Citrus Sinensis ID: 048501
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 143 | ||||||
| 163914165 | 139 | histon H3 protein [Vitis hybrid cultivar | 0.944 | 0.971 | 0.823 | 1e-55 | |
| 15232146 | 136 | histone H3 [Arabidopsis thaliana] gi|152 | 0.930 | 0.977 | 0.797 | 1e-52 | |
| 414587287 | 169 | TPA: histone H3.2 [Zea mays] | 0.930 | 0.786 | 0.797 | 1e-52 | |
| 449436665 | 274 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.481 | 0.795 | 2e-52 | |
| 391344312 | 277 | PREDICTED: uncharacterized protein LOC10 | 0.965 | 0.498 | 0.741 | 2e-52 | |
| 122045178 | 136 | RecName: Full=Histone H3.2 | 0.930 | 0.977 | 0.789 | 2e-52 | |
| 351722020 | 136 | uncharacterized protein LOC100306416 [Gl | 0.930 | 0.977 | 0.789 | 3e-52 | |
| 224284663 | 136 | unknown [Picea sitchensis] | 0.930 | 0.977 | 0.789 | 3e-52 | |
| 224865 | 135 | histone H3 | 0.930 | 0.985 | 0.789 | 3e-52 | |
| 294999388 | 136 | histone H3 [Oryza sativa Indica Group] | 0.916 | 0.963 | 0.764 | 3e-52 |
| >gi|163914165|dbj|BAF95851.1| histon H3 protein [Vitis hybrid cultivar] | Back alignment and taxonomy information |
|---|
Score = 220 bits (561), Expect = 1e-55, Method: Compositional matrix adjust.
Identities = 112/136 (82%), Positives = 115/136 (84%), Gaps = 1/136 (0%)
Query: 9 LARSRQ-QGSPPEGRHHVSSWPPRQLGNSTSATGGVKKPHCFRPGTVALREIRKYQKSTE 67
+AR+ Q GSP EGR H + S ATGGVKKPH FRPGTVALREIRKYQKSTE
Sbjct: 4 MARTMQLSGSPLEGRLHAKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 63
Query: 68 LLIRKLPFQRLVREIAQDFKTDLWFQSSAVAALQEAAEAYLVGLFEDTNLCTIHTKRVTI 127
LLIRKLPFQRLVREIAQDFKTDL FQSSAVAALQEAAEAYLVGLFEDTNLC IH KRVTI
Sbjct: 64 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI 123
Query: 128 MPKDIQLARRIRGERA 143
MPKDIQLARRIRGERA
Sbjct: 124 MPKDIQLARRIRGERA 139
|
Source: Vitis hybrid cultivar Species: Vitis hybrid cultivar Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15232146|ref|NP_189372.1| histone H3 [Arabidopsis thaliana] gi|15238433|ref|NP_201339.1| histone H3 [Arabidopsis thaliana] gi|18390992|ref|NP_563838.1| histone H3 [Arabidopsis thaliana] gi|18416261|ref|NP_568227.1| histone H3 [Arabidopsis thaliana] gi|18416264|ref|NP_568228.1| histone H3 [Arabidopsis thaliana] gi|115441249|ref|NP_001044904.1| Os01g0866200 [Oryza sativa Japonica Group] gi|115458352|ref|NP_001052776.1| Os04g0419600 [Oryza sativa Japonica Group] gi|115464121|ref|NP_001055660.1| Os05g0438700 [Oryza sativa Japonica Group] gi|115466556|ref|NP_001056877.1| Os06g0160100 [Oryza sativa Japonica Group] gi|115484259|ref|NP_001065791.1| Os11g0155900 [Oryza sativa Japonica Group] gi|212721652|ref|NP_001131276.1| histone H3.2 [Zea mays] gi|297724495|ref|NP_001174611.1| Os06g0159501 [Oryza sativa Japonica Group] gi|297724499|ref|NP_001174613.1| Os06g0160001 [Oryza sativa Japonica Group] gi|224053380|ref|XP_002297791.1| histone H3 [Populus trichocarpa] gi|224057509|ref|XP_002299242.1| histone H3 [Populus trichocarpa] gi|224075758|ref|XP_002304754.1| histone H3 [Populus trichocarpa] gi|224106912|ref|XP_002333603.1| histone H3 [Populus trichocarpa] gi|224161995|ref|XP_002338397.1| histone H3 [Populus trichocarpa] gi|225431587|ref|XP_002282606.1| PREDICTED: histone H3.2 isoform 1 [Vitis vinifera] gi|225435522|ref|XP_002285556.1| PREDICTED: histone H3.2-like [Vitis vinifera] gi|225435526|ref|XP_002285562.1| PREDICTED: histone H3.2-like [Vitis vinifera] gi|225450203|ref|XP_002264961.1| PREDICTED: histone H3.2-like [Vitis vinifera] gi|225460686|ref|XP_002269800.1| PREDICTED: histone H3.2-like [Vitis vinifera] gi|242056349|ref|XP_002457320.1| hypothetical protein SORBIDRAFT_03g005550 [Sorghum bicolor] gi|242061890|ref|XP_002452234.1| hypothetical protein SORBIDRAFT_04g022160 [Sorghum bicolor] gi|242073044|ref|XP_002446458.1| hypothetical protein SORBIDRAFT_06g016330 [Sorghum bicolor] gi|242075820|ref|XP_002447846.1| hypothetical protein SORBIDRAFT_06g016850 [Sorghum bicolor] gi|242090679|ref|XP_002441172.1| hypothetical protein SORBIDRAFT_09g021650 [Sorghum bicolor] gi|242092064|ref|XP_002436522.1| hypothetical protein SORBIDRAFT_10g004110 [Sorghum bicolor] gi|242094758|ref|XP_002437869.1| hypothetical protein SORBIDRAFT_10g004100 [Sorghum bicolor] gi|255562996|ref|XP_002522502.1| histone h3, putative [Ricinus communis] gi|255567299|ref|XP_002524630.1| histone h3, putative [Ricinus communis] gi|255585756|ref|XP_002533558.1| histone h3, putative [Ricinus communis] gi|255585762|ref|XP_002533561.1| histone h3, putative [Ricinus communis] gi|255585766|ref|XP_002533563.1| histone h3, putative [Ricinus communis] gi|255585768|ref|XP_002533564.1| histone h3, putative [Ricinus communis] gi|297811141|ref|XP_002873454.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|297811143|ref|XP_002873455.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|297818324|ref|XP_002877045.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|297849218|ref|XP_002892490.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|297853534|ref|XP_002894648.