Citrus Sinensis ID: 048633

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
KICNMHIFTCQKLDANQDLRRKKIKDLLGYAEEHCRAESNIVKDLFDARNNTTSITTKWAMAELLHNPEALSKATSRDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLYPL
ccccccccccHHHHHHHHcccccccccccccHHHHHccccEEcccEEcccccEEEEEEccHHHHccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHccccccccccccccccccccEEEcccEcccccEEEEHHHHHHHHHccHHHHHHHccccccccccHHHcccHHHccccccEccccEEEEcccccccccccHHHHHHHcccc
KICNMHIFTCQKLDANQDLRRKKIKDLLGYAEEHCRAESNIVKDLFDARNNTTSITTKWAMAELlhnpealskatsrdestrdhahsfmpkrflgsevdfigrnfesipfgagrricpdlplditmlypl
kicnmhiftcqkldanqdlRRKKIKDLLGYAEEHCRAESNIVKDLFDARNNTTSITTKWAMAELLHNPEALskatsrdestrdhahsfmpkrflgsevdFIGRNFEsipfgagrricpdlplditmlypl
KICNMHIFTCQKLDANQDLRRKKIKDLLGYAEEHCRAESNIVKDLFDARNNTTSITTKWAMAELLHNPEALSKATSRDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLYPL
**CNMHIFTCQKLDANQDLRRKKIKDLLGYAEEHCRAESNIVKDLFDARNNTTSITTKWAMAELL*************************KRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLY**
*ICNMHIFTCQKLDANQDLRRKKIKDLLGYAEEHCRAESNIVKDLFDARNNTTSITTKWAMAELLHNPEALSKATSRDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLYPL
KICNMHIFTCQKLDANQDLRRKKIKDLLGYAEEHCRAESNIVKDLFDARNNTTSITTKWAMAELLHNPEAL**************HSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLYPL
KICNMHIFTCQKLDANQDLRRKKIKDLLGYAEEHCRAESNIVKDLFDARNNTTSITTKWAMAELLHNPEALSKATSRDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLYP*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KICNMHIFTCQKLDANQDLRRKKIKDLLGYAEEHCRAESNIVKDLFDARNNTTSITTKWAMAELLHNPEALSKATSRDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLYPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q8VWZ7493 Geraniol 8-hydroxylase OS N/A no 0.361 0.095 0.607 4e-12
D1MI46495 Geraniol 8-hydroxylase OS N/A no 0.384 0.101 0.555 4e-11
Q9FXW4488 Probable (S)-N-methylcocl N/A no 0.376 0.100 0.591 5e-11
O64636512 Cytochrome P450 76C1 OS=A yes no 0.376 0.095 0.551 3e-10
O64637512 Cytochrome P450 76C2 OS=A no no 0.346 0.087 0.509 4e-10
C0SJS2473 Psoralen synthase (Fragme N/A no 0.515 0.141 0.370 5e-10
O64635511 Cytochrome P450 76C4 OS=A no no 0.576 0.146 0.348 6e-10
P93531500 Cytochrome P450 71D7 OS=S N/A no 0.415 0.108 0.490 6e-10
Q94FM7504 5-epiaristolochene 1,3-di N/A no 0.415 0.107 0.509 9e-10
E3W9C4513 Alpha-humulene 10-hydroxy N/A no 0.476 0.120 0.537 1e-09
>sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 Back     alignment and function desciption
 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 38/51 (74%)

