHcccccccccccccccccccccccccHHHccccccccccccccHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
mlnrtrsfssssgismENLASLRRSASDSLALmsstnvikigvgdnfsfegdvetrkgdddnnnnnhlnyssdkkpssannevraltpidssskiepqksvasndhgkgpKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVLGKMNREMKEMMEALENETAAKEAEFQALMEEKEALGLAYRLLGEGK
mlnrtrsfssssgisMENLASLRRSASDSLALMSStnvikigvgdnFSFEGDVEtrkgdddnnnnnhlnyssdkkpssanNEVRALtpidssskiepqksvasndhgkgpkrMKRLLAnrvsaqrsrlrnlAYMEKLKKEIDNEEARLSVLlplvshyeTECKVLGKMNREMKEMMEALENETAAKEAEFQALMEEKEALGLAYRLLGEGK
MLNRTRsfssssgisMENlaslrrsasdslalmssTNVIKIGVGDNFSFEGDVETRKGdddnnnnnHLNYSSDKKPSSANNEVRALTPIDSSSKIEPQKSVASNDHGKGPKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVLGKMNREMKEMMEALENETAAKEAEFQALMEEKEALGLAYRLLGEGK
************************************NVIKIGVGDNF************************************************************************************AYM*********EEARLSVLLPLVSHYETECKVLG***********************************LAY*******
***********************************************************************************************************************************AYMEKLKKEIDNEEARLSVLLPLVSHYETECKV*G*************************ALMEEKEAL***********
*************ISMENLASLRRSASDSLALMSSTNVIKIGVGDNFSFEGDVETRKGDDDNNNNNHLNYS**********EVRALTPIDSS*****************PKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVLGKMNREMKEMMEALENETAAKEAEFQALMEEKEALGLAYRLLGEGK
**********************************************************************************************************GKGPKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVLGKMNREMKEMMEALENETAAKEAEFQALMEEKEALGLAYRLLG***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNRTRSFSSSSGISMENLASLRRSASDSLALMSSTNVIKIGVGDNFSFEGDVETRKGDDDNNNNNHLNYSSDKKPSSANNEVRALTPIDSSSKIEPQKSVASNDHGKGPKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKEALGLAYRLLGEGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
Q6S4P4329 Transcription factor RF2b no no 0.445 0.285 0.329 8e-06
Q9MA75341 Transcription factor VIP1 no no 0.412 0.255 0.321 8e-05
>sp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b OS=Oryza sativa subsp. japonica GN=RF2b PE=1 SV=1 Back     alignment and function desciption
 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 54/94 (57%)

Query: 110 PKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVLGKMN 169
           PKR KR+LANR SA RS+ R   Y+ +L++++   +   + L   ++ ++ +   L   N
Sbjct: 133 PKRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDTTGLSAEN 192

Query: 170 REMKEMMEALENETAAKEAEFQALMEEKEALGLA 203
            E+K  ++A+E +   ++A   AL +E E L LA
Sbjct: 193 AELKIRLQAMEQQAQLRDALNDALKQELERLKLA 226
Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q9MA75|VIP1_ARATH Transcription factor VIP1 OS=Arabidopsis thaliana GN=VIP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
224139214175 predicted protein [Populus trichocarpa] 0.459 0.554 0.489 3e-13
18491297311 At2g42380/MHK10.10 [Arabidopsis thaliana 0.862 0.585 0.309 1e-11
30689007 321 basic helix-loop-helix domain-containing 0.862 0.566 0.309 1e-11
297827913 321 bZIP transcription factor family protein 0.549 0.361 0.370 2e-11
224122022 317 predicted protein [Populus trichocarpa] 0.554 0.369 0.369 6e-11
357136496276 PREDICTED: transcription factor RF2b-lik 0.606 0.463 0.333 8e-11
15230964 329 basic leucine zipper transcription facto 0.549 0.352 0.354 1e-10
168022272 464 predicted protein [Physcomitrella patens 0.545 0.247 0.373 1e-10
297820612 329 bZIP transcription factor family protein 0.549 0.352 0.354 2e-10
225446525295 PREDICTED: uncharacterized protein LOC10 0.549 0.393 0.388 2e-10
>gi|224139214|ref|XP_002323008.1| predicted protein [Populus trichocarpa] gi|222867638|gb|EEF04769.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 111 KRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVLGKMNR 170
           KR+KR++ANR+SAQRSRLR L Y+EKL++++  EE ++  L    S Y+     L   N 
Sbjct: 76  KRIKRIMANRLSAQRSRLRKLVYVEKLERDVKAEEVKVYWLSLQESLYQQSQMALQTENT 135