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|359476951|ref|XP_003631918.1| PREDICTED: histone H3.2 isoform 2 [Vitis vinifera] gi|449448760|ref|XP_004142133.1| PREDICTED: histone H3.2-like [Cucumis sativus] gi|449476030|ref|XP_004154620.1| PREDICTED: histone H3.2-like isoform 1 [Cucumis sativus] gi|449476032|ref|XP_004154621.1| PREDICTED: histone H3.2-like isoform 2 [Cucumis sativus] gi|449489076|ref|XP_004158207.1| PREDICTED: histone H3.2-like [Cucumis sativus] gi|449520805|ref|XP_004167423.1| PREDICTED: histone H3.2-like [Cucumis sativus] gi|449533260|ref|XP_004173594.1| PREDICTED: histone H3.2-like [Cucumis sativus] gi|27805477|sp|P59226.2|H32_ARATH RecName: Full=Histone H3.2; AltName: Full=Histone H3.1 gi|59799552|sp|P69246.2|H32_MAIZE RecName: Full=Histone H3.2 gi|59799553|sp|P69248.2|H32_PETCR RecName: Full=Histone H3.2 gi|62286642|sp|Q71T45.3|H32_EUPES RecName: Full=Histone H3.2 gi|73919911|sp|Q6LBE3.3|H32_ASPOF RecName: Full=Histone H3.2 gi|73919912|sp|Q6LCK1.3|H32_BRANA RecName: Full=Histone H3.2 gi|75138727|sp|Q76MV0.1|H32_TOBAC RecName: Full=Histone H3.2 gi|122248843|sp|Q2RAD9.1|H32_ORYSJ RecName: Full=Histone H3.2 gi|158512928|sp|A2Y533.1|H32_ORYSI RecName: Full=Histone H3.2 gi|7595794|gb|AAF64452.1|AF239930_1 histone H3 [Euphorbia esula] gi|13926211|gb|AAK49583.1|AF370577_1 histone H3 [Arabidopsis thaliana] gi|20251|emb|CAA31969.1| unnamed protein product [Oryza sativa] gi|20253|emb|CAA31970.1| unnamed protein product [Oryza sativa] gi|168493|gb|AAA33471.1| histone H3 (H3C3) [Zea mays] gi|168495|gb|AAA33472.1| histone H3 [Zea mays] gi|168497|gb|AAA33473.1| histone H3 [Zea mays] gi|168506|gb|AAA66265.1| histone H3 [Zea mays] gi|169655|gb|AAA33852.1| histone H3 [Petroselinum crispum] gi|169657|gb|AAA33853.1| histone H3 [Petroselinum crispum] gi|169659|gb|AAA33854.1| histone H3 [Petroselinum crispum] gi|387565|gb|AAA32808.1| histone H3 [Arabidopsis thaliana] gi|387567|gb|AAA32809.1| histone H3 [Arabidopsis thaliana] gi|886738|emb|CAA59111.1| histone 3 [Zea mays] gi|1040764|gb|AAA79889.1| histone H3 [Arabidopsis thaliana] gi|1314779|gb|AAB67837.1| histone H3 homolog [Brassica napus] gi|1531754|emb|CAA57811.1| Histone H3 [Asparagus officinalis] gi|1667592|gb|AAB18816.1| histone 3 [Oryza sativa Indica Group] gi|3249101|gb|AAC24084.1| Match to histone H3 gene gb|M17131 and gb|M35387 from A. thaliana. ESTs gb|H76511 gb|H76255, gb|AA712452, gb|N65260 and gb|T42306 come from this gene [Arabidopsis thaliana] gi|5295939|dbj|BAA81840.1| histone H3 [Oryza sativa Japonica Group] gi|5295940|dbj|BAA81841.1| histone H3 [Oryza sativa Japonica Group] gi|7671463|emb|CAB89403.1| histone H3-like protein [Arabidopsis thaliana] gi|7671464|emb|CAB89404.1| histone H3-like protein [Arabidopsis thaliana] gi|7939509|dbj|BAA95712.1| histone H3-like protein [Arabidopsis thaliana] gi|9759616|dbj|BAB11558.1| histone H3 [Arabidopsis thaliana] gi|14335142|gb|AAK59851.1| AT3g27360/K1G2_6 [Arabidopsis thaliana] gi|14532560|gb|AAK64008.1| AT5g65360/MNA5_9 [Arabidopsis thaliana] gi|18655353|gb|AAL76132.1| AT3g27360/K1G2_6 [Arabidopsis thaliana] gi|19548061|gb|AAL87394.1| AT5g65360/MNA5_9 [Arabidopsis thaliana] gi|21536571|gb|AAM60903.1| histone H3-like protein [Arabidopsis thaliana] gi|21644654|dbj|BAC01212.1| histone H3 [Oryza sativa Japonica Group] gi|22324934|gb|AAM95675.1| histone H3 [Orobanche cernua var. cumana] gi|26449416|dbj|BAC41835.1| putative histone H3 [Arabidopsis thaliana] gi|27529854|dbj|BAC53942.1| H3 histone [Nicotiana tabacum] gi|27764990|gb|AAO23616.1| At5g10400 [Arabidopsis thaliana] gi|27808628|gb|AAO24594.1| At1g09200 [Arabidopsis thaliana] gi|28973783|gb|AAO64207.1| putative histone H3 [Arabidopsis thaliana] gi|29824185|gb|AAP04053.1| putative histone H3 [Arabidopsis thaliana] gi|32488365|emb|CAE02924.1| OSJNBb0108J11.17 [Oryza sativa Japonica Group] gi|46981297|gb|AAT07615.1| putative histone H3 [Oryza sativa Japonica Group] gi|52075995|dbj|BAD46448.1| histone H3 [Oryza sativa Japonica Group] gi|52076000|dbj|BAD46453.1| histone H3 [Oryza sativa Japonica Group] gi|52076001|dbj|BAD46454.1| histone H3 [Oryza sativa Japonica Group] gi|62701646|gb|AAX92719.1| histone H3 - maize [Oryza sativa Japonica Group] gi|72255621|gb|AAZ66939.1| 117M18_20 [Brassica rapa] gi|108864010|gb|ABA91537.2| Histone H3, putative, expressed [Oryza sativa Japonica Group] gi|110736757|dbj|BAF00340.1| histone H3 like protein [Arabidopsis thaliana] gi|110743434|dbj|BAE99603.1| histone H3 like protein [Arabidopsis thaliana] gi|110743612|dbj|BAE99643.1| histone H3 like protein [Arabidopsis thaliana] gi|113534435|dbj|BAF06818.1| Os01g0866200 [Oryza sativa Japonica Group] gi|113564347|dbj|BAF14690.1| Os04g0419600 [Oryza sativa Japonica Group] gi|113579211|dbj|BAF17574.1| Os05g0438700 [Oryza sativa Japonica Group] gi|113594917|dbj|BAF18791.1| Os06g0160100 [Oryza sativa Japonica Group] gi|113644495|dbj|BAF27636.1| Os11g0155900 [Oryza sativa Japonica Group] gi|116780664|gb|ABK21761.1| unknown [Picea sitchensis] gi|116790074|gb|ABK25492.1| unknown [Picea sitchensis] gi|118481843|gb|ABK92858.1| unknown [Populus trichocarpa] gi|118484038|gb|ABK93905.1| unknown [Populus trichocarpa] gi|118484134|gb|ABK93950.1| unknown [Populus trichocarpa] gi|118488137|gb|ABK95888.1| unknown [Populus trichocarpa] gi|125533457|gb|EAY80005.1| hypothetical protein OsI_35174 [Oryza sativa Indica Group] gi|125552484|gb|EAY98193.1| hypothetical protein OsI_20106 [Oryza sativa