Query: 74  ATSRDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDI 124
           A  RDE+  D A +F P+RF+ SE+D  GR+FE IPFGAGRRICP LPL +
Sbjct: 393 AIGRDETVWDDALAFKPERFMESELDIRGRDFELIPFGAGRRICPGLPLAL 443
Hydroxylase involved in the biosynthesis of hydroxygeraniol, a precursor of the terpenoid indole alkaloids such as vinblastine and vincristine. Also able to hydroxylate in vitro nerol and to catalyze 3'-hydroxylation of the flavanone naringenin to form eriodictyol. No activity with apigenin, kaempferol, p-coumaric acid and ferulic acid as substrates.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 5EC: 2
>sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 Back     alignment and function description
>sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 Back     alignment and function description
>sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 Back     alignment and function description
>sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 Back     alignment and function description
>sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 Back     alignment and function description
>sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 Back     alignment and function description
>sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 Back     alignment and function description
>sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 Back     alignment and function description
>sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
297742641 373 unnamed protein product [Vitis vinifera] 0.684 0.238 0.486 5e-20
296083378 895 unnamed protein product [Vitis vinifera] 0.684 0.099 0.408 4e-15
147846593 473 hypothetical protein VITISV_036425 [Viti 0.684 0.188 0.338 3e-12
147846594 442 hypothetical protein VITISV_036426 [Viti 0.684 0.201 0.409 3e-12
224058639 493 cytochrome P450 [Populus trichocarpa] gi 0.423 0.111 0.618 6e-12
225426693 499 PREDICTED: cytochrome P450 76C4 [Vitis v 0.607 0.158 0.408 9e-12
7406712 499 putative ripening-related P-450 enzyme [ 0.607 0.158 0.408 9e-12
125581075 475 hypothetical protein OsJ_05662 [Oryza sa 0.615 0.168 0.360 2e-11
359474049 399 PREDICTED: cytochrome P450 76C4-like [Vi 0.353 0.115 0.581 3e-11
297741999 442 unnamed protein product [Vitis vinifera] 0.523 0.153 0.426 4e-11
>gi|297742641|emb|CBI34790.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 69/109 (63%), Gaps = 20/109 (18%)

Query: 40  NIVKDLFDARNNTTSITTKWAMAELLHNPEALSKA--------------------TSRDE 79
           +++ DLF A  +TTS T +WAMAELLHNPE L KA                      RD 
Sbjct: 219 HLLLDLFAAGTDTTSSTLEWAMAELLHNPETLLKARMELLQTIGQDKQVLVNAWAIGRDP 278

Query: 80  STRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLY 128
           +T ++ +SF+P+RFLG ++D  G+NFE IPFGAGRRICP LPL I M++
Sbjct: 279 NTWENPNSFVPERFLGLDMDVKGQNFELIPFGAGRRICPGLPLAIRMVH 327

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296083378|emb|CBI23267.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147846593|emb|CAN81641.1| hypothetical protein VITISV_036425 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147846594|emb|CAN81642.1| hypothetical protein VITISV_036426 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224058639|ref|XP_002299579.1| cytochrome P450 [Populus trichocarpa] gi|222846837|gb|EEE84384.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225426693|ref|XP_002281735.1| PREDICTED: cytochrome P450 76C4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|7406712|emb|CAB85635.1| putative ripening-related P-450 enzyme [Vitis vinifera] Back     alignment and taxonomy information
>gi|125581075|gb|EAZ22006.1| hypothetical protein OsJ_05662 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|359474049|ref|XP_002275279.2| PREDICTED: cytochrome P450 76C4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741999|emb|CBI33786.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
UNIPROTKB|Q8VWZ7493 CYP76B6 "Geraniol 8-hydroxylas 0.430 0.113 0.578 1.1e-24
UNIPROTKB|D1MI46495 CYP76B10 "Geraniol 8-hydroxyla 0.415 0.109 0.555 9.4e-23
TAIR|locus:2043699512 CYP76C1 ""cytochrome P450, fam 0.376 0.095 0.551 5.7e-20
TAIR|locus:2043694511 CYP76C4 ""cytochrome P450, fam 0.392 0.099 0.490 1.5e-19
TAIR|locus:2043605512 CYP76C2 ""cytochrome P450, fam 0.430 0.109 0.491 2.3e-18
UNIPROTKB|Q6YTF1500 CYP76M8 "Ent-cassadiene C11-al 0.376 0.098 0.431 8.7e-17
TAIR|locus:2043614515 CYP76C3 ""cytochrome P450, fam 0.423 0.106 0.436 2.8e-16
TAIR|locus:2031820504 CYP71B7 ""cytochrome P450, fam 0.384 0.099 0.5 3e-16
UNIPROTKB|Q69X58500 CYP76M7 "Ent-cassadiene C11-al 0.376 0.098 0.431 9.5e-16
TAIR|locus:2012693511 CYP76C6 ""cytochrome P450, fam 0.376 0.095 0.530 5.4e-15
UNIPROTKB|Q8VWZ7 CYP76B6 "Geraniol 8-hydroxylase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
 Score = 160 (61.4 bits), Expect = 1.1e-24, Sum P(3) = 1.1e-24
 Identities = 33/57 (57%), Positives = 41/57 (71%)