Query: 171 EMKEMMEALENETAAKEAEFQALMEEKEAL-GLAYRLL 207
            +KE+ME LE E A KE EFQ L +E +AL G + RLL
Sbjct: 136 HIKEIMEGLEREKAMKEVEFQYLKKELQALRGASMRLL 173

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|18491297|gb|AAL69473.1| At2g42380/MHK10.10 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30689007|ref|NP_850369.1| basic helix-loop-helix domain-containing protein [Arabidopsis thaliana] gi|330255020|gb|AEC10114.1| basic helix-loop-helix domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297827913|ref|XP_002881839.1| bZIP transcription factor family protein [Arabidopsis lyrata subsp. lyrata] gi|297327678|gb|EFH58098.1| bZIP transcription factor family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224122022|ref|XP_002330711.1| predicted protein [Populus trichocarpa] gi|222872315|gb|EEF09446.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357136496|ref|XP_003569840.1| PREDICTED: transcription factor RF2b-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|15230964|ref|NP_191371.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana] gi|15100055|gb|AAK84223.1|AF401300_1 transcription factor bZIP61 [Arabidopsis thaliana] gi|6735324|emb|CAB68150.1| putative protein [Arabidopsis thaliana] gi|20260308|gb|AAM13052.1| pelota-like protein [Arabidopsis thaliana] gi|21592956|gb|AAM64906.1| unknown [Arabidopsis thaliana] gi|30984556|gb|AAP42741.1| At3g58120 [Arabidopsis thaliana] gi|332646223|gb|AEE79744.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|168022272|ref|XP_001763664.1| predicted protein [Physcomitrella patens subsp. patens] gi|162685157|gb|EDQ71554.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|297820612|ref|XP_002878189.1| bZIP transcription factor family protein [Arabidopsis lyrata subsp. lyrata] gi|297324027|gb|EFH54448.1| bZIP transcription factor family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225446525|ref|XP_002275912.1| PREDICTED: uncharacterized protein LOC100243740 [Vitis vinifera] gi|302143381|emb|CBI21942.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
TAIR|locus:2085425329 BZIP61 [Arabidopsis thaliana ( 0.753 0.483 0.303 1.5e-14
TAIR|locus:2053761321 BZIP34 "AT2G42380" [Arabidopsi 0.549 0.361 0.370 2.9e-14
TAIR|locus:2033123337 bZIP52 "AT1G06850" [Arabidopsi 0.521 0.326 0.294 3.7e-09
TAIR|locus:2061908 367 AT2G40620 "AT2G40620" [Arabido 0.545 0.313 0.286 7e-08
TAIR|locus:2047082525 AT2G21230 "AT2G21230" [Arabido 0.369 0.148 0.333 1.3e-07
TAIR|locus:2198856 423 AT1G06070 "AT1G06070" [Arabido 0.630 0.314 0.281 1.5e-06
TAIR|locus:2031123341 VIP1 "VIRE2-interacting protei 0.431 0.266 0.318 1.5e-06
TAIR|locus:2061340398 AT2G31370 [Arabidopsis thalian 0.611 0.324 0.248 0.00013
TAIR|locus:2148007168 HY5 "ELONGATED HYPOCOTYL 5" [A 0.426 0.535 0.305 0.00038
TAIR|locus:2141826553 AT4G38900 "AT4G38900" [Arabido 0.445 0.169 0.3 0.0004
TAIR|locus:2085425 BZIP61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 1.5e-14, P = 1.5e-14
 Identities = 51/168 (30%), Positives = 84/168 (50%)