Indica Group] gi|125554171|gb|EAY99776.1| hypothetical protein OsI_21763 [Oryza sativa Indica Group] gi|125554174|gb|EAY99779.1| hypothetical protein OsI_21766 [Oryza sativa Indica Group] gi|125572756|gb|EAZ14271.1| hypothetical protein OsJ_04197 [Oryza sativa Japonica Group] gi|125590373|gb|EAZ30723.1| hypothetical protein OsJ_14783 [Oryza sativa Japonica Group] gi|125596123|gb|EAZ35903.1| hypothetical protein OsJ_20204 [Oryza sativa Japonica Group] gi|147809988|emb|CAN73758.1| hypothetical protein VITISV_031197 [Vitis vinifera] gi|147844088|emb|CAN80002.1| hypothetical protein VITISV_043973 [Vitis vinifera] gi|147855133|emb|CAN83843.1| hypothetical protein VITISV_044079 [Vitis vinifera] gi|147862092|emb|CAN80880.1| hypothetical protein VITISV_018649 [Vitis vinifera] gi|147862761|emb|CAN83194.1| hypothetical protein VITISV_010341 [Vitis vinifera] gi|151413349|gb|ABS11143.1| histone H3 [Nicotiana benthamiana] gi|156720295|dbj|BAF76800.1| histone H3.1 [Nicotiana tabacum] gi|192913026|gb|ACF06621.1| histone H3 [Elaeis guineensis] gi|194691056|gb|ACF79612.1| unknown [Zea mays] gi|194696296|gb|ACF82232.1| unknown [Zea mays] gi|194704326|gb|ACF86247.1| unknown [Zea mays] gi|194708694|gb|ACF88431.1| unknown [Zea mays] gi|195606614|gb|ACG25137.1| histone H3 [Zea mays] gi|195611030|gb|ACG27345.1| histone H3 [Zea mays] gi|195616454|gb|ACG30057.1| histone H3 [Zea mays] gi|195617288|gb|ACG30474.1| histone H3 [Zea mays] gi|195617742|gb|ACG30701.1| histone H3 [Zea mays] gi|195617754|gb|ACG30707.1| histone H3 [Zea mays] gi|195617922|gb|ACG30791.1| histone H3 [Zea mays] gi|195618240|gb|ACG30950.1| histone H3 [Zea mays] gi|195620208|gb|ACG31934.1| histone H3 [Zea mays] gi|195634985|gb|ACG36961.1| histone H3 [Zea mays] gi|195640334|gb|ACG39635.1| histone H3 [Zea mays] gi|195641210|gb|ACG40073.1| histone H3 [Zea mays] gi|195643030|gb|ACG40983.1| histone H3 [Zea mays] gi|195655633|gb|ACG47284.1| histone H3 [Zea mays] gi|196166894|gb|ACG70966.1| histone H3 [Ziziphus jujuba] gi|215768014|dbj|BAH00243.1| unnamed protein product [Oryza sativa Japonica Group] gi|218197632|gb|EEC80059.1| hypothetical protein OsI_21765 [Oryza sativa Indica Group] gi|222615540|gb|EEE51672.1| hypothetical protein OsJ_33018 [Oryza sativa Japonica Group] gi|222837547|gb|EEE75912.1| histone H3 [Populus trichocarpa] gi|222842186|gb|EEE79733.1| histone H3 [Populus trichocarpa] gi|222845049|gb|EEE82596.1| histone H3 [Populus trichocarpa] gi|222846500|gb|EEE84047.1| histone H3 [Populus trichocarpa] gi|222872075|gb|EEF09206.1| histone H3 [Populus trichocarpa] gi|223526558|gb|EEF28815.1| histone h3, putative [Ricinus communis] gi|223526561|gb|EEF28818.1| histone h3, putative [Ricinus communis] gi|223526563|gb|EEF28820.1| histone h3, putative [Ricinus communis] gi|223526564|gb|EEF28821.1| histone h3, putative [Ricinus communis] gi|223536099|gb|EEF37755.1| histone h3, putative [Ricinus communis] gi|223538193|gb|EEF39802.1| histone h3, putative [Ricinus communis] gi|224029695|gb|ACN33923.1| unknown [Zea mays] gi|238012294|gb|ACR37182.1| unknown [Zea mays] gi|238012900|gb|ACR37485.1| unknown [Zea mays] gi|238013136|gb|ACR37603.1| unknown [Zea mays] gi|238013902|gb|ACR37986.1| unknown [Zea mays] gi|238014038|gb|ACR38054.1| unknown [Zea mays] gi|241914745|gb|EER87889.1| hypothetical protein SORBIDRAFT_10g004110 [Sorghum bicolor] gi|241916092|gb|EER89236.1| hypothetical protein SORBIDRAFT_10g004100 [Sorghum bicolor] gi|241929295|gb|EES02440.1| hypothetical protein SORBIDRAFT_03g005550 [Sorghum bicolor] gi|241932065|gb|EES05210.1| hypothetical protein SORBIDRAFT_04g022160 [Sorghum bicolor] gi|241937641|gb|EES10786.1| hypothetical protein SORBIDRAFT_06g016330 [Sorghum bicolor] gi|241939029|gb|EES12174.1| hypothetical protein SORBIDRAFT_06g016850 [Sorghum bicolor] gi|241946457|gb|EES19602.1| hypothetical protein SORBIDRAFT_09g021650 [Sorghum bicolor] gi|255676735|dbj|BAH93339.1| Os06g0159501 [Oryza sativa Japonica Group] gi|255676737|dbj|BAH93341.1| Os06g0160001 [Oryza sativa Japonica Group] gi|288812727|gb|ADC54261.1| histone H3 [Oryza sativa Japonica Group] gi|294461191|gb|ADE76159.1| unknown [Picea sitchensis] gi|294461568|gb|ADE76345.1| unknown [Picea sitchensis] gi|294461811|gb|ADE76464.1| unknown [Picea sitchensis] gi|294463779|gb|ADE77414.1| unknown [Picea sitchensis] gi|297319291|gb|EFH49713.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|297319292|gb|EFH49714.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|297322883|gb|EFH53304.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|297338332|gb|EFH68749.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|297340490|gb|EFH70907.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gi|312985287|gb|ADR30794.1| histone H3.1 [Hevea brasiliensis] gi|317106674|dbj|BAJ53177.1| JHL18I08.11 [Jatropha curcas] gi|332004152|gb|AED91535.1| histone H3 [Arabidopsis thaliana] gi|332004153|gb|AED91536.1| histone H3 [Arabidopsis thaliana] gi|332010660|gb|AED98043.1| histone H3 [Arabidopsis thaliana] gi|332190292|gb|AEE28413.1| histone H3 [Arabidopsis thaliana] gi|332643787|gb|AEE77308.1| histone H3 [Arabidopsis thaliana] gi|383100951|emb|CCD74495.1| histone H3 [Arabidopsis halleri subsp. halleri] gi|413918290|gb|AFW58222.1| histone H3.2 isoform 1 [Zea mays] gi|413918291|gb|AFW58223.1| histone H3.2 isoform 2 [Zea mays] gi|413918312|gb|AFW58244.1| histone H3.2 [Zea mays] gi|413922633|gb|AFW62565.1| histone H3.2 [Zea mays] gi|413942945|gb|AFW75594.1| histone H3.2 [Zea mays] gi|413953084|gb|AFW85733.1| histone H3.2 isoform 1 [Zea mays] gi|413953085|gb|AFW85734.1| histone H3.2 isoform 2 [Zea mays] gi|414587293|tpg|DAA37864.1| TPA: histone H3.2 [Zea mays] gi|414876272|tpg|DAA53403.1| TPA: histone H3.2 [Zea mays] gi|225459|prf||1303352A histone H3 gi|225839|prf||1314298B histone H3 | Back alignment and taxonomy information |