Query:    74 ATSRDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLYPL 130
             A  RDE+  D A +F P+RF+ SE+D  GR+FE IPFGAGRRICP LPL +  + PL
Sbjct:   393 AIGRDETVWDDALAFKPERFMESELDIRGRDFELIPFGAGRRICPGLPLALRTV-PL 448
GO:0016099 "monoterpenoid biosynthetic process" evidence=IDA
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
UNIPROTKB|D1MI46 CYP76B10 "Geraniol 8-hydroxylase" [Swertia mussotii (taxid:137888)] Back     alignment and assigned GO terms
TAIR|locus:2043699 CYP76C1 ""cytochrome P450, family 76, subfamily C, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043694 CYP76C4 ""cytochrome P450, family 76, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6YTF1 CYP76M8 "Ent-cassadiene C11-alpha-hydroxylase 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2043614 CYP76C3 ""cytochrome P450, family 76, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031820 CYP71B7 ""cytochrome P450, family 71 subfamily B, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q69X58 CYP76M7 "Ent-cassadiene C11-alpha-hydroxylase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2012693 CYP76C6 ""cytochrome P450, family 76, subfamily C, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00026278001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (438 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 1e-10
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 6e-10
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-09
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-08
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 4e-08
pfam00067461 pfam00067, p450, Cytochrome P450 4e-07
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 6e-07
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-06
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-04
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 4e-04
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 6e-04
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 0.004
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information 
 Score = 57.4 bits (138), Expect = 1e-10
 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 74  ATSRDEST-RDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITML 127
           A SRDE     +   F P+RFL  EVDF G ++E IPFG+GRR+CP + L   ML
Sbjct: 398 AVSRDEKEWGPNPDEFRPERFLEKEVDFKGTDYEFIPFGSGRRMCPGMRLGAAML 452

Length = 502
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.97
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.96
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.96
PLN02394503 trans-cinnamate 4-monooxygenase 99.96
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.96
PLN02500490 cytochrome P450 90B1 99.96
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.96
PLN02971543 tryptophan N-hydroxylase 99.96
PLN02183516 ferulate 5-hydroxylase 99.96
PTZ00404482 cytochrome P450; Provisional 99.96
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.96
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.95
PLN03234499 cytochrome P450 83B1; Provisional 99.95
PLN02966502 cytochrome P450 83A1 99.95
PLN02774463 brassinosteroid-6-oxidase 99.95
PLN02687517 flavonoid 3'-monooxygenase 99.95
PLN00168519 Cytochrome P450; Provisional 99.95
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.95
PLN02290516 cytokinin trans-hydroxylase 99.95
PLN02738633 carotene beta-ring hydroxylase 99.95
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.95
PLN03112514 cytochrome P450 family protein; Provisional 99.95
PLN02655466 ent-kaurene oxidase 99.95
PLN03018534 homomethionine N-hydroxylase 99.94
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.94
PLN02196463 abscisic acid 8'-hydroxylase 99.94
PLN02936489 epsilon-ring hydroxylase 99.94
PLN02302490 ent-kaurenoic acid oxidase 99.94
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.94
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.94
PLN02987472 Cytochrome P450, family 90, subfamily A 99.93
PLN02648480 allene oxide synthase 99.81
PF0849259 SRP72: SRP72 RNA-binding domain; InterPro: IPR0136 81.59
PF0595257 ComX: Bacillus competence pheromone ComX; InterPro 80.52
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.97  E-value=2.7e-32  Score=204.00  Aligned_cols=108  Identities=20%  Similarity=0.245  Sum_probs=93.3

Q ss_pred             hhhHHHHHHHHHHhhh---------------hHHhHHHHHHHhccCchHHHHHHHHHHHhhChHHHHHHHh---------
Q 048633           21 RKKIKDLLGYAEEHCR---------------AESNIVKDLFDARNNTTSITTKWAMAELLHNPEALSKATS---------   76 (130)
Q Consensus        21 ~~~~~dll~~~~~~~~---------------~~~~~~~~l~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~---------   76 (130)
                      +...+|+++.+++...               +....+..+++||.|||++++++++|+|++||++|+|+|+         
T Consensus       263 ~~~r~Dfi~lll~~~~~~~~~~~~~~~lt~dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~  342 (499)
T KOG0158|consen  263 NIERNDFIDLLLDARASDFAKSKSHKALTDDEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEK  342 (499)
T ss_pred             CCCCchHHHHHHHhhcccccccccccccCHHHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhccc
Confidence            3455677777766442               2356799999999999999999999999999999999998         