Query:    45 DNFSFEGDVETRKGXXXXXXXXHLNYSSDKKPSSANNEVRALTPIDSSSKIEPQKSVASN 104
             D+ S   D +  K         H++ +   + ++A N       + S  K EPQ   ++N
Sbjct:   131 DHNSLSDD-DNNKEAPPSDHDHHMDNNVANQNNAAGNNYNESDEVQSQCKTEPQDGPSAN 189

Query:   105 DHGKG--------PKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVS 156
              +  G        PKR+KR+LANR SAQRSR+R L Y+ +L++ + + +  +SVL P V+
Sbjct:   190 QNSGGSSGNRIHDPKRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSVLSPRVA 249

Query:   157 HYETECKVLGKMNREMKEMMEALENETAAKEAEFQALMEEKEALGLAY 204
               + +  +L   N  +K+ + AL  +   K+A  +AL  E E L   Y
Sbjct:   250 FLDHQRLLLNVDNSAIKQRIAALAQDKIFKDAHQEALKREIERLRQVY 297
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0003677 "DNA binding" evidence=IDA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2053761 BZIP34 "AT2G42380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047082 AT2G21230 "AT2G21230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061340 AT2G31370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148007 HY5 "ELONGATED HYPOCOTYL 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141826 AT4G38900 "AT4G38900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
smart0033865 smart00338, BRLZ, basic region leucin zipper 1e-04
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 0.004
pfam05266190 pfam05266, DUF724, Protein of unknown function (DU 0.004
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 38.7 bits (91), Expect = 1e-04
 Identities = 19/64 (29%), Positives = 32/64 (50%)

Query: 108 KGPKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVLGK 167
           +  KR +R   NR +A+RSR R  A +E+L+++++  EA    L   +     E + L  
Sbjct: 2   EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKS 61