|---|
| >gi|414587287|tpg|DAA37858.1| TPA: histone H3.2 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|449436665|ref|XP_004136113.1| PREDICTED: uncharacterized protein LOC101209420 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|391344312|ref|XP_003746445.1| PREDICTED: uncharacterized protein LOC100902368 [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|122045178|sp|P08903.2|H32_ENCAL RecName: Full=Histone H3.2 | Back alignment and taxonomy information |
|---|
| >gi|351722020|ref|NP_001238509.1| uncharacterized protein LOC100306416 [Glycine max] gi|356512809|ref|XP_003525108.1| PREDICTED: histone H3.2-like [Glycine max] gi|356512811|ref|XP_003525109.1| PREDICTED: histone H3.2-like [Glycine max] gi|356521422|ref|XP_003529355.1| PREDICTED: histone H3.2-like [Glycine max] gi|356526362|ref|XP_003531787.1| PREDICTED: histone H3.2-like [Glycine max] gi|356526495|ref|XP_003531853.1| PREDICTED: histone H3.2-like [Glycine max] gi|356538929|ref|XP_003537953.1| PREDICTED: histone H3.2-like [Glycine max] gi|356541888|ref|XP_003539404.1| PREDICTED: histone H3.2-like [Glycine max] gi|356548652|ref|XP_003542714.1| PREDICTED: histone H3.2-like [Glycine max] gi|356556728|ref|XP_003546675.1| PREDICTED: histone H3.2-like [Glycine max] gi|357110762|ref|XP_003557185.1| PREDICTED: histone H3.2-like isoform 1 [Brachypodium distachyon] gi|357110764|ref|XP_003557186.1| PREDICTED: histone H3.2-like isoform 2 [Brachypodium distachyon] gi|357125196|ref|XP_003564281.1| PREDICTED: histone H3.2-like isoform 1 [Brachypodium distachyon] gi|357125198|ref|XP_003564282.1| PREDICTED: histone H3.2-like isoform 2 [Brachypodium distachyon] gi|357125200|ref|XP_003564283.1| PREDICTED: histone H3.2-like isoform 3 [Brachypodium distachyon] gi|357125202|ref|XP_003564284.1| PREDICTED: histone H3.2-like isoform 4 [Brachypodium distachyon] gi|357132777|ref|XP_003568005.1| PREDICTED: histone H3.2-like isoform 1 [Brachypodium distachyon] gi|357132779|ref|XP_003568006.1| PREDICTED: histone H3.2-like isoform 2 [Brachypodium distachyon] gi|357132781|ref|XP_003568007.1| PREDICTED: histone H3.2-like isoform 3 [Brachypodium distachyon] gi|357132783|ref|XP_003568008.1| PREDICTED: histone H3.2-like isoform 4 [Brachypodium distachyon] gi|357133509|ref|XP_003568367.1| PREDICTED: histone H3.2-like isoform 1 [Brachypodium distachyon] gi|357133511|ref|XP_003568368.1| PREDICTED: histone H3.2-like isoform 2 [Brachypodium distachyon] gi|357133513|ref|XP_003568369.1| PREDICTED: histone H3.2-like isoform 3 [Brachypodium distachyon] gi|357133987|ref|XP_003568601.1| PREDICTED: histone H3.2-like isoform 1 [Brachypodium distachyon] gi|357133989|ref|XP_003568602.1| PREDICTED: histone H3.2-like isoform 2 [Brachypodium distachyon] gi|357149385|ref|XP_003575094.1| PREDICTED: histone H3.2-like isoform 1 [Brachypodium distachyon] gi|357149388|ref|XP_003575095.1| PREDICTED: histone H3.2-like isoform 2 [Brachypodium distachyon] gi|357149391|ref|XP_003575096.1| PREDICTED: histone H3.2-like isoform 3 [Brachypodium distachyon] gi|357149393|ref|XP_003575097.1| PREDICTED: histone H3.2-like isoform 4 [Brachypodium distachyon] gi|357149396|ref|XP_003575098.1| PREDICTED: histone H3.2-like isoform 5 [Brachypodium distachyon] gi|357149399|ref|XP_003575099.1| PREDICTED: histone H3.2-like isoform 6 [Brachypodium distachyon] gi|357153574|ref|XP_003576496.1| PREDICTED: histone H3.2-like isoform 1 [Brachypodium distachyon] gi|357153577|ref|XP_003576497.1| PREDICTED: histone H3.2-like isoform 2 [Brachypodium distachyon] gi|357153580|ref|XP_003576498.1| PREDICTED: histone H3.2-like isoform 3 [Brachypodium distachyon] gi|357153582|ref|XP_003576499.1| PREDICTED: histone H3.2-like isoform 4 [Brachypodium distachyon] gi|357153585|ref|XP_003576500.1| PREDICTED: histone H3.2-like isoform 5 [Brachypodium distachyon] gi|357153588|ref|XP_003576501.1| PREDICTED: histone H3.2-like isoform 6 [Brachypodium distachyon] gi|357444381|ref|XP_003592468.1| Histone H3 [Medicago truncatula] gi|357485137|ref|XP_003612856.1| Histone H3 [Medicago truncatula] gi|357505385|ref|XP_003622981.1| Histone H3 [Medicago truncatula] gi|357516805|ref|XP_003628691.1| Histone H3 [Medicago truncatula] gi|357519793|ref|XP_003630185.1| Histone H3 [Medicago truncatula] gi|449446215|ref|XP_004140867.1| PREDICTED: histone H3.2-like [Cucumis sativus] gi|449499418|ref|XP_004160811.1| PREDICTED: histone H3.2-like [Cucumis sativus] gi|55977041|sp|P68427.2|H32_PEA RecName: Full=Histone H3.2 gi|55977043|sp|P68428.2|H32_WHEAT RecName: Full=Histone H3.2 gi|55977044|sp|P68429.2|H32_MEDSA RecName: Full=Histone H3.2; AltName: Full=Histone H3.1; AltName: Full=Major histone H3 gi|55977045|sp|P68430.2|H32_ONOVI RecName: Full=Histone H3.2 gi|19607|emb|CAA31964.1| unnamed protein product [Medicago sativa] gi|19609|emb|CAA31965.1| unnamed protein product [Medicago sativa] gi|21797|emb|CAA25451.1| unnamed protein product [Triticum aestivum] gi|488565|gb|AAB49545.1| histone H3.1 [Medicago sativa] gi|2565419|gb|AAB81995.1| histone H3 [Onobrychis viciifolia] gi|195605922|gb|ACG24791.1| histone H3 [Zea mays] gi|195611126|gb|ACG27393.1| histone H3 [Zea mays] gi|195622802|gb|ACG33231.1| histone H3 [Zea mays] gi|217075590|gb|ACJ86155.1| unknown [Medicago truncatula] gi|255628465|gb|ACU14577.1| unknown [Glycine max] gi|270315170|gb|ACZ74621.1| histone H3-like protein [Wolffia arrhiza] gi|294462026|gb|ADE76568.1| unknown [Picea sitchensis] gi|294462216|gb|ADE76659.1| unknown [Picea sitchensis] gi|326487552|dbj|BAK05448.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326493316|dbj|BAJ85119.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326495746|dbj|BAJ85969.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326516088|dbj|BAJ88067.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326527407|dbj|BAK07978.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326529361|dbj|BAK01074.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326529719|dbj|BAK04806.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|355481516|gb|AES62719.1| Histone H3 [Medicago truncatula] gi|355497996|gb|AES79199.1| Histone H3 [Medicago truncatula] gi|355514191|gb|AES95814.1| Histone H3 [Medicago truncatula] gi|355522713|gb|AET03167.1| Histone H3 [Medicago truncatula] gi|355524207|gb|AET04661.1| Histone H3 [Medicago truncatula] gi|388505574|gb|AFK40853.1| unknown [Medicago truncatula] gi|388506042|gb|AFK41087.1| unknown [Medicago truncatula] gi|388508840|gb|AFK42486.1| unknown [Medicago truncatula] gi|388509052|gb|AFK42592.1| unknown [Lotus japonicus] gi|388510014|gb|AFK43073.1| unknown [Medicago truncatula] gi|388517949|gb|AFK47036.1| unknown [Medicago truncatula] gi|413937164|gb|AFW71715.1| histone H3 [Zea mays] gi|413951815|gb|AFW84464.1| putative vesicle-associated membrane protein family protein [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|224284663|gb|ACN40064.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|224865|prf||1202289A histone H3 | Back alignment and taxonomy information |
|---|
| >gi|294999388|gb|ADF58429.1| histone H3 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 143 | ||||||
| TAIR|locus:2195341 | 136 | H3.1 "histone 3.1" [Arabidopsi | 0.930 | 0.977 | 0.673 | 6.8e-40 | |
| TAIR|locus:2086696 | 136 | H3.1 "histone 3.1" [Arabidopsi | 0.930 | 0.977 | 0.673 | 6.8e-40 | |
| TAIR|locus:2142439 | 136 | H3.1 "histone 3.1" [Arabidopsi | 0.930 | 0.977 | 0.673 | 6.8e-40 | |
| TAIR|locus:2142424 | 136 | H3.1 "histone 3.1" [Arabidopsi | 0.930 | 0.977 | 0.673 | 6.8e-40 | |
| TAIR|locus:2168277 | 136 | H3.1 "histone 3.1" [Arabidopsi | 0.930 | 0.977 | 0.673 | 6.8e-40 | |
| UNIPROTKB|E1BGN3 | 136 | LOC788077 "Histone H3" [Bos ta | 0.944 | 0.992 | 0.657 | 2.3e-39 | |
| FB|FBgn0051613 | 136 | His3:CG31613 "His3:CG31613" [D | 0.930 | 0.977 | 0.659 | 3.7e-39 | |
| FB|FBgn0053803 | 136 | His3:CG33803 "His3:CG33803" [D | 0.930 | 0.977 | 0.659 | 3.7e-39 | |
| FB|FBgn0053806 | 136 | His3:CG33806 "His3:CG33806" [D | 0.930 | 0.977 | 0.659 | 3.7e-39 | |
| FB|FBgn0053809 | 136 | His3:CG33809 "His3:CG33809" [D | 0.930 | 0.977 | 0.659 | 3.7e-39 |
| TAIR|locus:2195341 H3.1 "histone 3.1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 425 (154.7 bits), Expect = 6.8e-40, P = 6.8e-40
Identities = 93/138 (67%), Positives = 97/138 (70%)
Query: 6 TKWLARSRQQGSPPEGRHHVSSWPPRQLGNSTSATGGVKKPHCFRPGTVALREIRKYQKS 65
TK AR G P R +++ R+ S ATGGVKKPH FRPGTVALREIRKYQKS
Sbjct: 4 TKQTARKSTGGKAP--RKQLATKAARK---SAPATGGVKKPHRFRPGTVALREIRKYQKS 58
Query: 66 TELLIRKLPFQRLVREIAQDFKTDLWFXXXXXXXXXXXXXXXXXGLFEDTNLCTIHTKRV 125
TELLIRKLPFQRLVREIAQDFKTDL F GLFEDTNLC IH KRV
Sbjct: 59 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRV 118
Query: 126 TIMPKDIQLARRIRGERA 143
TIMPKDIQLARRIRGERA
Sbjct: 119 TIMPKDIQLARRIRGERA 136
|
|
| TAIR|locus:2086696 H3.1 "histone 3.1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2142439 H3.1 "histone 3.1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2142424 H3.1 "histone 3.1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168277 H3.1 "histone 3.1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BGN3 LOC788077 "Histone H3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0051613 His3:CG31613 "His3:CG31613" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053803 His3:CG33803 "His3:CG33803" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053806 His3:CG33806 "His3:CG33806" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053809 His3:CG33809 "His3:CG33809" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 143 | |||
| PTZ00018 | 136 | PTZ00018, PTZ00018, histone H3; Provisional | 1e-69 | |
| PLN00121 | 136 | PLN00121, PLN00121, histone H3; Provisional | 3e-61 | |
| smart00428 | 105 | smart00428, H3, Histone H3 | 3e-59 | |
| PLN00161 | 135 | PLN00161, PLN00161, histone H3; Provisional | 1e-41 | |
| PLN00160 | 97 | PLN00160, PLN00160, histone H3; Provisional | 3e-38 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 1e-32 | |
| COG2036 | 91 | COG2036, HHT1, Histones H3 and H4 [Chromatin struc | 8e-32 |
| >gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional | Back alignment and domain information |
|---|
Score = 205 bits (524), Expect = 1e-69
Identities = 105/138 (76%), Positives = 112/138 (81%), Gaps = 5/138 (3%)
Query: 6 TKWLARSRQQGSPPEGRHHVSSWPPRQLGNSTSATGGVKKPHCFRPGTVALREIRKYQKS 65
TK AR G P R ++S R+ S TGG+KKPH +RPGTVALREIR+YQKS
Sbjct: 4 TKQTARKSTGGKAP--RKQLASKAARK---SAPVTGGIKKPHRYRPGTVALREIRRYQKS 58
Query: 66 TELLIRKLPFQRLVREIAQDFKTDLWFQSSAVAALQEAAEAYLVGLFEDTNLCTIHTKRV 125
TELLIRKLPFQRLVREIAQDFKTDL FQSSAV ALQEAAEAYLVGLFEDTNLC IH KRV
Sbjct: 59 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRV 118
Query: 126 TIMPKDIQLARRIRGERA 143
TIMPKDIQLARRIRGER+
Sbjct: 119 TIMPKDIQLARRIRGERS 136
|
Length = 136 |
| >gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|128705 smart00428, H3, Histone H3 | Back alignment and domain information |
|---|
| >gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 143 | |||
| PLN00161 | 135 | histone H3; Provisional | 100.0 | |
| PTZ00018 | 136 | histone H3; Provisional | 100.0 | |
| PLN00121 | 136 | histone H3; Provisional | 100.0 | |
| KOG1745 | 137 | consensus Histones H3 and H4 [Chromatin structure | 100.0 | |
| smart00428 | 105 | H3 Histone H3. | 100.0 | |
| PLN00160 | 97 | histone H3; Provisional | 100.0 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 99.92 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.84 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 99.24 | |
| PLN00158 | 116 | histone H2B; Provisional | 98.74 | |
| PTZ00463 | 117 | histone H2B; Provisional | 98.72 | |
| smart00427 | 89 | H2B Histone H2B. | 98.7 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 98.53 | |
| PLN00035 | 103 | histone H4; Provisional | 98.42 | |
| KOG1744 | 127 | consensus Histone H2B [Chromatin structure and dyn | 98.39 | |
| PTZ00015 | 102 | histone H4; Provisional | 98.39 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 98.39 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 98.31 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 98.28 | |
| smart00417 | 74 | H4 Histone H4. | 98.01 | |
| PF15630 | 76 | CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C | 97.91 | |
| PF03847 | 68 | TFIID_20kDa: Transcription initiation factor TFIID | 97.69 | |
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 97.56 | |
| PF02291 | 129 | TFIID-31kDa: Transcription initiation factor IID, | 97.51 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 97.51 | |
| KOG0870 | 172 | consensus DNA polymerase epsilon, subunit D [Trans | 97.46 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 97.33 | |
| PF15511 | 414 | CENP-T: Centromere kinetochore component CENP-T; P | 97.2 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 97.03 | |
| KOG1142 | 258 | consensus Transcription initiation factor TFIID, s | 96.8 | |
| KOG3334 | 148 | consensus Transcription initiation factor TFIID, s | 95.5 | |
| PF07524 | 77 | Bromo_TP: Bromodomain associated; InterPro: IPR006 | 94.88 | |
| PF02269 | 93 | TFIID-18kDa: Transcription initiation factor IID, | 88.23 | |
| COG5262 | 132 | HTA1 Histone H2A [Chromatin structure and dynamics | 87.8 | |
| KOG3467 | 103 | consensus Histone H4 [Chromatin structure and dyna | 86.19 | |
| KOG0869 | 168 | consensus CCAAT-binding factor, subunit A (HAP3) [ | 85.14 | |
| KOG0871 | 156 | consensus Class 2 transcription repressor NC2, bet | 83.05 | |
| smart00414 | 106 | H2A Histone 2A. | 81.94 | |
| KOG2549 | 576 | consensus Transcription initiation factor TFIID, s | 81.71 | |
| COG5094 | 145 | TAF9 Transcription initiation factor TFIID, subuni | 81.44 | |
| PLN00154 | 136 | histone H2A; Provisional | 80.57 | |
| cd08045 | 212 | TAF4 TATA Binding Protein (TBP) Associated Factor | 80.08 |
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.5e-58 Score=348.35 Aligned_cols=128 Identities=59% Similarity=0.846 Sum_probs=119.7
Q ss_pred hhccccCCCCCCCCCCCCCCCCCcCCCCCCCCCCCCCcccCCCCchhhHHHHhhhhhhhhhhccCccchhHHHHHHhhh-
Q 048501 9 LARSRQQGSPPEGRHHVSSWPPRQLGNSTSATGGVKKPHCFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFK- 87 (143)
Q Consensus 9 MartK~ta~k~~~~~~~~kaprk~~~ks~p~~~~~k~~~r~rpgt~alrEIr~yQkst~llI~k~pF~RLVrEI~~~~~- 87 (143)
||||||+ +++++ ||.|+|++... ...+++++++||+||++||+|||+||+||+|||||+||+||||||++++.
T Consensus 1 mar~k~~-~~~~~----~~~~~~~~~~~-~~~~~~kk~~r~rpGtvaLrEIR~yQkst~lLIpklPF~RLVREI~~~~~~ 74 (135)
T PLN00161 1 MARRLQG-KRFRK----GKKPQKEASGV-TRQELDKKPHRYRPGTVALREIRKYQKSTELLIRKLPFARLVREISNEMLR 74 (135)
T ss_pred CCccccc-ccccC----CCCCcccCCCC-CCCCCCCCCccCCCcchHHHHHHHHccccccccccccHHHHHHHHHHhcCC
Confidence 9999999 67777 88899888643 45577899999999999999999999999999999999999999999996
Q ss_pred ccccchHHHHHHHHHHHHHHHHHHhhhhhhhhhccCccccCcccHHHHHHHhccC
Q 048501 88 TDLWFQSSAVAALQEAAEAYLVGLFEDTNLCTIHTKRVTIMPKDIQLARRIRGER 142 (143)
Q Consensus 88 ~~~rfq~~Al~aLQeaaEa~Lv~lfeda~l~a~HakRvTi~~kDiqLa~rirg~~ 142 (143)
+++|||++||+|||||+|+|||+||||+|+||+||||||||++||+||.+|||+.
T Consensus 75 ~~~Rfq~~Al~ALQEAsEayLV~lFeda~lcaiHAkRVTlm~kDm~La~rirg~~ 129 (135)
T PLN00161 75 EPFRWTAEALLALQEATEDFLVHLFEDCNLCAIHAKRVTIMPKDMQLARRIRGPI 129 (135)
T ss_pred CCcEeeHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccchhhHHHHHHhcccc
Confidence 5899999999999999999999999999999999999999999999999999975
|
|
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >KOG1744 consensus Histone H2B [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C | Back alignment and domain information |
|---|
| >PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
| >KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG3334 consensus Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) | Back alignment and domain information |
|---|
| >PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) | Back alignment and domain information |
|---|
| >COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG3467 consensus Histone H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] | Back alignment and domain information |
|---|
| >KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >COG5094 TAF9 Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PLN00154 histone H2A; Provisional | Back alignment and domain information |
|---|
| >cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 143 | ||||
| 3av1_A | 139 | The Human Nucleosome Structure Containing The Histo | 5e-44 | ||
| 2io5_B | 135 | Crystal Structure Of The Cia- Histone H3-H4 Complex | 7e-44 | ||
| 2hio_C | 136 | Histone Octamer (Chicken), Chromosomal Protein Leng | 8e-44 | ||
| 3afa_A | 139 | The Human Nucleosome Structure Length = 139 | 1e-43 | ||
| 2cv5_A | 136 | Crystal Structure Of Human Nucleosome Core Particle | 1e-43 | ||
| 3lel_A | 136 | Structural Insight Into The Sequence-Dependence Of | 2e-43 | ||
| 3av2_A | 139 | The Human Nucleosome Structure Containing The Histo | 2e-43 | ||
| 1kx3_A | 135 | X-Ray Structure Of The Nucleosome Core Particle, Nc | 3e-43 | ||
| 4hga_B | 136 | Structure Of The Variant Histone H3.3-H4 Heterodime | 3e-43 | ||
| 3azh_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 3e-43 | ||
| 3azg_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 3e-43 | ||
| 3azf_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 3e-43 | ||
| 3aze_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 3e-43 | ||
| 3ayw_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 3e-43 | ||
| 3a6n_A | 139 | The Nucleosome Containing A Testis-Specific Histone | 5e-43 | ||
| 3kxb_A | 135 | Structural Characterization Of H3k56q Nucleosomes A | 7e-43 | ||
| 1f66_A | 136 | 2.6 A Crystal Structure Of A Nucleosome Core Partic | 2e-42 | ||
| 1aoi_A | 116 | Complex Between Nucleosome Core Particle (H3,H4,H2a | 2e-42 | ||
| 1zla_A | 135 | X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L | 2e-42 | ||
| 4h9o_A | 135 | Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length | 2e-42 | ||
| 4h9n_A | 135 | Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 | 3e-42 | ||
| 1m18_A | 135 | Ligand Binding Alters The Structure And Dynamics Of | 5e-42 | ||
| 3c1c_A | 135 | The Effect Of H3 K79 Dimethylation And H4 K20 Trime | 7e-42 | ||
| 1p3b_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 1e-41 | ||
| 4h9p_A | 135 | Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length | 2e-41 | ||
| 1p3k_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 3e-41 | ||
| 1p3m_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 5e-41 | ||
| 1p34_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 5e-41 | ||
| 1p3a_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 7e-41 | ||
| 1p3l_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 9e-41 | ||
| 4h9s_A | 135 | Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 | 4e-40 | ||
| 1id3_A | 135 | Crystal Structure Of The Yeast Nucleosome Core Part | 1e-37 | ||
| 3kwq_A | 98 | Structural Characterization Of H3k56q Nucleosomes A | 3e-37 | ||
| 1hio_C | 93 | Histone Octamer (Chicken), Chromosomal Protein, Alp | 1e-35 | ||
| 2hue_B | 77 | Structure Of The H3-h4 Chaperone Asf1 Bound To Hist | 2e-25 | ||
| 4eo5_B | 76 | Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 | 2e-25 | ||
| 2yfv_A | 100 | The Heterotrimeric Complex Of Kluyveromyces Lactis | 5e-18 | ||
| 2yfw_A | 92 | Heterotetramer Structure Of Kluyveromyces Lactis Cs | 2e-17 | ||
| 3an2_A | 143 | The Structure Of The Centromeric Nucleosome Contain | 3e-16 | ||
| 3r45_A | 156 | Structure Of A Cenp-A-Histone H4 Heterodimer In Com | 3e-16 | ||
| 3nqu_A | 140 | Crystal Structure Of Partially Trypsinized (Cenp-AH | 4e-16 | ||
| 2l5a_A | 235 | Structural Basis For Recognition Of Centromere Spec | 5e-13 | ||
| 3nqj_A | 82 | Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Len | 3e-11 |
| >pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 | Back alignment and structure |
|
| >pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 | Back alignment and structure |
| >pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 | Back alignment and structure |
| >pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 | Back alignment and structure |
| >pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 | Back alignment and structure |
| >pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 | Back alignment and structure |
| >pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 | Back alignment and structure |
| >pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 | Back alignment and structure |
| >pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 | Back alignment and structure |
| >pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 | Back alignment and structure |
| >pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 | Back alignment and structure |
| >pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 | Back alignment and structure |
| >pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 | Back alignment and structure |
| >pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 | Back alignment and structure |
| >pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 | Back alignment and structure |
| >pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 | Back alignment and structure |
| >pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 | Back alignment and structure |
| >pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 | Back alignment and structure |
| >pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 | Back alignment and structure |
| >pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 | Back alignment and structure |
| >pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 | Back alignment and structure |
| >pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 | Back alignment and structure |
| >pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 | Back alignment and structure |
| >pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 | Back alignment and structure |
| >pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 | Back alignment and structure |
| >pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 | Back alignment and structure |
| >pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 | Back alignment and structure |
| >pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 | Back alignment and structure |
| >pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 | Back alignment and structure |
| >pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 | Back alignment and structure |
| >pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 | Back alignment and structure |
| >pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific Histone H3 Variant By Nonhistone Scm3 Length = 235 | Back alignment and structure |
| >pdb|3NQJ|A Chain A, Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Length = 82 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 143 | |||
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 2e-42 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 5e-39 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 4e-38 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 3e-34 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 8e-34 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 3e-31 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 2e-29 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 4e-04 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 5e-04 |
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 | Back alignment and structure |
|---|
Score = 134 bits (338), Expect = 2e-42
Identities = 69/76 (90%), Positives = 70/76 (92%)
Query: 68 LLIRKLPFQRLVREIAQDFKTDLWFQSSAVAALQEAAEAYLVGLFEDTNLCTIHTKRVTI 127
LIRKLPFQRLVREIAQDFKTDL FQSSAV ALQEA+EAYLV LFEDTNLC IH KRVTI
Sbjct: 2 ALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTI 61
Query: 128 MPKDIQLARRIRGERA 143
MPKDIQLARRIRGERA