Q ss_pred             -------------------------------------------------------------cCCCCCCCCCCCCCCCCCC
Q 048633           77 -------------------------------------------------------------RDESTRDHAHSFMPKRFLG   95 (130)
Q Consensus        77 -------------------------------------------------------------~d~~~~~~p~~F~P~R~l~   95 (130)
                                                                                   |||++||||++|+||||.+
T Consensus       343 ~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~~~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~  422 (499)
T KOG0158|consen  343 EGLTYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKDYEIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEE  422 (499)
T ss_pred             CCCCHHHHhCCcHHHHHHHHHHhhCCCcccccceecCceecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCC
Confidence                                                                         9999999999999999998


Q ss_pred             CCCCCCCCCccccccCCCCCCCCCHHHHHHcccc
Q 048633           96 SEVDFIGRNFESIPFGAGRRICPDLPLDITMLYP  129 (130)
Q Consensus        96 ~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~~  129 (130)
                      ++.. ..++..|+|||.|||.|+|.+||.+|+++
T Consensus       423 ~~~~-~~~~~~ylPFG~GPR~CIGmRfa~mq~K~  455 (499)
T KOG0158|consen  423 ENNK-SRHPGAYLPFGVGPRNCIGMRFALMEAKL  455 (499)
T ss_pred             Cccc-ccCCccccCCCCCccccHHHHHHHHHHHH
Confidence            7744 44577999999999999999999999875

>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PF08492 SRP72: SRP72 RNA-binding domain; InterPro: IPR013699 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF05952 ComX: Bacillus competence pheromone ComX; InterPro: IPR009233 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-11
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-05
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 7e-10
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-09
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-07
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-08
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-05
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 5e-07
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 7e-06
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 8e-05
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-05
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-05
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-05
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 6e-05
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 6e-05
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-04
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-04
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-04
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-04
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 8e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score = 58.9 bits (143), Expect = 2e-11
 Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 2/45 (4%)

Query: 74  ATSRDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICP 118
           A  R+ +      +F P R+L  + +     F ++ FG G R C 
Sbjct: 381 ALGREPTFFFDPENFDPTRWLSKDKN--ITYFRNLGFGWGVRQCL 423
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.97
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.96
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.96
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.96
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.96
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.96
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.96
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.96
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.96
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.96
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.96
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.96
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.96
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.96
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.95
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.95
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.95
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.95
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.95
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.95
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.95
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.95
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.94
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.94
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.94
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.94
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.94
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.94
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.94
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.94
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.94
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.94
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.94
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.94
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.94
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.94
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.94
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.94
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.94
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.94
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.94
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.94
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.94
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.94
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.93
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.93
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.93
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.93
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.93
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.93
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.93
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.93
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.93
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.93
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.93
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.93
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.93
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.93
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.93
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.93
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.93
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.93
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.93
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.93
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.93
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.93
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.92
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.92
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.92
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.92
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.92
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.92
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.91
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.9
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.89
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.89
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.89
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.97  E-value=2.3e-31  Score=197.15  Aligned_cols=90  Identities=31%  Similarity=0.547  Sum_probs=82.2

Q ss_pred             HhHHHHHHHhccCchHHHHHHHHHHHhhChHHHHHHHh------------------------------------------
Q 048633           39 SNIVKDLFDARNNTTSITTKWAMAELLHNPEALSKATS------------------------------------------   76 (130)
Q Consensus        39 ~~~~~~l~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~------------------------------------------   76 (130)
                      ...++++++||+|||+++++|++++|++||++|+|+++                                          
T Consensus       274 ~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~  353 (479)
T 3tbg_A          274 RIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVT  353 (479)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCC
T ss_pred             HHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccchhhhccccccccceeeeccccccccccce
Confidence            56689999999999999999999999999999999997                                          