Query: 168 MNRE 171
              E
Sbjct: 62  ELEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|114015 pfam05266, DUF724, Protein of unknown function (DUF724) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
smart0033865 BRLZ basic region leucin zipper. 99.47
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.38
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 99.34
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.16
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.08
KOG0709 472 consensus CREB/ATF family transcription factor [Tr 98.99
KOG3584348 consensus cAMP response element binding protein an 98.7
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 97.86
KOG4571294 consensus Activating transcription factor 4 [Trans 97.78
KOG0837279 consensus Transcriptional activator of the JUN fam 97.71
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.72
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 96.55
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.44
PRK13169110 DNA replication intiation control protein YabA; Re 96.43
KOG3119269 consensus Basic region leucine zipper transcriptio 96.27
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.06
PRK1542279 septal ring assembly protein ZapB; Provisional 95.9
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 95.81
PF14662 193 CCDC155: Coiled-coil region of CCDC155 95.68
PRK10884206 SH3 domain-containing protein; Provisional 95.63
COG307479 Uncharacterized protein conserved in bacteria [Fun 95.46
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 95.4
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 95.11
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.56
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.46
COG4467114 Regulator of replication initiation timing [Replic 94.24
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 94.0
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 93.84
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 93.61
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.21
PRK11637 428 AmiB activator; Provisional 93.2
TIGR0244965 conserved hypothetical protein TIGR02449. Members 93.08
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.06
COG2433 652 Uncharacterized conserved protein [Function unknow 92.91
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 92.72
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 92.69
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 92.34
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 92.26
PRK11637 428 AmiB activator; Provisional 92.05
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 92.05
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 91.84
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 91.68
COG307479 Uncharacterized protein conserved in bacteria [Fun 91.62
COG4026290 Uncharacterized protein containing TOPRIM domain, 91.55
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 91.4
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 91.21
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 91.17
PRK09039 343 hypothetical protein; Validated 91.15
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.12
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 91.12
PRK0029568 hypothetical protein; Provisional 91.11
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.03
PRK10884206 SH3 domain-containing protein; Provisional 90.8
PRK0211973 hypothetical protein; Provisional 90.57
PRK0279372 phi X174 lysis protein; Provisional 90.33
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 90.28
PRK0073668 hypothetical protein; Provisional 90.19
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 89.93
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 89.89
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 89.77
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 89.72
PRK0432574 hypothetical protein; Provisional 89.72
PRK0440675 hypothetical protein; Provisional 89.59
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 89.59
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 89.58
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 89.45
KOG0982 502 consensus Centrosomal protein Nuf [Cell cycle cont 89.36
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 89.29
PF15290 305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 89.09
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 88.94
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 88.9
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 88.86
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 88.47
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 88.4
PF05837106 CENP-H: Centromere protein H (CENP-H); InterPro: I 88.05
COG2433 652 Uncharacterized conserved protein [Function unknow 87.95
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 87.86
PF10186 302 Atg14: UV radiation resistance protein and autopha 87.86
PRK0084677 hypothetical protein; Provisional 87.77
COG4942 420 Membrane-bound metallopeptidase [Cell division and 87.65
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 87.59
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 87.44
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 87.35
PF00038 312 Filament: Intermediate filament protein; InterPro: 87.11
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 87.02
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 86.88
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 86.85
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 86.84
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 86.8
PRK13169110 DNA replication intiation control protein YabA; Re 86.69
PF10186 302 Atg14: UV radiation resistance protein and autopha 86.66
COG4026290 Uncharacterized protein containing TOPRIM domain, 86.57
PRK09039 343 hypothetical protein; Validated 86.5
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 86.22
PRK04863 1486 mukB cell division protein MukB; Provisional 86.2
PRK13922 276 rod shape-determining protein MreC; Provisional 86.06
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 85.93
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 85.85
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 85.76
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 85.62
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 85.54
smart0033865 BRLZ basic region leucin zipper. 85.44
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 85.27
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 85.23
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 85.15
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 85.08
PF1374789 DUF4164: Domain of unknown function (DUF4164) 84.96
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 84.84
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 84.76
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 84.11
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 84.1
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 84.03
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 83.64
KOG0971 1243 consensus Microtubule-associated protein dynactin 83.49
PRK0211973 hypothetical protein; Provisional 83.4
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 83.24
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 83.17
PF13851201 GAS: Growth-arrest specific micro-tubule binding 83.15
PRK0440675 hypothetical protein; Provisional 83.12
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 83.11
KOG3650120 consensus Predicted coiled-coil protein [General f 83.04
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 82.98
PF14817 632 HAUS5: HAUS augmin-like complex subunit 5 82.96
KOG0971 1243 consensus Microtubule-associated protein dynactin 82.73
PF15294278 Leu_zip: Leucine zipper 82.54
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 82.19
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 82.16
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 82.09
PRK00888105 ftsB cell division protein FtsB; Reviewed 80.96
TIGR0220985 ftsL_broad cell division protein FtsL. This model 80.86
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 80.84
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 80.6
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 80.34
PRK13922 276 rod shape-determining protein MreC; Provisional 80.29
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 80.2
PRK10803 263 tol-pal system protein YbgF; Provisional 80.1
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.47  E-value=4e-13  Score=95.41  Aligned_cols=62  Identities=29%  Similarity=0.304  Sum_probs=55.5

Q ss_pred             CChHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 048456          108 KGPKRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVLGKMN  169 (211)
Q Consensus       108 ~d~KR~KR~l~NReSAqrSR~RKk~yieeLE~kv~~L~~en~~L~~~l~~L~~~~~~L~~EN  169 (211)
                      .|+|+.+|+++||+||+++|+||+.|+.+||.+|..|+.+|..|..++..|..++..|..++
T Consensus         2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            57899999999999999999999999999999999999999999999999985555554443

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3650 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF14817 HAUS5: HAUS augmin-like complex subunit 5 Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 3e-05
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 2e-04
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 2e-04
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 5e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-04
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 6e-04
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 8e-04
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
 Score = 39.6 bits (93), Expect = 3e-05
 Identities = 16/55 (29%), Positives = 27/55 (49%)

Query: 111 KRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETECKVL 165
           KR K L  NR +A RSR +   +++ L+K+ ++  +    L   V+    E   L
Sbjct: 1   KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQL 55
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.58
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.41
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.37
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.25
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.11
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.05
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.98
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.49
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.46
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 98.46
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.0
2wt7_B90 Transcription factor MAFB; transcription, transcri 97.87
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 96.81
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 95.57
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 94.85
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 94.0
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.8
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 93.74
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 93.68
1deb_A54 APC protein, adenomatous polyposis coli protein; c 93.41
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 92.94
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 92.86
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.43
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 92.29
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 92.17
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 91.77
3m48_A33 General control protein GCN4; leucine zipper, synt 91.37
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 91.24
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 91.09
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 91.02
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 91.02
3cve_A72 Homer protein homolog 1; coiled coil, alternative 90.76
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 90.39
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 90.31
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 89.99
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 89.97
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 89.74
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 89.59
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 89.37
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 89.22
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 89.08
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 89.05
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 88.66
3cve_A72 Homer protein homolog 1; coiled coil, alternative 88.46
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 88.37
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 87.86
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 87.81
1uo4_A34 General control protein GCN4; four helix bundle, c 87.66
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 87.41
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 87.35
2hy6_A34 General control protein GCN4; protein design, para 87.01
1fmh_A33 General control protein GCN4; coiled coil, leucine 86.97
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 86.9
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 86.69
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 86.43
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 86.19
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 86.05
2bni_A34 General control protein GCN4; four helix bundle, a 85.73
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 85.64
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 84.93
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 84.8
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 84.79
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 84.63
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 84.4
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 84.09
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 84.03
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 83.79
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 83.76
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 83.58
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 83.28
4emc_A 190 Monopolin complex subunit CSM1; RWD domain, kineto 83.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 82.38
3plt_A234 Sphingolipid long chain base-responsive protein L; 82.3
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 82.26
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 81.22
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 81.08
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 80.72
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 80.47
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.58  E-value=2.9e-15  Score=103.60  Aligned_cols=52  Identities=25%  Similarity=0.339  Sum_probs=48.9

Q ss_pred             HHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 048456          111 KRMKRLLANRVSAQRSRLRNLAYMEKLKKEIDNEEARLSVLLPLVSHYETEC  162 (211)
Q Consensus       111 KR~KR~l~NReSAqrSR~RKk~yieeLE~kv~~L~~en~~L~~~l~~L~~~~  162 (211)
                      ||.+|+++||+||++||.||++|+++||.+|..|+.+|..|..++..|++.+
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6899999999999999999999999999999999999999999999987654
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 82.85
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myc proto-oncogene protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=82.85  E-value=1.3  Score=29.97  Aligned_cols=12  Identities=17%  Similarity=0.288  Sum_probs=4.7

Q ss_pred             HHHHHHHHHHHH
Q 048456          133 YMEKLKKEIDNE  144 (211)
Q Consensus       133 yieeLE~kv~~L  144 (211)
                      ||..|+.++..|
T Consensus        53 yI~~L~~~~~~l   64 (88)
T d1nkpa_          53 YILSVQAEEQKL   64 (88)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            444443333333