Sbjct: 62 MPKDIQLARRIRGERA 77
|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Length = 70 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Length = 68 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 143 | |||
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 100.0 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 100.0 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 100.0 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 100.0 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 100.0 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 100.0 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 100.0 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 99.95 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 99.81 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 99.65 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 99.51 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 99.09 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 99.09 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 98.73 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 98.72 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 98.68 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 98.6 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 98.58 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 98.57 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 98.55 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 98.54 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 98.51 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 98.42 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 98.41 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 98.34 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 98.32 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 98.28 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 98.27 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 98.25 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 98.11 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 98.07 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 98.05 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 98.0 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 97.52 | |
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 97.47 | |
| 2x4w_B | 26 | Histone H3.2; transcription, metal-binding, zinc-f | 97.27 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 97.17 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 97.08 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 97.03 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 97.01 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 96.96 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 96.83 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 96.82 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 96.79 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 96.64 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 90.45 |
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
Probab=100.00 E-value=4.4e-62 Score=370.36 Aligned_cols=131 Identities=80% Similarity=1.156 Sum_probs=93.7
Q ss_pred hhccccCCCCCCCCCCCCCCCCCcCC-----CCCCCCCCCCCcccCCCCchhhHHHHhhhhhhhhhhccCccchhHHHHH
Q 048501 9 LARSRQQGSPPEGRHHVSSWPPRQLG-----NSTSATGGVKKPHCFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIA 83 (143)
Q Consensus 9 MartK~ta~k~~~~~~~~kaprk~~~-----ks~p~~~~~k~~~r~rpgt~alrEIr~yQkst~llI~k~pF~RLVrEI~ 83 (143)
||||||||++++| ||+|+|+++ |++|+++++++|+||+||+++|+|||+||+||+|||||+||+||||||+
T Consensus 1 MARtk~tarkstg----gkaprk~l~~k~a~k~~p~~~~~kk~~r~rpgt~alrEIr~yQkst~lLIpk~PF~RLVREI~ 76 (136)
T 1tzy_C 1 MARTKQTARKSTG----GKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIA 76 (136)
T ss_dssp ---------------------------------------------CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHH
T ss_pred CCCCccccccCCC----CCCCCccccccccccCCCCCCCCCCCCCCCCchhHHHHHHHhhcchhhhhccchHHHHHHHHH
Confidence 9999999999999 999999987 6678888999999999999999999999999999999999999999999
Q ss_pred HhhhccccchHHHHHHHHHHHHHHHHHHhhhhhhhhhccCccccCcccHHHHHHHhccCC
Q 048501 84 QDFKTDLWFQSSAVAALQEAAEAYLVGLFEDTNLCTIHTKRVTIMPKDIQLARRIRGERA 143 (143)
Q Consensus 84 ~~~~~~~rfq~~Al~aLQeaaEa~Lv~lfeda~l~a~HakRvTi~~kDiqLa~rirg~~~ 143 (143)
++|.+|+|||++||+|||||+|+|||+||||+|+||+||||||||++|||||++|||+++
T Consensus 77 ~~~~~~~R~q~~Al~aLQeaaEayLv~Lfeda~l~A~HAkRvTi~~kDiqLa~rirg~~~ 136 (136)
T 1tzy_C 77 QDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 (136)
T ss_dssp HHHCTTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHHHTCCC
T ss_pred HHhhhhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccCcHHhHHHHHHHhCcCC
Confidence 999999999999999999999999999999999999999999999999999999999864
|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 143 | ||||
| d1tzyc_ | 95 | a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), | 4e-58 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 4e-10 | |
| d1ku5a_ | 66 | a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc | 1e-05 | |
| d1htaa_ | 68 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth | 5e-05 | |
| d1n1ja_ | 87 | a.22.1.3 (A:) Nuclear transcription factor Y subun | 8e-05 | |
| d1n1jb_ | 78 | a.22.1.3 (B:) Nuclear transcription factor Y subun | 2e-04 | |
| d1q9ca_ | 172 | a.22.1.3 (A:) Histone domain of Son of sevenless p | 4e-04 | |
| d1jfib_ | 135 | a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain | 0.003 |
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H3 species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Score = 173 bits (440), Expect = 4e-58
Identities = 88/95 (92%), Positives = 91/95 (95%)
Query: 49 FRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLWFQSSAVAALQEAAEAYL 108
+RPGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDL FQSSAV ALQEA+EAYL
Sbjct: 1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 60
Query: 109 VGLFEDTNLCTIHTKRVTIMPKDIQLARRIRGERA 143
VGLFEDTNLC IH KRVTIMPKDIQLARRIRGERA
Sbjct: 61 VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 95
|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 143 | |||
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 100.0 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.16 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 98.98 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 98.93 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 98.8 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 98.38 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 98.22 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 98.16 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 98.0 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 97.97 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 97.96 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 97.77 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 97.68 | |
| d1tafa_ | 68 | TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta | 97.49 | |
| d1tafb_ | 70 | TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta | 97.33 | |
| d1h3ob_ | 74 | TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom | 97.22 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 94.01 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 93.61 | |
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 93.33 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 91.63 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 88.38 |
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H3 species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00 E-value=1.4e-50 Score=289.48 Aligned_cols=95 Identities=93% Similarity=1.313 Sum_probs=93.7
Q ss_pred CCCCchhhHHHHhhhhhhhhhhccCccchhHHHHHHhhhccccchHHHHHHHHHHHHHHHHHHhhhhhhhhhccCccccC
Q 048501 49 FRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLWFQSSAVAALQEAAEAYLVGLFEDTNLCTIHTKRVTIM 128 (143)
Q Consensus 49 ~rpgt~alrEIr~yQkst~llI~k~pF~RLVrEI~~~~~~~~rfq~~Al~aLQeaaEa~Lv~lfeda~l~a~HakRvTi~ 128 (143)
||||++||+|||+||+||++||||+||+||||||++++++++|||++||+|||||+|+|||+||||||+||+|+||||||
T Consensus 1 ~rpGt~ALrEIRk~Qkst~lLIpk~pF~RLVRei~~~~~~~~r~~~~Al~aLQea~E~yLv~lfeda~~~a~HakRvTl~ 80 (95)
T d1tzyc_ 1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 80 (95)
T ss_dssp CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHCTTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEEC
T ss_pred CCCchHHHHHHHHHhCCcccccccccHHHHHHHHHHhcCCCCEeeHHHHHHHHHHHHHHHHHHHHHhHHHHHhcCCCcCC
Confidence 79999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccHHHHHHHhccCC
Q 048501 129 PKDIQLARRIRGERA 143 (143)
Q Consensus 129 ~kDiqLa~rirg~~~ 143 (143)
++||+||++|||+++
T Consensus 81 ~kD~~LarrirG~r~ 95 (95)
T d1tzyc_ 81 PKDIQLARRIRGERA 95 (95)
T ss_dssp HHHHHHHHHHHTCCC
T ss_pred HHHHHHHHHHhccCC
Confidence 999999999999975
|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|