Q ss_pred             ----------------------------cCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccCCCCCCCCCHHHHHHccc
Q 048633           77 ----------------------------RDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLY  128 (130)
Q Consensus        77 ----------------------------~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~  128 (130)
                                                  |||++|+||++|+||||++++... ..+..|+|||+|+|.|||++||++||+
T Consensus       354 ~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~-~~~~~~~pFG~G~R~C~G~~lA~~e~~  432 (479)
T 3tbg_A          354 HMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHF-VKPEAFLPFSAGRRACLGEPLARMELF  432 (479)
T ss_dssp             EECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCB-CCCTTCCTTCCSTTSCTTHHHHHHHHH
T ss_pred             eecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCccc-CCCCceecCCCCCcCChhHHHHHHHHH
Confidence                                        999999999999999999876432 346689999999999999999999997


Q ss_pred             c
Q 048633          129 P  129 (130)
Q Consensus       129 ~  129 (130)
                      .
T Consensus       433 ~  433 (479)
T 3tbg_A          433 L  433 (479)
T ss_dssp             H
T ss_pred             H
Confidence            5
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-07
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-07
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 6e-07
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 7e-07
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 7e-07
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-04
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 0.001
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 0.001
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 0.001
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 0.002
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 0.002
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 0.003
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 46.8 bits (109), Expect = 1e-07
 Identities = 13/42 (30%), Positives = 18/42 (42%)

Query: 77  RDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICP 118
           R        H F+P R+     + +   +  IPFGAGR  C 
Sbjct: 350 RIPEDFPDPHDFVPARYEQPRQEDLLNRWTWIPFGAGRHRCV 391
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.96
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.96
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.96
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.95
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.95
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.94
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.94
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.94
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.93
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.93
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.93
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.92
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.92
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.91
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.89
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.89
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.89
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.89
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.88
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.87
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.86
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=8e-30  Score=184.80  Aligned_cols=90  Identities=26%  Similarity=0.355  Sum_probs=82.1

Q ss_pred             HhHHHHHHHhccCchHHHHHHHHHHHhhChHHHHHHHh------------------------------------------
Q 048633           39 SNIVKDLFDARNNTTSITTKWAMAELLHNPEALSKATS------------------------------------------   76 (130)
Q Consensus        39 ~~~~~~l~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~------------------------------------------   76 (130)
                      ...+..+++||+|||+++++|++++|+.||++|+++++                                          
T Consensus       262 ~~~~~~~l~ag~~tt~~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~~~~~~~~~l~~lp~l~a~~~Et~Rl~~~~~~~~~  341 (463)
T d3czha1         262 IFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIF  341 (463)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHHHHHCSSTTCSC
T ss_pred             HHHHHHHHhhhhccchhhhhhHHHhhccCcHHHHHHHHHHHhhcCCCCCCCHHHHHhhhhcccccceeeeeeccccccce
Confidence            56689999999999999999999999999999999997                                          


Q ss_pred             ----------------------------cCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccCCCCCCCCCHHHHHHccc
Q 048633           77 ----------------------------RDESTRDHAHSFMPKRFLGSEVDFIGRNFESIPFGAGRRICPDLPLDITMLY  128 (130)
Q Consensus        77 ----------------------------~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~  128 (130)
                                                  +||++|+||++|+||||++.+.. ...+..|+|||+|+|.|||++||++||+
T Consensus       342 r~~~~~~~~~g~~ipkG~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~-~~~~~~~~~FG~G~r~C~G~~~A~~~~~  420 (463)
T d3czha1         342 HATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGY-FAKKEALVPFSLGRRHCLGEHLARMEMF  420 (463)
T ss_dssp             EECSSCEEETTEEECTTCEEEEEHHHHHTCTTTCSSTTSCCGGGGBCTTSC-BCCCTTCCTTCCSTTCCTTHHHHHHHHH
T ss_pred             ecccCCcccCCcEECCCCcccCcHHHhhCCcccCCChhhcCccccCCCccc-cCCCCceeCCCCCCcCCchHHHHHHHHH
Confidence                                        99999999999999999987643 2345689999999999999999999987


Q ss_pred             c
Q 048633          129 P  129 (130)
Q Consensus       129 ~  129 (130)
                      +
T Consensus       421 ~  421 (463)
T d3czha1         421 L  421 (463)
T ss_dssp             H
T ss_pred             H
Confidence            5
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure